We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Threonine (RMDB00167)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 13:40:06
Accession Number RMDB00167
Common Name L-Threonine
Description Threonine is an essential amino acid in humans. It is abundant in cows rumen, particularly in newborns. Severe deficiency of threonine causes neurological dysfunction and lameness in experimental animals. In plants and microorganisms, threonine is synthesized from aspartic acid via α-aspartyl-semialdehyde and homoserine. Homoserine undergoes O-phosphorylation; this phosphate ester undergoes hydrolysis concomitant with relocation of the OH group. Enzymes involved in a typical biosynthesis of threonine include: Threonine is an immunostimulant which promotes the growth of thymus gland. It also can probably promote cell immune defense function. This amino acid has been useful in the treatment of genetic spasticity disorders and multiple sclerosis at a dose of 1 gram daily. Increasing the threonine plasma concentrations leads to accumulation of threonine and glycine in the brain. Such accumulation affects the neurotransmitter balance which may have consequences for the brain development during early postnatal life.
Synonyms
  1. (2S,3R)-(-)-Threonine
  2. (2S,3R)-2-Amino-3-hydroxybutyrate
  3. (2S,3R)-2-Amino-3-hydroxybutyric acid
  4. (R-(R*,S*))-2-Amino-3-hydroxybutanoate
  5. (R-(R*,S*))-2-Amino-3-hydroxybutanoic acid
  6. (S)-Threonine
  7. 2-Amino-3-hydroxybutanoate
  8. 2-Amino-3-hydroxybutanoic acid
  9. 2-Amino-3-hydroxybutyrate
  10. 2-Amino-3-hydroxybutyric acid
  11. L-(-)-Threonine
  12. L-2-Amino-3-hydroxybutyrate
  13. L-2-Amino-3-hydroxybutyric acid
  14. L-alpha-Amino-beta-hydroxybutyrate
  15. L-alpha-Amino-beta-hydroxybutyric acid
  16. Threonin
  17. Threonine
  18. [R-(R*,S*)]-2-Amino-3-hydroxybutanoate
  19. [R-(R*,S*)]-2-Amino-3-hydroxybutanoic acid
  20. [R-(R*,S*)]-2-amino-3-hydroxy-Butanoate
  21. [R-(R*,S*)]-2-amino-3-hydroxy-Butanoic acid
Chemical IUPAC Name 2-amino-3-hydroxy-butanoic acid
Chemical Formula C4H9NO3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; 1,2-aminoalcohol; primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Essential amino acids; Component of Aminoacyl-tRNA biosynthesis; Component of Glycine, serine and threonine metabolism
Application
Source
  • Exogenous
Average Molecular Weight 119.119
Monoisotopic Molecular Weight 119.058243
Isomeric SMILES C[C@@H](O)[C@H](N)C(O)=O
Canonical SMILES CC(O)C(N)C(O)=O
KEGG Compound ID C00188 Link Image
BioCyc ID THR Link Image
BiGG ID 34186 Link Image
Wikipedia Link L-Threonine Link Image
METLIN ID 32 Link Image
PubChem Compound 6288 Link Image
PubChem Substance 841559 Link Image
ChEBI ID 16857 Link Image
CAS Registry Number 72-19-5
InChI Identifier InChI=1/C4H9NO3/c1-2(6)3(5)4(7)8/h2-3,6H,5H2,1H3,(H,7,8)/t2-,3+/m1/s1
Synthesis Reference Fujita, Chuzo; Nara, Takashi; Samejima, Hirotoshi; Kinoshita, Shukuo. L-Threonine fermentation. I. Microbial conversion of L-homoserine to L-threonine. Nippon Nogei Kagaku Kaishi (1965), 39(6), 2
Melting Point (Experimental) 256 oC
Experimental Water Solubility 97.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 477.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -2.94 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -3.01 [Predicted by ALOGPS]; -3.5 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1EVK Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
Biofluid Location
  • Rumen
  • Blood
  • Cow_Milk
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 113.5 (37.0-190.0) uM
Age N/A
Sex Both
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments This concentration measured after 1 hour of feeding.; The three amino acids (AA), threonine, methionine and Lysine were administered intraruminally in mixtures at dosages of 100, 200, 300, and 400 mmol of each,together with polyethylene glycol (PEG) as a liquid marker.
References
Biofluid Rumen
Value 24.45 +/- 7.32 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 28 +/- 7 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 35 +/- 22 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 41 +/- 29 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. L-serine dehydratase
  2. Probable threonyl-tRNA synthetase 2, cytoplasmic
  3. L-threonine 3-dehydrogenase, mitochondrial
  4. Threonyl-tRNA synthetase, cytoplasmic
Enzyme 1 [top]
Enzyme 1 ID 88
Enzyme 1 Name L-serine dehydratase
Enzyme 1 Synonyms
  1. L-serine deaminase
Enzyme 1 Gene Name SDS
Enzyme 1 Protein Sequence >L-serine dehydratase
MMSGRPLHMETPVRDSMTLSKVAGTTAYLKLDSAQPSGSFKIRGIGHLCKMWAERGCEHF
VCSSAGNAGMAAAYAARKLGIPSTIVVPSTTPALTIQRLKNEGATVKVVGETLDEAIRVA
KDLEKNNSGWVYVPPFDDPLIWEGHSSIVKELKETMTEKPGAIVLAVGGGGLLCGVVQGL
AEVGWRDVPVITMETIGAESFHASTKAGKLVTLPCITSVAKALGVTTVAAQAMKVYREHP
IFSEVVSDQEAVAALEKFVDDEKILVEPACGAALAAVYSNVIQKLQGEGKLRTPLSSLVV
IVCGGSNISLAQLVALKKQLGMDGLSQ
Enzyme 1 Number of Residues 327
Enzyme 1 Molecular Weight 34440.8
Enzyme 1 Theoretical pI 7.44
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function L-serine = pyruvate + NH(3)
Enzyme 1 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 111307504 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q0VCW4 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SDHL_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >984 bp
ATGATGTCAGGAAGACCCTTGCACATGGAAACTCCGGTCCGTGACAGCATGACTCTGTCT
AAAGTGGCTGGCACCACGGCCTATCTCAAGCTAGACAGTGCCCAGCCCTCCGGCTCCTTC
AAGATCCGGGGCATCGGACACCTCTGCAAAATGTGGGCCGAGCGGGGCTGCGAGCATTTC
GTCTGCTCCTCAGCGGGCAATGCAGGCATGGCAGCCGCCTATGCTGCCAGGAAGCTGGGC
ATCCCCTCCACGATTGTCGTGCCCAGCACCACGCCTGCCCTCACCATCCAGCGGCTCAAG
AATGAGGGCGCCACGGTCAAAGTGGTGGGTGAGACATTGGATGAGGCCATCAGAGTGGCC
AAGGACCTGGAGAAAAACAACTCAGGCTGGGTCTATGTCCCCCCCTTTGACGACCCCCTC
ATCTGGGAAGGCCACTCTTCCATCGTGAAGGAGCTGAAGGAGACGATGACCGAAAAGCCA
GGGGCCATCGTGCTGGCAGTAGGGGGCGGAGGCCTCTTGTGCGGAGTGGTTCAGGGGCTG
GCAGAGGTGGGCTGGAGGGACGTGCCCGTCATCACCATGGAGACCATCGGAGCAGAGAGC
TTCCACGCTTCCACCAAGGCCGGCAAGCTCGTCACCCTGCCCTGCATTACCAGTGTTGCC
AAAGCCCTGGGCGTGACCACCGTGGCAGCGCAGGCTATGAAGGTTTATCGGGAACATCCC
ATTTTCTCTGAAGTTGTCTCGGACCAGGAAGCTGTGGCCGCTCTTGAGAAGTTTGTGGAT
GATGAGAAGATCCTGGTGGAGCCCGCCTGTGGGGCCGCCCTGGCCGCCGTCTACAGCAAC
GTGATTCAGAAGCTGCAAGGAGAGGGGAAACTCCGCACCCCGCTGTCCTCCCTCGTGGTC
ATTGTTTGTGGGGGCAGCAACATCAGCCTGGCGCAGCTGGTGGCGCTCAAGAAGCAGCTG
GGCATGGACGGGCTGTCCCAGTGA
Enzyme 1 GenBank Gene ID BC119966 Link Image
Enzyme 1 GeneCard ID SDS Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 12q24.13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 384
Enzyme 2 Name Probable threonyl-tRNA synthetase 2, cytoplasmic
Enzyme 2 Synonyms
  1. Threonine--tRNA ligase
  2. ThrRS
  3. Threonyl-tRNA synthetase-like protein 2
Enzyme 2 Gene Name TARSL2
Enzyme 2 Protein Sequence >Probable threonyl-tRNA synthetase 2, cytoplasmic
MAAEALAAEAVASRLARQEEDIRWLWAEVHRLRDEQLNAPDRCQAEGPCLTREVAQLRAE
NRELRHCLYRLRLCLAEELSHQARLESAARAEAGRAAAGAQPPPSQSLEEDVKKEIDPDN
EVKNPPNFMKERLKFFEILKKDHQLLLAIYEKKGDSSNVITVRVADGRTVKGEAWKTTPY
QVAAEISQELAETTVVAKVNGELWDLDRPLEGDATVELLTFEDEEARAVYWHSSAHVLGE
ALELHYGGLLCCSPPGDGSFHYDVYLEDRAVSSAELPVLESMCQAIIKEQQPFERLEVST
KVLLDLFKYNKFKCRILKEKVATPTTTVYRCGPLVELCKGPHVRHTGTIKVIKIFKNSLA
YWADNPEMEMLQRVYGVSFPDEQRMAAWEELQEEARARDHRTIGKEQELFFFHDLSPGSC
FFLPRGACIYNTLIDFIREQHHQRNFTEVLSPNMYSCKLWEASGHWQHYSENMFTFDIDK
DTFALKPMNCPGHCLMFAHRPRSWREMPIRLADFGVLHRNEPSGALSGLTCVRRFQQDDA
HIFCTVGQLEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGKIELWDEAEKQLQNSL
MEFGKPWKINPGEGAFYGPKIDLEIKDALGRYHQCATIQLDFQLPIRFNLTYVSKDGDDK
KNPVIIHQAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQWLEKRKR
QIML
Enzyme 2 Number of Residues 724
Enzyme 2 Molecular Weight 83075.2
Enzyme 2 Theoretical pI 6.07
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Translation, ribosomal structure and biogenesis
Enzyme 2 Specific Function ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr)
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 151556799 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A6QNM8 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name SYTC2_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >2175 bp
ATGGCGGCCGAGGCCCTTGCGGCTGAGGCGGTGGCGTCGCGCCTGGCGCGGCAGGAGGAG
GACATCCGCTGGCTGTGGGCGGAGGTCCACCGTCTGAGGGACGAGCAGCTGAACGCGCCG
GACCGCTGCCAGGCCGAGGGGCCGTGCCTCACGCGCGAGGTAGCGCAGCTGCGGGCAGAG
AACCGCGAGCTGCGCCACTGCCTGTACCGTCTGCGGCTGTGCCTTGCGGAGGAGCTGAGC
CACCAAGCTCGGCTGGAGAGCGCGGCGCGGGCAGAGGCGGGGCGCGCGGCCGCAGGCGCG
CAGCCTCCTCCTAGTCAAAGCCTAGAAGAGGACGTTAAAAAGGAGATCGACCCTGACAAT
GAGGTGAAGAATCCACCAAATTTTATGAAGGAAAGATTGAAGTTTTTTGAAATACTGAAG
AAAGATCATCAGCTCTTACTTGCCATTTATGAAAAGAAGGGAGATTCAAGCAATGTGATC
ACAGTAAGAGTGGCTGATGGGAGAACAGTGAAAGGGGAAGCTTGGAAAACAACGCCTTAC
CAGGTGGCTGCAGAGATTAGTCAGGAGCTAGCGGAAACCACCGTGGTGGCTAAAGTGAAT
GGGGAGCTGTGGGACCTGGACCGCCCGCTGGAAGGGGACGCCACTGTGGAGCTCCTCACC
TTCGAGGATGAGGAGGCCCGGGCCGTATACTGGCACTCCAGTGCCCACGTACTCGGGGAA
GCCCTGGAGCTCCACTATGGAGGCCTCCTATGCTGCAGCCCACCCGGCGACGGCAGCTTT
CACTACGACGTGTACCTGGAAGACAGGGCCGTGTCCAGCGCAGAGCTGCCGGTGCTGGAG
AGCATGTGCCAGGCCATCATCAAAGAGCAGCAGCCATTTGAGAGACTGGAAGTCAGCACG
AAGGTCCTTCTAGACCTATTCAAGTACAATAAATTTAAATGCCGCATCCTGAAGGAGAAG
GTGGCCACGCCAACGACCACAGTTTACAGGTGCGGTCCACTAGTTGAACTTTGTAAAGGG
CCTCACGTAAGACACACTGGAACTATTAAGGTCATAAAAATTTTCAAGAATTCATTGGCA
TACTGGGCGGACAACCCTGAGATGGAAATGCTGCAGAGGGTCTACGGGGTGTCCTTTCCT
GACGAGCAGCGGATGGCTGCCTGGGAGGAGCTCCAGGAGGAGGCCAGGGCCCGGGACCAC
AGGACGATTGGGAAGGAACAGGAGCTTTTCTTTTTCCATGATCTGAGCCCCGGAAGCTGT
TTCTTTCTTCCTAGAGGAGCCTGCATTTATAACACACTGATAGACTTCATACGAGAGCAG
CACCACCAGCGCAACTTCACGGAGGTCCTGTCCCCCAACATGTACAGCTGCAAGCTCTGG
GAGGCTTCTGGACACTGGCAGCATTACAGTGAGAACATGTTCACCTTTGACATCGACAAG
GACACTTTCGCCCTTAAGCCCATGAATTGTCCAGGGCACTGTCTGATGTTTGCCCATCGT
CCACGGTCTTGGAGGGAAATGCCGATCAGACTTGCTGACTTCGGGGTTCTTCACAGGAAT
GAGCCATCAGGAGCTCTGAGTGGCTTGACCTGCGTCAGGCGCTTCCAGCAGGATGACGCT
CACATCTTCTGCACAGTGGGGCAGCTTGAAGAGGAGATAAAAGGGTGTTTGCAGTTTCTG
CAGTCTGTTTACTCAACGTTTGGCTTCTCCTTTCAATTAAATTTGTCAACAAGACCTGAA
AACTTCCTGGGAAAGATTGAGTTATGGGATGAAGCTGAAAAGCAACTACAGAATAGCTTG
ATGGAATTTGGGAAACCATGGAAGATAAACCCTGGAGAAGGAGCATTTTATGGTCCTAAA
ATTGATTTAGAAATCAAGGATGCTCTTGGCAGATACCATCAATGTGCTACAATCCAGCTG
GACTTTCAACTGCCTATAAGATTTAACCTTACATATGTGAGTAAGGATGGGGACGATAAG
AAGAACCCTGTGATCATTCACCAAGCCATTTTGGGGTCAGTGGAAAGAATGATAGCCATT
CTCTCTGAAAACTATGGGGGAAAATGGCCTTTCTGGCTGTCTCCTCGTCAGGTGATGGTC
ATCCCTGTGGGGCCAACTTGTGAAAAATACGCACTTCAGTGGTTGGAGAAAAGGAAGAGA
CAAATAATGCTGTAA
Enzyme 2 GenBank Gene ID BC148906 Link Image
Enzyme 2 GeneCard ID TARSL2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 15q26.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 385
Enzyme 3 Name L-threonine 3-dehydrogenase, mitochondrial
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name TDH
Enzyme 3 Protein Sequence >L-threonine 3-dehydrogenase, mitochondrial
MPVVRVLRRVACWMLQSPACGCRAPVLPSRFLGTSPRQIPMDANFHSTSFSEADQQRVLI
TGGLGQLGVGLASFLRKRFGKDNVILSDIRKPPEHVFLSGPFIYSDILDYKNLREIVVNN
RITWLFHYSALLSAVGEANVSLARAVNITGLHNVLDVAAEHGLRLFVPSTIGAFGPTSPR
NPTPDLCIQRPRTIYGVSKVHAELMGEYYYYRYGLDFRCLRYPGIISADSQPGGGTTDYA
VQIFHEAVKNGRFECNLKPDTRLPMMYIDDCLRATLEVMEAPAESLSMRTYNISAMSFTP
EELAQEVLKHVPELQVTYNVDPVRQAIADSWPMNFDDSNARKDWGWKHDFDLPELVTTML
NFHGSESRVAQAN
Enzyme 3 Number of Residues 373
Enzyme 3 Molecular Weight 41845.5
Enzyme 3 Theoretical pI 7.04
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Cell wall/membrane/envelope biogenesis
Enzyme 3 Specific Function L-threonine + NAD(+) = L-2-amino-3- oxobutanoate + NADH
Enzyme 3 Pathways
  • Amino-acid degradation
  • L-threonine degradation via oxydo-reductase pathway
  • glycine from L-threonine:step 1/2
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 86438277 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2KIR8 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name TDH_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1122 bp
ATGCCAGTTGTTCGGGTGCTGCGGCGGGTCGCCTGCTGGATGCTGCAGAGCCCAGCCTGT
GGCTGCCGGGCTCCTGTCCTACCCAGCCGGTTTCTGGGGACCTCTCCTCGGCAGATTCCA
ATGGATGCCAACTTCCACTCCACTTCATTCTCAGAAGCAGACCAGCAGCGTGTCTTAATT
ACAGGGGGTCTTGGCCAGCTTGGAGTGGGTCTTGCTAGCTTTCTGAGGAAACGATTTGGG
AAGGACAATGTGATTCTATCTGACATTCGGAAGCCCCCGGAACACGTCTTTCTTAGTGGC
CCGTTTATTTATTCCGACATCCTGGATTACAAGAATCTTCGGGAGATTGTGGTGAACAAC
CGCATCACGTGGCTGTTCCATTACAGCGCCCTGCTCAGCGCAGTGGGAGAAGCAAACGTG
TCCCTGGCCAGAGCCGTGAACATCACTGGACTGCACAATGTCCTGGACGTTGCCGCAGAG
CACGGTCTGCGATTGTTTGTGCCAAGCACCATCGGGGCGTTTGGACCTACTTCTCCACGG
AACCCAACCCCTGACCTCTGCATCCAGAGACCCAGGACCATCTATGGGGTGTCCAAGGTC
CACGCTGAGCTTATGGGCGAGTATTATTATTACCGGTATGGATTAGACTTTCGGTGCCTG
AGATATCCTGGAATCATTTCTGCTGATTCCCAGCCTGGAGGAGGAACAACTGACTATGCG
GTCCAGATTTTCCATGAAGCTGTCAAGAATGGCAGATTTGAGTGCAACCTGAAACCCGAC
ACGAGGCTCCCAATGATGTACATTGACGACTGCCTCCGGGCCACCCTGGAGGTCATGGAG
GCCCCAGCAGAGTCCCTGTCCATGAGAACCTACAACATCAGCGCCATGAGCTTCACCCCC
GAGGAGCTGGCCCAGGAGGTGCTCAAGCATGTCCCAGAGCTCCAGGTCACCTACAATGTG
GATCCTGTCCGACAGGCCATAGCGGATAGTTGGCCAATGAACTTTGATGATAGCAACGCT
CGGAAGGACTGGGGATGGAAGCACGATTTTGACCTCCCAGAGCTGGTGACAACGATGTTG
AACTTCCACGGTTCTGAGAGCAGAGTTGCCCAGGCTAACTGA
Enzyme 3 GenBank Gene ID BC112535 Link Image
Enzyme 3 GeneCard ID TDH Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:8
Enzyme 3 Locus 8p23.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 386
Enzyme 4 Name Threonyl-tRNA synthetase, cytoplasmic
Enzyme 4 Synonyms
  1. Threonine--tRNA ligase
  2. ThrRS
Enzyme 4 Gene Name TARS
Enzyme 4 Protein Sequence >Threonyl-tRNA synthetase, cytoplasmic
MSEEQASSPSAKMGDEEKPVGAGEEKQKEGSKKKNKEGSGDGGRAELNPWPEYINTRLEM
YNKLKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNKAVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLETLCKKIIKEKQAFERLEVKKETLLEMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKTLKIHKNSSTYWEGKSDMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFI
RSEYRKRGFQEVVTPNIYNSRLWVTSGHWEHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRVADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSIFGFSFKLNLSTRPEKFLGDIEVWNQAEKQLENSLNDFGEKWELNPGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTFVSHDGDDKKKPVIIHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHNAKFMVDIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKTSGTVNIRTRDNKVHGERTISETIERLQQLKHSRSKQAE
EEF
Enzyme 4 Number of Residues 723
Enzyme 4 Molecular Weight 83491.4
Enzyme 4 Theoretical pI 6.76
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Translation, ribosomal structure and biogenesis
Enzyme 4 Specific Function ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr)
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 73586669 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q3ZBV8 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name SYTC_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >2172 bp
ATGTCCGAGGAGCAGGCCAGTAGCCCTTCAGCGAAAATGGGAGACGAGGAGAAGCCGGTA
GGTGCTGGTGAAGAGAAACAAAAGGAAGGAAGCAAGAAGAAGAATAAAGAAGGATCGGGG
GATGGAGGTCGAGCAGAGTTGAATCCTTGGCCCGAATATATTAACACCCGTCTTGAGATG
TACAATAAGCTAAAAGCAGAACATGATTCCATTCTGGCAGAAAAGGCAGAAAAAGATAGT
AAGCCCATTAAAGTCACCCTGCCTGATGGTAAACAGGTAGATGCAGAATCCTGGAAAACT
ACACCATATCAAATTGCTTGTGGAATTAGTCAAGGCCTGGCCGACAACACTGTCATTGCT
AAGGTGAATAAAGCCGTCTGGGACCTAGACCGTCCTCTGGAGGAAGATTGCACCTTGGAG
CTGCTCAAGTTTGAGGATGAGGAAGCTCAAGCAGTGTATTGGCACTCAAGTGCTCACATA
ATGGGTGAAGCCATGGAAAGAGTCTATGGTGGGTGTCTGTGTTATGGACCACCAATAGAA
AACGGATTCTATTACGACATGTACCTCGAAGAAGGGGGTGTGTCCAGCAATGATTTCTCT
TCTTTGGAGACTTTATGTAAGAAAATCATTAAAGAAAAGCAAGCTTTCGAAAGATTAGAA
GTTAAGAAGGAAACTTTACTGGAAATGTTTAAGTACAACAAGTTCAAATGCAGGATTTTG
AATGAAAAAGTGAATACTCCAACTACCACAGTCTATAGATGTGGCCCCTTGATAGATCTC
TGCCGGGGTCCTCATGTCAGACACACTGGCAAAATCAAGACTTTGAAAATACACAAAAAT
TCCTCCACCTACTGGGAAGGCAAGTCAGATATGGAGACTCTACAGAGAATTTACGGCATT
TCCTTTCCAGATCCTAAGATGTTGAAAGAATGGGAGAAGTTCCAAGAGGAGGCTAAAAAC
CGAGATCATAGGAAAATTGGAAGGGACCAAGAACTCTACTTCTTCCATGAACTCAGCCCT
GGGAGTTGCTTTTTCCTGCCCAAGGGAGCCTACATTTATAACACACTTATTGAATTCATC
AGGAGTGAATACAGGAAACGAGGATTCCAGGAGGTGGTCACCCCGAACATCTATAATAGC
CGGCTCTGGGTGACCTCGGGCCACTGGGAGCACTACAGCGAGAACATGTTCTCCTTTGAA
GTGGAAAAGGAGCTGTTTGCTCTGAAACCCATGAACTGCCCGGGACACTGCCTCATGTTT
GACCATCGGCCAAGATCCTGGCGAGAGTTGCCTCTGCGAGTTGCTGATTTTGGGGTGCTT
CATAGGAATGAGCTGTCAGGAGCACTCACAGGACTTACTCGGGTCCGAAGGTTCCAGCAA
GATGATGCGCATATATTCTGTGCCATGGAGCAGATTGAGGATGAAATAAAAGGTTGTTTG
GATTTTCTGCGTACAGTATATAGCATATTTGGATTTTCTTTTAAACTGAACCTGTCTACT
CGCCCAGAAAAATTCCTTGGAGATATTGAAGTATGGAATCAAGCTGAGAAACAACTTGAA
AACAGTCTGAATGACTTTGGTGAAAAGTGGGAATTAAATCCCGGAGATGGAGCTTTCTAT
GGTCCAAAGATTGACATCCAGATTAAAGACGCTATTGGGCGGTACCACCAGTGTGCAACA
ATACAGTTGGATTTTCAGTTGCCCATTAGATTTAATCTTACTTTTGTAAGCCATGATGGT
GATGATAAGAAAAAGCCAGTCATTATCCATAGAGCCATCTTGGGGTCAGTGGAAAGAATG
ATTGCTATCCTCACTGAAAACTACGGGGGCAAATGGCCCTTCTGGCTGTCCCCTCGTCAG
GTAATGGTAGTTCCAGTGGGACCAACATGTGATGAATATGCCCAAAAGGTACGGCAACAA
TTCCACAATGCTAAATTCATGGTGGACATTGATCTGGATCCAGGCTGTACATTAAACAAG
AAGATCAGAAATGCACAGTTGGCACAATATAACTTCATCCTAGTTGTTGGTGAAAAAGAG
AAAACCAGCGGCACCGTCAATATCCGTACCAGAGACAATAAGGTGCACGGAGAGCGCACC
ATCTCGGAAACCATCGAGCGGCTCCAGCAGCTCAAGCACTCCCGCAGCAAACAGGCAGAA
GAAGAATTCTAA
Enzyme 4 GenBank Gene ID BC103082 Link Image
Enzyme 4 GeneCard ID TARS Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:5
Enzyme 4 Locus 5p13.2
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available