We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Formic acid (RMDB00142)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-28 10:58:02
Accession Number RMDB00142
Common Name Formic acid
Description Formic acid is the simplest carboxylic acid. Formate is an intermediate in normal metabolism. It takes part in the metabolism of one-carbon compounds and its carbon may appear in methyl groups undergoing transmethylation. It is eventually oxidized to carbon dioxide. In nature, formic acid is found in the stings and bites of many insects of the order Hymenoptera, including bees and ants. The principal use of formic acid is as a preservative and antibacterial agent in livestock feed. When sprayed on fresh hay or other silage, it arrests certain decay processes and causes the feed to retain its nutritive value longer.
Synonyms
  1. Add-F
  2. Ameisensaure
  3. Aminate
  4. Aminic acid
  5. Bilorin
  6. Collo-Bueglatt
  7. Collo-Didax
  8. Formate
  9. Formira
  10. Formisoton
  11. Formylate
  12. Formylic acid
  13. Hydrogen carboxylate
  14. Hydrogen carboxylic acid
  15. Methanoate
  16. Methanoic acid
  17. Methanoic acid monomer
  18. Myrmicyl
  19. Sybest
  20. Wonderbond Hardener M 600L
  21. Sodium Formate
Chemical IUPAC Name Formic acid
Chemical Formula CH2O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Fatty Acids
Sub Class
  • Short chain fatty acids
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 46.025
Monoisotopic Molecular Weight 46.005478
Isomeric SMILES OC=O
Canonical SMILES OC=O
KEGG Compound ID C00058 Link Image
BioCyc ID FORMATE Link Image
BiGG ID 33693 Link Image
Wikipedia Link Formic acid Link Image
METLIN ID 3202 Link Image
PubChem Compound 284 Link Image
PubChem Substance 8023639 Link Image
ChEBI ID 15740 Link Image
CAS Registry Number 64-18-6
InChI Identifier InChI=1/CH2O2/c2-1-3/h1H,(H,2,3)
Synthesis Reference Finholt, Albert E.; Jacobson, Eugene C. The reduction of carbon dioxide to formic acid with lithium aluminum hydride. Journal of the American Chemical Society (1952), 74 3943-4.
Melting Point (Experimental) 8.4 oC
Experimental Water Solubility 1000.0 mg/mL [RIDDICK,JA et al. (1986)] Source: PhysProp
Predicted Water Solubility 477.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Liquid
Experimental LogP/Hydrophobicity -0.54 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -0.47 [Predicted by ALOGPS]; -0.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1AQ6 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • endoplasmic reticulum
  • Extracellular
  • mitochondria
  • nucleus
Biofluid Location
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 159.7 +/- 45.8 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 329.0 +/- 11.3 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal)
Biofluid Rumen
Value 163 +/- 33 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 160 +/- 45 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 276 +/- 304 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Lanosterol 14-alpha demethylase
  2. S-formylglutathione hydrolase
  3. Monofunctional C1-tetrahydrofolate synthase, mitochondrial
Enzyme 1 [top]
Enzyme 1 ID 14
Enzyme 1 Name Lanosterol 14-alpha demethylase
Enzyme 1 Synonyms
  1. LDM
  2. Cytochrome P450 51A1
  3. CYPLI
  4. P450LI
  5. Sterol 14-alpha demethylase
  6. P450-14DM
  7. P45014DM
Enzyme 1 Gene Name CYP51A1
Enzyme 1 Protein Sequence >Lanosterol 14-alpha demethylase
MLDLLQAGGSVLGQAMEQVTGGNLASMLLIACAFTLSLVYLFRLAVGHLAPPLPTGAKSP
PYIVSPIPFLGHAIAFGKSPIEFLEDAYEKYGPVFSFTMVGKTFTYLLGSEAAALLFNSK
NEDLNAEEVYSRLTTPVFGKGVAYDVPNTVFLEQKKMLKSGLNIAHFRQHVSIIEKETKE
YFKSWGESGEKNLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLL
PGWLPLPSFRRRDRAHREIKNIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEV
AGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCFLEQKTVCGENLPPLTYDQLKDLN
LLDRCIKETLRLRPPIMTMMRLAKTPLTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDF
NPDRYLEDSPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPT
VNYTTMIHTPEKPIIRYKRRSK
Enzyme 1 Number of Residues 502
Enzyme 1 Molecular Weight 56595.9
Enzyme 1 Theoretical pI 8.25
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Catalyzes C14-demethylation of lanosterol; it transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol
Enzyme 1 Pathways
  • Steroid biosynthesis
  • zymosterol biosynthesis
  • zymosterol from lanosterol:step 1/6
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 22-42
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 67866950 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q4PJW3 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name CP51A_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1509 bp
ATGCTGGACTTACTGCAGGCGGGCGGGTCAGTGCTGGGGCAGGCGATGGAGCAAGTAACG
GGCGGCAACCTCGCATCCATGCTGCTCATCGCCTGCGCCTTCACGCTTAGTCTGGTCTAC
CTGTTCCGCCTCGCGGTTGGCCACCTGGCCCCACCACTGCCGACTGGGGCGAAAAGTCCA
CCATACATTGTCTCTCCAATTCCATTCCTTGGACATGCTATAGCATTTGGGAAAAGTCCA
ATTGAATTCCTAGAAGATGCATATGAGAAGTATGGACCTGTATTTAGTTTTACCATGGTG
GGAAAGACGTTTACCTACCTGCTGGGGAGTGAGGCTGCTGCACTGCTTTTTAATAGTAAA
AATGAAGACTTGAATGCCGAGGAAGTCTACAGTCGTCTGACGACACCTGTGTTTGGGAAG
GGAGTTGCCTATGATGTGCCTAATACAGTTTTCTTGGAGCAGAAGAAAATGTTGAAAAGT
GGTCTTAACATAGCCCACTTTAGACAGCACGTGTCTATAATTGAAAAAGAAACAAAAGAA
TACTTTAAAAGTTGGGGAGAAAGTGGAGAAAAAAATTTGTTTGAAGCTCTTTCTGAGCTC
ATCATTTTAACAGCCAGCCATTGTTTACATGGAAAGGAAATCAGAAGTCAACTCAACGAG
AAGGTGGCACAACTGTATGCGGATTTGGATGGAGGTTTTAGCCATGCAGCCTGGCTTTTG
CCAGGCTGGCTCCCTCTGCCTAGTTTCAGACGCAGGGACAGAGCTCATCGGGAGATCAAG
AATATTTTCTACAAGGCAATCCAGAAACGCAGAGAGTCAGGAGAAAAAATTGATGACATT
CTCCAAACTTTACTAGAGTCTACTTACAAGGATGGGCGTCCTCTGACGGATGATGAAGTA
GCAGGCATGCTTATTGGACTGCTCTTGGCAGGGCAGCATACTTCTTCAACTACCAGTGCC
TGGATGGGCTTCTTTTTGGCCAGAGACAAAACACTTCAAGAAAAATGTTTCTTAGAACAG
AAAACAGTCTGTGGTGAGAATCTGCCTCCTCTGACTTATGACCAGCTCAAGGATCTCAAT
TTACTTGATCGCTGTATAAAAGAAACATTAAGACTTCGACCTCCTATAATGACCATGATG
AGACTGGCCAAAACTCCTCTGACTGTGGCAGGGTACACCATTCCTCCAGGACACCAGGTG
TGTGTGTCTCCTACTGTCAATCAGAGACTTAAAGACTCATGGGTAGAGCGTCTGGACTTC
AATCCTGACCGCTACTTAGAGGACAGCCCAGCATCAGGAGAGAAGTTTGCTTACGTGCCA
TTTGGAGCTGGGCGTCATCGTTGCATTGGGGAGAATTTTGCCTATGTTCAAATCAAGACA
ATTTGGTCCACTATGCTTCGTTTATATGAATTTGATCTCATTGATGGGTATTTTCCCACT
GTGAATTATACAACTATGATTCACACCCCTGAAAAACCCATCATCAGATACAAACGAAGA
TCAAAATGA
Enzyme 1 GenBank Gene ID DQ078267 Link Image
Enzyme 1 GeneCard ID CYP51A1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:7
Enzyme 1 Locus 7q21.2-q21.3|7q21.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 117
Enzyme 2 Name S-formylglutathione hydrolase
Enzyme 2 Synonyms
  1. FGH
  2. Esterase D
Enzyme 2 Gene Name ESD
Enzyme 2 Protein Sequence >S-formylglutathione hydrolase
MALKQVSSSKCFGGLQKVFEHDSVELKCKMKFAVYLPPKAETGKCPVLYWLSGLTCTEQN
FISKSGYHQAASEHGLVVIAPDTSPRGCNIKGEEDSWDFGTGAGFYVDATEDLWKTNYRM
YSYVTKELPQLVNDNFPVDPQRMSVFGHSMGGHGALICALKNPGKYKSVSAFAPLCNPVL
CRWGKKAFTGYLGTDQSKWEAYDATYLVKSYPGPQLDILIDQGKEDEFLSDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFIADHIRHHAKYLNA
Enzyme 2 Number of Residues 282
Enzyme 2 Molecular Weight 31547.7
Enzyme 2 Theoretical pI 6.97
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in carboxylesterase activity
Enzyme 2 Specific Function Serine hydrolase involved in the detoxification of formaldehyde
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 115305246 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q08E20 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name ESTD_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >849 bp
ATGGCCCTGAAACAGGTTTCCAGCAGCAAGTGCTTTGGTGGACTGCAGAAAGTTTTTGAA
CATGACAGTGTTGAACTGAAGTGCAAAATGAAATTTGCTGTCTATTTACCACCAAAGGCA
GAAACTGGAAAATGCCCTGTGCTATATTGGCTGTCTGGTTTAACTTGCACAGAACAAAAT
TTTATATCAAAATCTGGTTACCATCAAGCTGCTTCGGAACACGGCCTTGTCGTCATTGCC
CCAGATACCAGCCCTCGTGGCTGCAATATTAAAGGAGAAGAGGACAGCTGGGACTTCGGC
ACTGGCGCTGGGTTTTATGTCGATGCTACTGAAGATCTTTGGAAAACTAACTATAGAATG
TACTCTTACGTAACGAAGGAGCTTCCCCAACTTGTAAATGACAATTTCCCAGTGGACCCC
CAAAGGATGTCTGTTTTTGGCCACTCTATGGGAGGCCATGGAGCTCTGATTTGTGCTTTG
AAGAATCCTGGAAAATACAAATCTGTGTCAGCATTTGCTCCACTTTGCAACCCAGTGCTC
TGTCGTTGGGGCAAAAAAGCCTTTACCGGATATTTGGGAACAGATCAAAGTAAATGGGAG
GCTTATGATGCTACCTATCTTGTGAAGTCCTATCCAGGTCCTCAGCTGGATATACTAATT
GATCAAGGGAAAGAGGACGAGTTCCTTTCCGACGGACAGTTACTGCCTGATAACTTCATA
GCTGCCTGTACAGAAAAGAAAATCCCTGTTGTTTTCAGATTGCAAGAGGGTTATGATCAC
AGCTACTACTTTATTGCAACCTTTATCGCTGATCACATCAGACATCATGCAAAATATCTG
AATGCATGA
Enzyme 2 GenBank Gene ID BC123461 Link Image
Enzyme 2 GeneCard ID ESD Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 13q14.1-q14.2
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 118
Enzyme 3 Name Monofunctional C1-tetrahydrofolate synthase, mitochondrial
Enzyme 3 Synonyms
  1. Formyltetrahydrofolate synthetase
Enzyme 3 Gene Name MTHFD1L
Enzyme 3 Protein Sequence >Monofunctional C1-tetrahydrofolate synthase, mitochondrial
MSARLPFVLRRLARPQHPGSPRRLPSLCRASSGRGSGCGGGEGLLGQQRLRDTQAGSSRG
PGSPAPPARDSIVREVIQNSKEVLSLLQEKTPTFKPVLAIIQAGDDNLMQEVNQNLAEEA
GLNITHICLPAESGEDEIIDEILKINEDSRVHGLALQIAETSFSNKILNALKPEKDVDGL
TDVNLGKLVRGDAHECFISPVARAVIELLEKSGVSLDGKKILVIGAHGSLEATLQCLFQR
KGSMTMSSQWKTPQLQGKLQEADIVVLGSPKPEEIPLSWIQPGTTVFNCSHDFLSGKAAC
ISSGVHGISPIAEDVSLLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPVPSDI
EISRAQTPKAVEILAKEIGLLADEIEIYGKSKAKVRLSLLERLKDQADGKYVLVAGITPT
PLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEFNL
HLTGDIHAITAANNLLAAAIDARILHENTQTDKALYNRLVPSVNGVREFSKIQLARLKRL
GINKTDPSALTEEEMRKFARLDIDPSTITWQRVVDTNDRFLRKITIGQANTEKGCSRQAQ
FDIAVASEIMAVLALTDSLSDMKERLGRMVVASDRNGQPVTADDLGVTGALTVLMKDAIK
PNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEGGFVVTEAGFGADIGMEKF
FNIKCRASGLVPSVVVLVATVRALKMHGGGPSVTAGVPLRKEYTEENLQLVADGCCNLEK
QIQIAQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFNAVPCYHWSIGGKGSVDLAW
AVREAASKESRFQFLYDVQLPIVEKIRTIAQSVYGAKDIELSPEAQSKIDRYTEQGFGNL
PICMAKTHLSLSHQPDKKGVPKGFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFY
DIDLDTETEQVKGLF
Enzyme 3 Number of Residues 975
Enzyme 3 Molecular Weight 105226.2
Enzyme 3 Theoretical pI 7.78
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Nucleotide transport and metabolism
Enzyme 3 Specific Function May provide the missing metabolic reaction required to link the mitochondria and the cytoplasm in the mammalian model of one-carbon folate metabolism in embryonic an transformed cells complementing thus the enzymatic activities of MTHFD2
Enzyme 3 Pathways
  • One-carbon metabolism
  • tetrahydrofolate interconversion
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 111308519 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q0VCR7 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name C1TM_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >2928 bp
ATGAGCGCGCGCCTGCCGTTCGTCCTGCGCCGGCTCGCGCGCCCGCAGCACCCCGGCTCG
CCGCGCCGCCTCCCATCTCTTTGTCGCGCCAGCAGCGGCAGGGGCAGCGGATGTGGCGGC
GGGGAGGGTCTCCTCGGGCAACAGCGGCTGCGGGATACCCAGGCCGGGAGCAGCCGGGGC
CCGGGCAGCCCGGCGCCCCCAGCTCGGGACTCGATCGTCCGAGAAGTCATTCAGAATTCG
AAAGAAGTTCTGAGTTTATTGCAAGAAAAGACCCCTACCTTTAAGCCGGTTCTTGCTATT
ATTCAGGCAGGTGATGATAACTTGATGCAAGAAGTAAACCAGAATTTGGCTGAGGAGGCT
GGTCTGAACATCACCCACATCTGCCTTCCTGCGGAGAGCGGGGAAGATGAGATTATAGAT
GAGATCCTGAAGATTAATGAAGACAGCAGAGTACATGGCCTTGCCCTTCAGATCGCTGAG
ACCTCATTTAGCAACAAAATCCTCAATGCTTTGAAACCAGAAAAAGATGTGGATGGATTA
ACGGATGTCAACCTGGGGAAGTTGGTCCGAGGAGATGCCCATGGGTGTTTTATTTCACCT
GTGGCCAGAGCTGTAATCGAACTTCTTGAAAAGTCAGGTGTCAGCTTAGATGGAAAGAAG
ATCTTGGTAATAGGAGCCCATGGGTCTTTGGAAGCCACCCTACAATGTCTGTTCCAGAGA
AAAGGGTCCATGACAATGAGCTCCCAGTGGAAAACACCTCAGCTTCAAGGCAAGCTACAG
GAGGCTGATATTGTGGTCTTGGGCTCACCCAAGCCAGAAGAGATCCCCCTTTCTTGGATT
CAACCGGGAACTACTGTTTTCAACTGTTCGCATGACTTTCTATCAGGGAAGGCTGCATGC
ATTTCTTCTGGCGTCCATGGTATTAGTCCCATCGCCGAAGATGTGAGTCTCCTTGCTGCT
GCTCTGCGGATTCAGAACATGGTCAGCAGCGGAAGGAGATGGCTCCGTGAGCAGCAGCAC
CGCAGATGGAGACTTCACTGCTTGAAACTTCAGCCTCTGTCCCCTGTACCAAGTGATATC
GAGATTTCGAGAGCGCAGACTCCAAAAGCTGTGGAGATCCTTGCCAAGGAGATAGGATTG
CTTGCAGACGAAATTGAAATCTATGGCAAAAGCAAAGCCAAAGTACGTTTGTCCTTGTTG
GAAAGGTTAAAGGATCAAGCAGATGGAAAATACGTCTTGGTTGCTGGGATCACACCCACC
CCTCTTGGAGAAGGAAAAAGTACAGTTACAATTGGGCTTGTACAGGCATTGACTGCGCAC
CTGAACGTCAACTCCTTTGCCTGTCTCAGGCAGCCTTCTCAAGGACCAACTTTCGGAGTT
AAAGGAGGAGCTGCAGGTGGTGGATATGCCCAGGTCATCCCTATGGAGGAGTTCAACCTT
CACCTTACTGGGGACATCCACGCCATTACTGCTGCCAATAATTTGCTGGCTGCCGCTATC
GACGCAAGGATTTTGCATGAAAACACTCAAACAGATAAGGCCCTGTATAATCGACTGGTT
CCTTCAGTGAATGGTGTTCGAGAATTTTCAAAAATTCAACTTGCTCGGCTGAAAAGACTG
GGAATAAATAAGACTGATCCGAGTGCGCTGACAGAAGAGGAAATGAGGAAATTTGCCCGT
CTTGACATCGACCCCTCCACCATCACATGGCAGAGAGTTGTGGATACCAATGACCGATTT
CTACGGAAAATAACCATTGGGCAGGCGAACACAGAGAAGGGCTGTTCCCGGCAGGCGCAG
TTTGACATCGCAGTGGCCAGTGAAATCATGGCAGTGCTGGCTCTGACCGACAGCCTATCG
GACATGAAGGAGCGGCTGGGAAGAATGGTGGTGGCCAGTGACAGAAATGGACAGCCTGTG
ACAGCAGACGACTTGGGGGTGACAGGTGCTTTGACTGTTCTGATGAAAGACGCGATAAAA
CCAAATCTGATGCAGACCCTAGAAGGGACGCCTGTATTTGTGCATGCTGGCCCCTTTGCC
AACATCGCTCATGGCAACTCTTCAGTGTTGGCTGATAAAATTGCCCTGAAACTGGTTGGG
GAAGGAGGATTTGTGGTGACTGAAGCTGGCTTTGGTGCTGATATTGGCATGGAGAAATTC
TTCAACATCAAGTGCAGAGCTTCTGGTTTGGTGCCCAGCGTTGTGGTTCTGGTGGCGACC
GTGCGGGCTCTGAAGATGCATGGAGGTGGACCGAGCGTAACTGCTGGGGTCCCTCTTAGA
AAGGAATATACCGAAGAGAACCTCCAGCTGGTGGCAGATGGCTGCTGTAACCTGGAGAAG
CAAATTCAGATCGCTCAGCTCTTCGGGGTCCCTGTTGTTGTGGCTCTGAATGTCTTCAAG
ACCGACACCCGCGCAGAGATTGACTTGGTGTGTGAGCTTGCGAAGCGGGCCGGCGCCTTC
AATGCAGTCCCCTGCTATCACTGGTCGATTGGTGGGAAAGGGTCAGTGGACCTGGCTTGG
GCTGTGAGAGAAGCTGCAAGCAAAGAAAGTCGTTTCCAGTTCCTGTATGATGTGCAGCTT
CCAATTGTGGAAAAGATAAGAACCATTGCCCAGTCTGTCTATGGAGCCAAAGATATTGAA
CTCTCTCCAGAAGCACAATCCAAAATAGATCGTTACACGGAACAGGGATTTGGAAATTTG
CCCATCTGCATGGCGAAGACCCACCTCTCCCTGTCTCACCAACCTGACAAGAAAGGCGTA
CCCAAGGGTTTCATTCTACCCATTAGTGACGTCCGGGCCAGCATAGGCGCCGGATTCATT
TACCCATTGGTTGGAACGATGAGCACCATGCCAGGACTGCCAACTCGGCCCTGCTTCTAC
GACATAGATCTTGATACAGAAACAGAGCAGGTTAAAGGCTTGTTCTGA
Enzyme 3 GenBank Gene ID BC120038 Link Image
Enzyme 3 GeneCard ID MTHFD1L Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:6
Enzyme 3 Locus 6q25.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available