We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Ethanolamine (RMDB00149)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-29 16:20:31
Accession Number RMDB00149
Common Name Ethanolamine
Description A viscous, hygroscopic amino alcohol with an ammoniacal odor. It is widely distributed in biological tissue and is a component of lecithin. It is used as a surfactant, fluorometric reagent, and to remove CO2 and H2S from natural gas and other gases.
Synonyms
  1. 1-Amino-2-hydroxyethane
  2. 2-Amino-1-ethanol
  3. 2-Aminoethanol
  4. 2-Aminoethyl alcohol
  5. 2-Ethanolamine
  6. 2-Hydroxyethanamine
  7. 2-Hydroxyethylamine
  8. Aethanolamin
  9. Aminoethanol
  10. Colamine
  11. ETA
  12. Envision Conditioner PDD 9020
  13. Ethanolamine
  14. Ethylolamine
  15. Glycinol
  16. H-Glycinol
  17. MEA
  18. Monoaethanolamin
  19. Monoethanolamine
  20. Olamine
  21. b-Aminoethanol
  22. b-Aminoethyl alcohol
  23. b-Ethanolamine
  24. b-Hydroxyethylamine
  25. beta-Aminoethanol
  26. beta-Aminoethyl alcohol
  27. beta-Hydroxyethylamine
  28. beta-ethanolamine
Chemical IUPAC Name 2-aminoethanol
Chemical Formula C2H7NO
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Alcohols
Class
  • Amino Alcohols
Sub Class
  • Primary amino alcohols
Family
  • Mammalian_Metabolite
Species
  • primary alcohol; 1,2-aminoalcohol; primary amine; primary aliphatic amine (alkylamine)
Biofunction
  • Component of Glycerophospholipid metabolism
Application
Source
  • Endogenous
Average Molecular Weight 61.083
Monoisotopic Molecular Weight 61.052765
Isomeric SMILES NCCO
Canonical SMILES NCCO
KEGG Compound ID C00189 Link Image
BioCyc ID ETHANOL-AMINE Link Image
BiGG ID 34189 Link Image
Wikipedia Link Ethanolamine Link Image
METLIN ID 3207 Link Image
PubChem Compound 700 Link Image
PubChem Substance 583749 Link Image
ChEBI ID 16000 Link Image
CAS Registry Number 141-43-5
InChI Identifier InChI=1/C2H7NO/c3-1-2-4/h4H,1-3H2
Synthesis Reference Soucaille, Philippe. Ethanolamine production by fermentation of genetically modified Escherichia coli. PCT Int. Appl. (2007), 23pp.
Melting Point (Experimental) 10.5 oC
Experimental Water Solubility 1000.0 mg/mL [RIDDICK,JA et al. (1986)] Source: PhysProp
Predicted Water Solubility 849.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 1
State Liquid
Experimental LogP/Hydrophobicity -1.31 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.53 [Predicted by ALOGPS]; -1.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1AII Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 85.85 +/- 32.69 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 73 +/- 15 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 152 +/- 55 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 134 +/- 55 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Enzyme 1 [top]
Enzyme 1 ID 177
Enzyme 1 Name Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Enzyme 1 Synonyms
  1. E-NPP 2
  2. Extracellular lysophospholipase D
  3. LysoPLD
  4. Autotaxin
Enzyme 1 Gene Name ENPP2
Enzyme 1 Protein Sequence >Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
MARRRSCQLHQVISLFTFAVGVNICLGVTANRIKRAEGWGEGPPTVLSDSPSINISGSCK
GRCFELQEAGPPDCRCDNLCKSYSSCCLDFDELCLKTAGGWECTKDRCGEVRNEDHACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
HFNLRGREKFNHRWWGGQPLWITATKQGVIAGTFFWPVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLRDIDKTVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDIILVPGTLGRIRPKFNNHAKYDPKVIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDVHLLVERRWHVARKPLEVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTVPEEVTRPNYPGVMYLQSDFDLGCTCDDKAEPKNKLDELNKHLHIKESTEAETRKFR
GSKNEIKENVNGNFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYT
VSKQADVSDIPAHLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYGFLFPPYLSSSPEAKYD
AFLVTNMVPMYPAFKRIWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTQDKIKQ
YVEGSSVPVPTHYYSILTSCLDFTQPADRCDGPLSVSAFVLPHRPDNDESCNSSEDESKW
VEELLKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLQTYESEI
Enzyme 1 Number of Residues 888
Enzyme 1 Molecular Weight 101715.9
Enzyme 1 Theoretical pI 7.56
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in alkylglycerophosphoethanolamine phosphodies
Enzyme 1 Specific Function Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility- related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-27
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 119224048 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A1A4K5 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ENPP2_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >2667 bp
ATGGCCAGGAGACGCTCCTGCCAGCTCCATCAGGTGATATCTCTGTTCACTTTTGCCGTC
GGTGTCAATATCTGCTTAGGAGTCACAGCAAATCGAATTAAGAGGGCAGAAGGATGGGGT
GAAGGCCCTCCTACAGTGTTATCAGACTCCCCCTCGATCAACATCTCTGGGTCTTGCAAG
GGCAGATGCTTTGAACTTCAAGAGGCTGGACCCCCTGATTGTCGATGTGACAACTTGTGT
AAGAGCTATAGCAGCTGCTGCCTTGACTTTGATGAGCTCTGCTTGAAGACAGCTGGTGGC
TGGGAGTGTACCAAGGACAGATGCGGAGAAGTAAGAAATGAAGACCATGCTTGTCACTGC
TCGGAGGACTGCTTGGCCCGGGGAGACTGTTGCACTAATTACCAAGTGGTTTGCAAAGGA
GAGTCTCACTGGGTGGATGATGACTGTGAGGAAATAAAGACCCCAGAATGCCCTGCAGGG
TTCGTTCGCCCTCCGCTGATCATCTTCTCTGTGGACGGTTTCCGCGCATCGTACATGAAG
AAAGGCAGCAAGGTCATGCCTAACATCGAAAAGCTGAGGTCTTGTGGCACTCACTCCCCC
TACATGAGGCCTGTGTACCCGACGAAAACTTTCCCTAACTTATACACTCTGGCCACTGGG
CTGTATCCAGAATCACATGGAATTGTTGGCAATTCCATGTATGATCCTGTTTTTGATGCA
CATTTCAACCTTCGAGGGCGAGAGAAATTTAACCATAGGTGGTGGGGAGGTCAACCGCTA
TGGATTACAGCCACGAAGCAAGGGGTGATCGCTGGGACATTCTTCTGGCCTGTGGTGATC
CCCCACGAGCGGAGAATACTGACCATCCTGCAGTGGCTGACCCTGCCGGACCACGAAAGG
CCTTCAGTCTATGCCTTCTATTCCGAACAACCTGATTTCTCTGGACACAAGTATGGCCCC
TTTGGCCCTGAGATGACGAATCCTCTGAGGGACATTGACAAAACCGTGGGGCAGTTAATG
GATGGATTGAAGCAACTGAAGCTGCACCGCTGCGTGAATGTCATCTTCGTTGGAGACCAT
GGAATGGAAGATGTCACATGTGATAGAACAGAATTCTTGAGCAATTACCTGACTAATGTG
GATGATATTATTTTAGTGCCAGGAACTCTAGGAAGAATTCGACCCAAATTCAACAATCAT
GCTAAATATGACCCGAAAGTCATTATTGCTAATCTCACGTGTAAAAAACCAGACCAGCAC
TTTAAGCCTTACTTGAAACAGCACCTTCCCAAACGTTTGCACTACGCCAACAACAGAAGG
ATCGAAGACGTCCATTTACTGGTGGAGCGCAGATGGCACGTCGCAAGGAAACCTTTGGAG
GTTTATAAGAAACCATCAGGAAAATGTTTTTTCCAGGGAGACCACGGATTTGATAACAAG
GTCAACAGTATGCAGACTGTTTTTGTAGGTTATGGCCCAACATTTAAGTACAAGACCAAA
GTGCCTCCATTTGAAAACATTGAACTTTACAACGTTATGTGCGATCTCCTGGGATTGAAG
CCAGCTCCAAATAACGGGACCCACGGGAGTCTGAACCATCTCCTGCGTACCAACACCTTC
AGACCGACTGTGCCAGAGGAAGTCACCAGACCCAATTACCCAGGGGTTATGTACCTTCAG
TCCGATTTTGACCTGGGCTGTACCTGTGATGATAAGGCAGAGCCAAAGAACAAATTGGAT
GAACTCAACAAACACCTTCATATAAAAGAGTCCACAGAAGCTGAAACCAGGAAATTCAGA
GGCAGCAAAAATGAAATCAAGGAAAACGTTAATGGAAATTTTGAACCTAGAAAAGAGAGA
CATCTCCTCTATGGACGGCCTGCCGTGCTCTATCGGACTAGATATGATATCTTATATCAC
ACTGACTTTGAAAGCGGTTATAGTGAAATATTTCTAATGCCACTCTGGACATCATACACT
GTTTCCAAACAGGCTGACGTCTCTGACATCCCTGCACACCTGACCAACTGTGTCCGGCCC
GACGTCCGCGTTTCTCCGAGTTTCAGTCAGAGCTGTTTGGCCTACAAAAATGATAAACAG
ATGTCCTATGGATTCCTCTTTCCTCCCTATCTGAGCTCGTCCCCAGAAGCTAAATATGAT
GCATTCCTTGTAACCAATATGGTTCCAATGTATCCTGCTTTTAAACGCATCTGGAATTAT
TTCCAAAGGGTTCTGGTGAAGAAATATGCTTCAGAAAGAAATGGAGTTAATGTGATAAGT
GGACCAATCTTTGACTATGACTACGATGGCTTACACGACACACAAGACAAAATCAAACAG
TACGTGGAGGGCAGCTCCGTCCCCGTGCCCACCCACTACTACAGCATCCTCACCAGCTGC
CTGGACTTCACGCAGCCTGCCGACCGCTGCGACGGGCCGCTCTCCGTGTCCGCCTTCGTG
CTGCCCCACAGGCCCGACAACGACGAGAGCTGCAACAGCTCAGAGGACGAGTCGAAATGG
GTGGAAGAGCTTCTCAAGATGCACACAGCACGGGTGCGGGACATCGAGCATCTCACCAGC
CTGGACTTCTTCCGCAAGACCAGCCGCAGCTACCCAGAAATTCTGACCCTAAAGACGTAC
CTGCAGACGTATGAGAGCGAGATCTAG
Enzyme 1 GenBank Gene ID BC126631 Link Image
Enzyme 1 GeneCard ID ENPP2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:8
Enzyme 1 Locus 8q24.1
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available