We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for D-Mannose (RMDB00169)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:43
Accession Number RMDB00169
Common Name D-Mannose
Description D-Mannose is a carbohydrate. High-mannose-type oligosaccharides have been shown to play important roles in protein quality control. Several intracellular proteins, such as lectins, chaperones and glycan-processing enzymes, are involved in this process. These include calnexin/calreticulin, UDP-glucose:glycoprotein glucosyltransferase (UGGT), cargo receptors (such as VIP36 and ERGIC-53), mannosidase-like proteins (e.g. EDEM and Htm1p) and ubiquitin ligase (Fbs). They are thought to recognize high-mannose-type glycans with subtly different structures. Mannose-binding lectin (MBL) is an important constituent of the innate immune system. This protein binds through multiple lectin domains to the repeating sugar arrays that decorate many microbial surfaces, and is then able to activate the complement system through a specific protease called MBL-associated protease-2. The primary pathway for the formation of L-fucose in procaryotic and eucaryotic cells is from D-mannose via an internal oxidation reduction and then epimerization of GDP-D-mannose to produce GDP-L-fucose. (PMID: 9488699, 16154739, 11414367)
Synonyms
  1. DL-mannose
  2. (+)-mannose
  3. D-Mannopyranose
  4. Carubinose (van)
  5. D-mannose
  6. (+-)-mannose
  7. Mannose (van)
  8. D(+)-mannose
  9. nchembio828-comp8
  10. Seminose
  11. hexose (ACD/Name 4.0)
  12. Carubinose
  13. Mannose
Chemical IUPAC Name (3S,4S,5R,6R)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol
Chemical Formula C6H12O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; primary alcohol; secondary alcohol; 1,2-diol; heterocyclic compound
Biofunction
  • Component of High-mannose type N-glycan biosynthesis; Component of N-Glycan biosynthesis
Application
Source
  • Endogenous
Average Molecular Weight 180.156
Monoisotopic Molecular Weight 180.063385
Isomeric SMILES OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O
Canonical SMILES OCC1OC(O)C(O)C(O)C1O
KEGG Compound ID C00159 Link Image
BioCyc ID MANNOSE Link Image
BiGG ID 34085 Link Image
Wikipedia Link D-Mannose Link Image
METLIN ID Not Available
PubChem Compound 18950 Link Image
PubChem Substance 15322061 Link Image
ChEBI ID 16024 Link Image
CAS Registry Number 3458-28-4
InChI Identifier InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5+,6?/m1/s1
Synthesis Reference Sowden, John C.; Fischer, Hermann O. L. Condensation of nitromethane with D- and L-arabinose: preparation of L-glucose and L-mannose. Journal of the American Chemical Society (1947), 69 1963-5.
Melting Point (Experimental) 132 oC
Experimental Water Solubility 713.0 mg/mL at 17 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 782.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -2.57 [Predicted by ALOGPS]; -2.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • endoplasmic reticulum
  • Extracellular
  • golgi apparatus
  • lysosome
Biofluid Location
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 123.6 +/- 25.4 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 91 +/- 49 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 159 +/- 83 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 211 +/- 86 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Tissue-type plasminogen activator
Enzyme 1 [top]
Enzyme 1 ID 234
Enzyme 1 Name Tissue-type plasminogen activator
Enzyme 1 Synonyms
  1. t-plasminogen activator
  2. t-PA
  3. tPA
  4. Tissue-type plasminogen activator chain A
  5. Tissue-type plasminogen activator chain B
Enzyme 1 Gene Name PLAT
Enzyme 1 Protein Sequence >Tissue-type plasminogen activator
MMSAMKTEFLCVLLLCGAVFTSPSQETYRRLRRGARSYKVTCRDGKTQMTYRQHDSWLRP
LLRGNQVEHCWCDGGRAQCHSVPVRSCSEPWCFNGGTCRQALYSSDFVCQCPEGFMGKLC
EIDATATCYKDQGVAYRGTWSTAESGAECANWNSSGLAMKPYSGRRPNAIRLGLGNHNYC
RNPDQDSKPWCYVFKAGKYISEFCSTPACAKVAEEDGDCYTGNGLAYRGTRSHTKSGASC
LPWNSVFLTSKIYTAWKSNAPALGLGKHNHCRNPDGDAQPWCHVWKDRQLTWEYCDVPQC
VTCGLRQYKRPQFRIKGGLFADITSHPWQAAIFVKNRRSPGERFLCGGILISSCWVLSAA
HCFQERYPPHHLKVFLGRTYRLVPGEEEQTFEVEKYIIHKEFDDDTYDNDIALLHLKSDS
LTCARESASVRTICLPDASLQLPDWTECELSGYGKHESSSPFFSERLKEAHVRLYPSSRC
TSQHLFNRTVTNNMLCAGDTRSGGDHTNLHDACQGDSGGPLVCMKDNHMTLVGIISWGLG
CGRKDVPGVYTKVTNYLDWIRDNTRP
Enzyme 1 Number of Residues 566
Enzyme 1 Molecular Weight 63700.5
Enzyme 1 Theoretical pI 8.09
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in serine-type endopeptidase activity
Enzyme 1 Specific Function Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-21
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 1321708 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q28198 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name TPA_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1701 bp
ATGATGAGCGCAATGAAGACAGAGTTCCTGTGCGTGCTGCTGCTCTGTGGAGCTGTCTTC
ACGTCGCCCAGCCAGGAAACCTACAGACGACTCAGGAGAGGCGCCAGATCGTACAAAGTG
ACCTGCAGAGATGGAAAAACGCAGATGACGTACCGCCAACACGACTCCTGGCTGCGACCC
CTGCTCAGGGGCAACCAAGTGGAGCACTGCTGGTGCGACGGCGGCCGGGCCCAGTGCCAC
TCGGTGCCCGTCAGAAGTTGCAGTGAACCTTGGTGTTTCAATGGGGGGACATGTCGGCAG
GCCCTCTATTCTTCAGACTTTGTCTGCCAGTGCCCAGAAGGGTTCATGGGGAAGCTCTGT
GAAATAGATGCTACCGCCACGTGCTATAAGGACCAGGGTGTCGCCTACAGAGGCACGTGG
AGCACGGCAGAGAGCGGGGCTGAGTGCGCCAATTGGAACAGCAGCGGCCTGGCCATGAAG
CCGTACAGCGGGCGCAGGCCCAACGCCATCAGGCTGGGCCTTGGGAACCACAACTACTGC
AGAAACCCGGACCAAGACTCAAAGCCCTGGTGCTACGTCTTCAAGGCAGGGAAATACATC
TCTGAGTTCTGCAGCACTCCAGCCTGCGCTAAGGTTGCAGAAGAAGATGGGGACTGCTAC
ACTGGAAACGGGCTGGCGTACCGCGGCACCCGCAGCCACACCAAGTCTGGGGCTTCCTGC
CTCCCGTGGAATTCCGTGTTCCTAACCAGCAAGATTTACACCGCCTGGAAGAGCAACGCG
CCGGCCCTGGGCCTGGGGAAGCACAACCACTGCAGGAATCCCGATGGGGACGCCCAGCCT
TGGTGCCACGTGTGGAAGGACCGCCAGCTGACCTGGGAGTACTGTGATGTGCCCCAGTGC
GTCACCTGTGGCCTGAGACAGTACAAGCGGCCCCAGTTCCGCATCAAAGGAGGCCTCTTC
GCGGACATCACCTCCCACCCCTGGCAGGCCGCGATCTTCGTCAAGAACAGGCGGTCCCCG
GGAGAGCGGTTTCTGTGTGGGGGGATCCTGATCAGCTCCTGCTGGGTGCTGTCGGCCGCC
CACTGCTTCCAGGAGAGGTACCCGCCTCACCATCTCAAGGTGTTCCTGGGCAGGACGTAC
CGGCTGGTCCCTGGAGAGGAGGAGCAGACGTTTGAAGTAGAAAAATACATCATCCACAAG
GAATTTGATGATGACACTTATGACAATGACATCGCGCTGCTGCACCTGAAATCAGACTCG
CTGACCTGCGCCCGGGAGAGTGCCTCTGTCCGCACCATCTGCCTCCCAGACGCCAGCCTG
CAGCTGCCCGACTGGACGGAGTGCGAGCTGTCCGGCTACGGGAAACACGAGTCCTCTTCT
CCGTTCTTTTCCGAGCGGCTGAAGGAGGCTCACGTCAGGTTGTACCCATCCAGCCGCTGC
ACTTCCCAACACTTGTTTAACAGGACCGTCACCAACAACATGCTGTGTGCCGGAGACACA
CGGAGCGGTGGGGACCACACAAACCTGCACGATGCCTGCCAGGGTGACTCGGGCGGCCCC
CTGGTGTGTATGAAGGACAACCACATGACCTTGGTCGGCATCATCAGCTGGGGCCTGGGC
TGCGGGCGGAAGGACGTCCCGGGCGTGTACACCAAGGTGACTAACTACCTGGACTGGATC
CGAGACAACACTCGCCCATGA
Enzyme 1 GenBank Gene ID X85800 Link Image
Enzyme 1 GeneCard ID PLAT Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:8
Enzyme 1 Locus 8p12
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available