We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Serine (RMDB00187)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-28 13:20:02
Accession Number RMDB00187
Common Name L-Serine
Description Serine is a nonessential amino acid derived from glycine. Like all the amino acid building blocks of protein and peptides, serine can become essential under certain conditions, and is thus important in maintaining health and preventing disease. Low-average concentration of serine compared to other amino acids is found in muscle. Serine is highly concentrated in all cell membranes. (http://www.dcnutrition.com/AminoAcids/) L-Serine may be derived from four possible sources: dietary intake; biosynthesis from the glycolytic intermediate 3-phosphoglycerate; from glycine ; and by protein and phospholipid degradation. Little data is available on the relative contributions of each of these four sources of l-serine to serine homoeostasis. It is very likely that the predominant source of l-serine will be very different in different tissues and during different stages of human development. In the biosynthetic pathway, the glycolytic intermediate 3-phosphoglycerate is converted into phosphohydroxypyruvate, in a reaction catalyzed by 3-phosphoglycerate dehydrogenase (3- PGDH; EC 1.1.1.95). Phosphohydroxypyruvate is metabolized to phosphoserine by phosphohydroxypyruvate aminotransferase (EC 2.6.1.52) and, finally, phosphoserine is converted into l-serine by phosphoserine phosphatase (PSP; EC 3.1.3.3). In liver tissue, the serine biosynthetic pathway is regulated in response to dietary and hormonal changes. Of the three synthetic enzymes, the properties of 3-PGDH and PSP are the best documented. Hormonal factors such as glucagon and corticosteroids also influence 3-PGDH and PSP activities in interactions dependent upon the diet. L-serine plays a central role in cellular proliferation. L-Serine is the predominant source of one-carbon groups for the de novo synthesis of purine nucleotides and deoxythymidine monophosphate. It has long been recognized that, in cell cultures, L-serine is a conditional essential amino acid, because it cannot be synthesized in sufficient quantities to meet the cellular demands for its utilization. In recent years, L-serine and the products of its metabolism have been recognized not only to be essential for cell proliferation, but also to be necessary for specific functions in the central nervous system. The findings of altered levels of serine and glycine in patients with psychiatric disorders and the severe neurological abnormalities in patients with defects of L-serine synthesis underscore the importance of L-serine in brain development and function. (PMID 12534373)
Synonyms
  1. (-)-Serine
  2. (S)-2-Amino-3-hydroxypropanoate
  3. (S)-2-Amino-3-hydroxypropanoic acid
  4. (S)-2-amino-3-hydroxy-Propanoate
  5. (S)-2-amino-3-hydroxy-Propanoic acid
  6. (S)-Serine
  7. (S)-a-Amino-b-hydroxypropionate
  8. (S)-a-Amino-b-hydroxypropionic acid
  9. (S)-alpha-Amino-beta-hydroxypropionate
  10. (S)-alpha-Amino-beta-hydroxypropionic acid
  11. (S)-b-Amino-3-hydroxypropionate
  12. (S)-b-Amino-3-hydroxypropionic acid
  13. 2-Amino-3-hydroxypropanoate
  14. 2-Amino-3-hydroxypropanoic acid
  15. 3-hydroxy-L-Alanine
  16. L-(-)-Serine
  17. L-3-Hydroxy-2-aminopropionate
  18. L-3-Hydroxy-2-aminopropionic acid
  19. L-3-Hydroxy-alanine
  20. L-Ser
  21. b-Hydroxy-L-alanine
  22. beta-Hydroxy-L-alanine
  23. beta-Hydroxyalanine
  24. (S)-beta-Amino-3-hydroxypropionate
  25. (S)-beta-Amino-3-hydroxypropionic acid
Chemical IUPAC Name 2-amino-3-hydroxy-propanoic acid
Chemical Formula C3H7NO3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary alcohol; 1,2-aminoalcohol; primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Component of Aminoacyl-tRNA biosynthesis; Component of Cyanoamino acid metabolism; Component of Cysteine metabolism; Component of Glycine, serine and threonine metabolism; Component of Glycosphingolipid metabolism; Component of Methane metabolism; Component of Methionine metabolism; Component of Selenoamino acid metabolism
Application
Source
  • Endogenous
Average Molecular Weight 105.093
Monoisotopic Molecular Weight 105.042595
Isomeric SMILES N[C@@H](CO)C(O)=O
Canonical SMILES NC(CO)C(O)=O
KEGG Compound ID C00065 Link Image
BioCyc ID SER Link Image
BiGG ID 33717 Link Image
Wikipedia Link L-Serine Link Image
METLIN ID 5203 Link Image
PubChem Compound 5951 Link Image
PubChem Substance 6435756 Link Image
ChEBI ID 17115 Link Image
CAS Registry Number 56-45-1
InChI Identifier InChI=1/C3H7NO3/c4-2(1-5)3(6)7/h2,5H,1,4H2,(H,6,7)/t2-/m0/s1
Synthesis Reference Qin, Wei-min; Cao, Fei; Zhou, Hua; Li, Zhen-jiang; Wei, Ping. Asymmetric synthesis of D- and L-serine with "Glycine equivalent" method. Huaxue Shiji (2005), 27(11), 643-644, 670.
Melting Point (Experimental) 228 oC
Experimental Water Solubility 425.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 480.00003 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -3.07 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -3.42 [Predicted by ALOGPS]; -4 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1IIT Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
  • peroxisome
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 48.9 +/- 25.1 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 50 +/- 14 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 85 +/- 29 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 123 +/- 57 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Serine racemase
  2. Serine hydroxymethyltransferase, mitochondrial
  3. Seryl-tRNA synthetase, mitochondrial
  4. Serine palmitoyltransferase 1
  5. Seryl-tRNA synthetase, cytoplasmic
  6. Serine hydroxymethyltransferase, cytosolic
  7. L-serine dehydratase
Enzyme 1 [top]
Enzyme 1 ID 82
Enzyme 1 Name Serine racemase
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name SRR
Enzyme 1 Protein Sequence >Serine racemase
MCDQYCISFADVEKAHINIRDFIHLTPVLTSSILNQITGRNLFFKCELFQKTGSFKIRGA
LNAIRGLISAHPEEKPRAVVAHSSGNHGQALSFAARLEGIPAYVIVPETAPNCKKLAIQA
YGASIVYSEQSEESRENITKRIAEETEGIMVHPNQEPAVIAGQGTIAMEVLNQVPLVDAL
VVPVGGGGMLAGIAVTVKALRPSVKVYAAEPLNADDCYQSKLKGELTPNPYPPETIADGI
KSSIGLNTWPIIRDLVDDVFTVTEDEIKYATQLVWERMKLLIEPTAGVGVAVVLSQHFRT
VPAEVKNICIVLSGGNVDLTSLTWVKKQDEKAAP
Enzyme 1 Number of Residues 334
Enzyme 1 Molecular Weight 36180.4
Enzyme 1 Theoretical pI 5.92
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Catalyzes the synthesis of D-serine from L-serine
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 117306359 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A0JNI4 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SRR_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1005 bp
ATGTGTGATCAGTACTGCATCTCCTTTGCTGATGTTGAAAAAGCTCATATCAACATTCGA
GATTTTATTCACCTCACACCAGTACTAACAAGTTCCATTTTGAATCAAATAACAGGACGT
AATCTTTTCTTCAAATGTGAACTCTTCCAGAAAACTGGATCTTTTAAGATTCGTGGTGCC
CTTAATGCAATCAGAGGCCTGATTTCTGCCCATCCAGAAGAGAAGCCCAGAGCTGTTGTT
GCTCACAGCAGCGGAAACCATGGCCAGGCTCTCTCCTTTGCTGCCAGATTGGAAGGGATT
CCTGCTTATGTCATAGTGCCGGAAACAGCTCCCAACTGTAAAAAACTGGCAATACAAGCC
TATGGAGCCTCTATAGTATACAGTGAACAGAGCGAAGAGTCCAGAGAAAATATTACAAAG
AGAATTGCGGAAGAAACAGAAGGCATTATGGTACATCCCAACCAGGAGCCTGCAGTGATA
GCTGGGCAAGGGACAATTGCCATGGAAGTGCTAAACCAGGTTCCCTTGGTAGACGCACTG
GTGGTACCTGTAGGAGGAGGAGGAATGCTTGCTGGAATAGCCGTTACAGTGAAGGCTCTG
AGACCCAGTGTGAAGGTATATGCTGCTGAACCCTTGAATGCAGATGACTGCTACCAGTCC
AAACTGAAAGGGGAACTGACCCCCAACCCCTATCCTCCGGAAACCATAGCAGATGGTATC
AAATCCAGCATTGGCTTAAACACCTGGCCTATTATAAGAGACCTCGTGGATGATGTCTTC
ACTGTCACAGAGGATGAAATTAAGTATGCAACCCAGCTGGTGTGGGAGAGGATGAAATTG
CTTATTGAACCTACAGCTGGTGTTGGAGTGGCCGTTGTGCTGTCTCAGCATTTTCGAACA
GTTCCTGCAGAAGTAAAGAACATCTGTATTGTGCTCAGTGGTGGAAATGTAGACTTAACC
TCCCTAACTTGGGTGAAGAAGCAGGATGAAAAGGCAGCTCCTTAG
Enzyme 1 GenBank Gene ID BC126700 Link Image
Enzyme 1 GeneCard ID SRR Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17p13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 83
Enzyme 2 Name Serine hydroxymethyltransferase, mitochondrial
Enzyme 2 Synonyms
  1. SHMT
  2. Serine methylase
  3. Glycine hydroxymethyltransferase
Enzyme 2 Gene Name SHMT2
Enzyme 2 Protein Sequence >Serine hydroxymethyltransferase, mitochondrial
MLSFSFIWATRPLRRCGQLVGMAVRCQHSEAAQTQTGEASKGWSGQESLSDSDPEMWELL
RREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAAYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNPQTGLIDYDQLALTARLFKPRLIIAGTSAYARLIDYARMREV
CDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVQAVD
PKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQILKNAQA
MANALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT
PGGLRLGAPALTSRGFLEDDFRKVVGFIDEGVNIGLEVKSKTTKLQDFKSFLLKDPETSH
QLADLRQRVEQFARAFPMPGFDDH
Enzyme 2 Number of Residues 504
Enzyme 2 Molecular Weight 55604.9
Enzyme 2 Theoretical pI 7.78
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Interconversion of serine and glycine
Enzyme 2 Pathways
  • One-carbon metabolism
  • tetrahydrofolate interconversion
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 74268173 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q3SZ20 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name GLYM_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1515 bp
ATGTTGTCCTTCTCTTTTATTTGGGCGACTCGGCCTCTGCGGAGATGTGGTCAGCTGGTT
GGGATGGCCGTACGGTGCCAGCACAGTGAGGCGGCCCAGACTCAGACTGGAGAAGCAAGC
AAGGGCTGGTCAGGCCAGGAGAGTCTATCAGACAGTGACCCTGAGATGTGGGAGCTGCTG
CGGAGAGAGAAGGACAGGCAGTGTCGCGGCCTGGAGCTCATTGCTTCAGAGAACTTCTGC
AGCCGAGCTGCGCTGGAGGCCCTGGGGTCCTGTCTGAACAACAAGTACTCGGAGGGTTAT
CCTGGCAAGAGATACTACGGAGGAGCAGAGGTAGTGGATGAGATAGAGCTGCTGTGTCAG
CGCCGGGCCTTGGAGGCCTTTGACCTGGATCCTGCTCAGTGGGGAGTCAATGTCCAACCC
TACTCCGGATCCCCAGCCAATCTGGCTGCCTACACAGCCCTTCTGCAGCCTCACGACCGA
ATCATGGGGCTGGACTTGCCCGATGGGGGCCATCTCACCCACGGCTACATGTCTGATGTC
AAGCGGATCTCAGCTACATCTATCTTCTTCGAGTCTATGCCTTATAAGCTGAACCCCCAA
ACCGGCCTCATTGACTATGACCAGCTGGCACTCACTGCTCGGCTCTTCAAACCACGACTC
ATCATAGCTGGTACCAGTGCCTATGCTCGTCTCATTGACTACGCCCGCATGAGAGAAGTG
TGTGACGAGGTCAAGGCACACCTCTTGGCAGACATGGCCCACATCAGTGGCCTGGTGGCT
GCCAAGGTGATCCCCTCACCCTTCAAGCACGCGGATATTGTCACCACGACCACTCACAAG
ACCCTTCGAGGGGCCAGGTCAGGACTCATCTTCTACCGGAAGGGGGTGCAGGCTGTGGAC
CCCAAAACTGGCCGAGAGATCCCTTACACATTTGAGGACCGAATCAACTTTGCTGTGTTC
CCATCCCTGCAGGGGGGCCCCCACAACCATGCCATTGCTGCAGTGGCTGTGGCCCTAAAG
CAGGCCTGCACCCCCATGTTCCGGGAGTACTCCCTGCAGATTCTAAAGAACGCTCAGGCC
ATGGCTAATGCCCTGCTGGAGCGAGGCTACTCCCTGGTGTCTGGTGGCACTGACAACCAC
CTAGTGCTGGTAGACCTTCGGCCAAAGGGCCTGGACGGAGCTCGAGCAGAACGGGTGTTG
GAACTTGTATCCATCACGGCCAACAAGAACACCTGTCCTGGAGATCGAAGTGCCATCACC
CCTGGGGGCCTGAGGCTGGGGGCCCCAGCCCTGACTTCTCGAGGGTTCCTTGAAGATGAC
TTCCGGAAAGTTGTAGGCTTTATAGATGAAGGTGTCAACATTGGCTTGGAAGTGAAGAGC
AAGACCACCAAACTCCAGGATTTCAAATCTTTCCTGCTCAAAGACCCAGAAACAAGTCAT
CAGCTGGCCGACCTTAGGCAACGGGTGGAGCAGTTCGCCAGGGCCTTCCCCATGCCTGGT
TTTGATGATCACTGA
Enzyme 2 GenBank Gene ID BC103242 Link Image
Enzyme 2 GeneCard ID SHMT2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 12q12-q14
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 84
Enzyme 3 Name Seryl-tRNA synthetase, mitochondrial
Enzyme 3 Synonyms
  1. Seryl-tRNA(Ser/Sec) synthetase
  2. Serine--tRNA ligase
  3. SerRSmt
Enzyme 3 Gene Name SARS2
Enzyme 3 Protein Sequence >Seryl-tRNA synthetase, mitochondrial
MAASIVRRLGPLVAGRGLRLRGGCVCNQSFKRSFATERQDRNLLYEHAREGYSALPLLDM
ESLCAYPEDAARALDLRKGELRSKDLPGIISTWQELRQLREQIRSLEEEKEAVTEAVRAL
VVNQDNSQVQQDPQYQSLRARGREIRKQLTLLYPKEAQLEEQFYLRALRLPNQTHPDVPV
GDESQARVLHVVGDKPAFSFQPRGHLEIAEKLDIIRQKRLSHVSGHRSYYLRGAGALLQH
GLVNFTLNKLIHRGFTPMTVPDLLRGVVFEGCGMTPNAKPSQIYNIDPSRFEDLNLAGTA
EVGLAGYFMDHSVAFRDLPIRMVCSSTCYRAETDTGKEPWGLYRVHHFTKVEMFGVTGPG
LEQSSELLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT
SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATGCAVPRLLIALLESYQQKDGSVLVPPA
LQPYLGTDRITTPTHVPLQYIGPNQPQKPRLPGQPASS
Enzyme 3 Number of Residues 518
Enzyme 3 Molecular Weight 58295.1
Enzyme 3 Theoretical pI 7.62
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Translation, ribosomal structure and biogenesis
Enzyme 3 Specific Function Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)
Enzyme 3 Pathways
  • Aminoacyl-tRNA biosynthesis
  • selenocysteinyl-tRNA(Sec) biosynthesis
  • L-seryl-tRNA(Sec) from L-serine and tRNA(Sec):step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 9188533 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q9N0F3 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name SYSM_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1557 bp
ATGGCTGCGTCCATAGTGCGGCGCTTGGGTCCTCTAGTAGCTGGTCGGGGCCTGCGGCTT
CGAGGAGGCTGTGTCTGTAACCAGAGCTTCAAGAGAAGTTTCGCAACGGAGAGGCAGGAT
CGGAACCTCCTGTACGAACACGCGCGTGAGGGCTACAGCGCGCTCCCTCTGCTGGATATG
GAATCACTGTGCGCATACCCGGAAGATGCCGCGCGCGCGCTGGATCTCCGCAAGGGGGAG
TTGCGGTCTAAGGATCTGCCCGGCATCATCTCAACATGGCAGGAGCTGAGGCAGCTGCGG
GAACAGATCCGGAGCCTGGAGGAGGAGAAGGAGGCTGTGACAGAGGCAGTGCGGGCCCTG
GTGGTAAACCAGGACAACAGTCAAGTGCAGCAGGACCCCCAATATCAGAGTCTGCGGGCA
CGTGGCCGGGAGATCCGGAAGCAGCTCACACTCCTCTACCCCAAGGAGGCCCAGCTCGAA
GAGCAGTTCTACCTGCGGGCACTGAGGCTGCCCAACCAGACCCACCCAGACGTGCCTGTC
GGGGACGAAAGCCAGGCCCGCGTGCTCCATGTGGTTGGAGACAAGCCAGCTTTCTCCTTC
CAACCCCGGGGCCACCTGGAAATAGCCGAGAAACTCGACATCATCCGTCAGAAGCGCCTG
TCCCATGTGTCTGGCCACCGCTCCTATTACCTGCGCGGGGCTGGGGCCCTCCTGCAGCAC
GGCCTGGTCAACTTCACACTCAACAAGCTCATCCACCGGGGCTTCACCCCCATGACGGTG
CCAGACCTTCTCCGAGGAGTTGTGTTTGAAGGCTGTGGGATGACACCAAATGCCAAACCA
TCCCAAATTTACAACATCGACCCCTCCCGCTTTGAAGACCTCAATCTGGCCGGGACAGCG
GAGGTAGGACTTGCAGGCTACTTCATGGACCACTCCGTGGCCTTCAGGGACCTGCCAATC
AGGATGGTTTGTTCCAGTACCTGCTACCGGGCGGAAACAGACACGGGGAAGGAGCCGTGG
GGGCTGTATCGAGTACACCACTTCACCAAGGTGGAGATGTTTGGGGTGACAGGCCCCGGG
CTGGAGCAGAGCTCAGAGCTGCTGGAGGAGTTCCTGTCCCTTCAGATGGAGATCTTGACA
GAGCTGGGCTTGCACTTCCGAGTCCTGGACATGCCCACACAGGAGCTGGGCCTGCCCGCC
TACCGCAAGTTCGACATTGAGGCCTGGATGCCAGGGCGAGGCCGGTTCGGTGAGGTCACC
AGTGCTTCCAACTGCACGGACTTCCAGAGCCGCCGTTTACACATCATGTTCCAGACCGAG
GCCGGGGAGCTGCAGTTCGCACACACGGTGAATGCCACGGGCTGTGCTGTCCCTCGTCTC
CTCATCGCCCTCCTGGAGAGCTATCAGCAGAAGGACGGCTCAGTGCTCGTGCCCCCTGCC
CTCCAGCCCTACCTCGGCACCGATCGGATCACCACCCCCACCCACGTGCCTCTCCAGTAC
ATCGGCCCCAACCAGCCCCAGAAGCCCAGGCTCCCGGGCCAGCCTGCCTCGAGCTGA
Enzyme 3 GenBank Gene ID AB029947 Link Image
Enzyme 3 GeneCard ID SARS2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 19q13.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 85
Enzyme 4 Name Serine palmitoyltransferase 1
Enzyme 4 Synonyms
  1. Serine-palmitoyl-CoA transferase 1
  2. SPT 1
  3. SPT1
  4. Long chain base biosynthesis protein 1
  5. LCB 1
Enzyme 4 Gene Name SPTLC1
Enzyme 4 Protein Sequence >Serine palmitoyltransferase 1
MATVAEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTLKEKEEL
IEEWQPEPLVPPVSKDHPALNYNIVSGPPSHNIVVNGKECINFASFNFLGLLDNPRLKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDKAACFAIQKGLQASRSDIKVFNHNDMDDLERLLKEQEIEDQKNPRKARVTRR
FIIVEGLYMNTGTVCPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGISIDDI
DLISANMENSLASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCKRIHKALQGIPGLKVVGESISPALHLQLEETTGCRERDVKLLQEIVTQCM
DRGIALTQARYLEKEEKYLPPPSIRVVVTVEQTEEDLEKAASTISEVAQTVLL
Enzyme 4 Number of Residues 473
Enzyme 4 Molecular Weight 52787.5
Enzyme 4 Theoretical pI 5.70
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Coenzyme transport and metabolism
Enzyme 4 Specific Function Serine palmitoyltransferase (SPT). The heterodimer formed with LCB2 (SPTLC2 or SPTLC3) constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2- SSSPTA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SSSPTA isozyme uses both C14-CoA and C16- CoA as substrates. The SPTLC1-SPTLC2-SSSPTB complex displays a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3- SSSPTB isozyme has the ability to use a broader range of acyl-CoAs
Enzyme 4 Pathways
  • Lipid metabolism
  • sphingolipid metabolism
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • 16-36
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 75948211 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q3MHG1 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name SPTC1_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1422 bp
ATGGCGACCGTCGCGGAGCAGTGGGTCCTGGTGGAGATGGTCCAGGCGCTCTACGAGGCT
CCTGCTTATCATCTTATTTTAGAAGGAATTTTAATACTCTGGATAATCAGACTTCTTTTC
TCTAAAACTTACAAATTACAAGAACGATCTGATCTTACACTCAAGGAAAAGGAAGAATTG
ATTGAAGAGTGGCAACCAGAGCCTCTTGTTCCTCCTGTCTCAAAAGACCATCCTGCTCTC
AACTACAACATTGTTTCAGGCCCTCCAAGCCATAACATCGTGGTGAATGGAAAAGAATGT
ATAAACTTTGCTTCATTCAATTTTCTTGGATTGTTGGATAACCCTAGGCTCAAGGCAGCA
GCTTTGGCATCTCTAAAGAAGTATGGTGTGGGAACTTGTGGACCTAGAGGATTTTATGGC
ACATTTGATGTGCACTTGGATTTAGAAGACCGCCTGGCAAAATTTATGAAGACAGAAGAA
GCCATAATATACTCATATGGATTTGCCACCATAGCCAGTGCTATTCCTGCTTACTCTAAG
AGAGGGGACATTGTGTTTGTAGATAAAGCTGCCTGCTTTGCTATTCAGAAGGGATTACAG
GCATCACGTAGTGACATTAAGGTGTTTAACCATAATGATATGGACGACCTGGAGCGACTA
CTAAAAGAACAAGAGATTGAAGATCAAAAGAATCCTCGCAAGGCTCGTGTAACTCGACGT
TTCATTATAGTTGAAGGATTGTATATGAATACTGGAACTGTTTGCCCTCTTCCAGAATTG
GTTAAGTTAAAATATAAATATAAAGCAAGAATCTTTCTGGAGGAAAGCCTTTCATTTGGA
GTCCTGGGAGAGCATGGCCGAGGAGTCACGGAACATTTTGGAATCAGTATTGATGATATT
GATCTTATCAGTGCCAACATGGAGAACTCACTGGCATCTATTGGGGGTTTCTGCTGTGGC
AGGTCTTTCGTAATTGACCATCAGCGACTTTCTGGCCAGGGATACTGCTTTTCAGCTTCG
TTACCTCCCCTGTTAGCTGCTGCTGCGATTGAGGCTCTCAACATCATGGAAGAGAATCCA
GGTATTTTTGCAGTGTTGAAGGAAAAATGCAAACGAATTCATAAAGCTTTACAAGGCATT
CCTGGACTAAAAGTAGTGGGGGAGTCTATTTCTCCAGCATTGCACCTCCAACTGGAAGAG
ACCACTGGGTGTCGAGAAAGAGATGTTAAACTGCTTCAGGAAATAGTAACTCAATGCATG
GACAGAGGCATCGCATTGACTCAGGCACGCTACTTGGAGAAAGAAGAAAAGTACCTCCCC
CCTCCGAGCATTAGGGTTGTGGTCACAGTGGAACAAACAGAAGAGGACCTGGAGAAAGCT
GCGTCCACGATCAGCGAGGTGGCCCAGACCGTGCTGCTTTAG
Enzyme 4 GenBank Gene ID BC105250 Link Image
Enzyme 4 GeneCard ID SPTLC1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:9
Enzyme 4 Locus 9q22.2
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 86
Enzyme 5 Name Seryl-tRNA synthetase, cytoplasmic
Enzyme 5 Synonyms
  1. Seryl-tRNA(Ser/Sec) synthetase
  2. Serine--tRNA ligase
  3. SerRS
Enzyme 5 Gene Name SARS
Enzyme 5 Protein Sequence >Seryl-tRNA synthetase, cytoplasmic
MVLDLDLFRVDKGGDPALIRESQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLC
SKTIGEKMKKKEPVGNDESIPEDVLNLDDLTADTLTNLKVSQIKKVRLLVDEAILKCDAE
RIKLEAERFESLREIGNLLHPSVPISDDEDADNKVERIWGDCTVRKKYSHVDLVVMVDGF
EGEKGAVVAGSRGYFLKGVLVFLEQALIQFALRTLASRGYTPIYTPFFMRKEVMQEVAQL
SQFDEELYKVIGKGSEKSDDNSYEEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMIATAEEFYQSLGIPYH
IVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKV
EFVHMLNATMCATTRTICAILENYQTEKGILVPEKLKEFMPPGLQELIPFVKAAPIDQEP
SKKQKKQHEGSKKKGAARDVALESQLQNMEVTDA
Enzyme 5 Number of Residues 514
Enzyme 5 Molecular Weight 58604.5
Enzyme 5 Theoretical pI 6.07
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Translation, ribosomal structure and biogenesis
Enzyme 5 Specific Function Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec)
Enzyme 5 Pathways
  • Aminoacyl-tRNA biosynthesis
  • selenocysteinyl-tRNA(Sec) biosynthesis
  • L-seryl-tRNA(Sec) from L-serine and tRNA(Sec):step 1/1
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 9945026 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q9GMB8 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name SYSC_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1545 bp
ATGGTGCTGGATCTGGATTTGTTTCGGGTGGATAAAGGGGGGGACCCAGCACTCATCCGA
GAGTCGCAGGAGAAGCGCTTCAAGGACCCGGGACTGGTGGACCAGCTGGTGAAGGCAGAC
AGCGAGTGGCGACGATGCAGATTTCGGGCAGACAACTTGAACAAGCTGAAGAACCTATGC
AGCAAGACAATTGGAGAGAAAATGAAGAAAAAAGAGCCAGTGGGAAATGATGAGTCCATT
CCAGAAGATGTATTAAATCTCGATGACCTCACTGCAGACACTTTAACTAACCTAAAAGTC
TCACAGATCAAAAAAGTCCGCCTCCTCGTCGACGAAGCCATCCTGAAGTGTGACGCCGAG
CGGATAAAACTGGAAGCTGAGCGGTTTGAGAGCCTTCGGGAGATCGGGAACCTCCTGCAC
CCGTCGGTGCCCATCAGCGATGACGAGGATGCCGACAACAAAGTAGAGAGGATTTGGGGT
GATTGTACAGTCAGGAAGAAGTACTCTCACGTGGACCTGGTGGTGATGGTAGATGGCTTT
GAAGGCGAAAAGGGGGCCGTGGTGGCTGGGAGTCGAGGGTACTTCCTGAAGGGGGTCCTG
GTGTTCCTGGAACAAGCACTCATCCAGTTTGCCCTTCGGACCTTGGCAAGTCGGGGCTAC
ACTCCCATTTATACCCCCTTCTTCATGAGGAAGGAGGTCATGCAGGAAGTGGCACAGCTC
AGCCAGTTTGATGAAGAACTTTATAAGGTGATTGGCAAAGGCAGTGAAAAGTCTGATGAT
AACTCCTATGAGGAGAAATATCTGATTGCTACCTCTGAACAACCCATTGCTGCTCTTCAC
CGGGACGAGTGGCTTCGGCCAGAGGACTTGCCAATCAAGTATGCCGGCCTGTCCACCTGC
TTTCGCCAGGAGGTGGGCTCCCATGGGCGTGACACCCGTGGCATCTTTAGAGTCCATCAG
TTTGAGAAGATAGAGCAGTTTGTNTACTCCTCGCCACACGACAACAAGTCCTGGGAGATG
TTTGAGGAGATGATTGCCACCGCGGAGGAGTTCTACCAGTCTCTGGGGATCCCTTACCAC
ATCGTGAATATCGTCTCAGGTTCTTTGAATCATGCTGCCAGTAAGAAGCTTGACCTGGAG
GCCTGGTTTCCAGGCTCGGGGGCCTTCCGTGAGTTAGTCTCCTGTTCTAACTGCACAGAC
TATCAGGCTCGCCGGCTCCGAATCCGATATGGGCAGACCAAGAAGATGATGGACAAGGTG
GAGTTTGTCCACATGCTCAATGCCACCATGTGTGCCACAACCCGCACCATCTGTGCCATC
CTGGAGAACTACCAGACAGAGAAGGGCATCCTCGTGCCTGAGAAATTGAAGGAATTCATG
CCGCCAGGTCTCCAAGAACTGATCCCCTTTGTGAAGGCTGCGCCCATTGACCAGGAGCCC
TCCAAGAAGCAGAAGAAGCAGCATGAGGGCAGCAAGAAGAAAGGGGCAGCGAGAGATGTT
GCCCTGGAGAGCCAGCTGCAGAACATGGAGGTCACCGATGCCTGA
Enzyme 5 GenBank Gene ID AF297553 Link Image
Enzyme 5 GeneCard ID SARS Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 1p13.3-p13.1
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 87
Enzyme 6 Name Serine hydroxymethyltransferase, cytosolic
Enzyme 6 Synonyms
  1. SHMT
  2. Serine methylase
  3. Glycine hydroxymethyltransferase
Enzyme 6 Gene Name SHMT1
Enzyme 6 Protein Sequence >Serine hydroxymethyltransferase, cytosolic
MAAPVNKAPRDANLWSLHEKMLAQPLKDNDVEVYNIIKKESNRQRVGLELIASENFASRA
VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELEVLCQKRALQVYGLDSQCWGVNVQPYSG
SPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY
INYDQLEENARLFHPRLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHVSGLVAAGV
VPSPFEHCHVVSTTTHKTLRGCRAGMIFYRKGVRSVDPKTGRETRYNLESLINSAVFPGL
QGGPHNHAIAGVAVALKQAMTPEFRAYQRQVVANCRALAEALMGLGYRVVTGGSDNHLIL
VDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRLGTPALTSRGLLEEDFQK
VAHFIHRGIELTLQIQDAVGVKATLKEFMEKLAGAEEHHRAVAALRAEVESFATLFPLPG
LPGF
Enzyme 6 Number of Residues 484
Enzyme 6 Molecular Weight 52977.1
Enzyme 6 Theoretical pI 8.11
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Amino acid transport and metabolism
Enzyme 6 Specific Function Interconversion of serine and glycine
Enzyme 6 Pathways
  • One-carbon metabolism
  • tetrahydrofolate interconversion
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 59858107 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q5E9P9 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name GLYC_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1455 bp
ATGGCAGCTCCAGTCAACAAGGCACCCAGAGATGCCAATTTGTGGTCCTTGCACGAGAAG
ATGCTGGCACAGCCCCTGAAGGACAACGATGTCGAGGTTTACAACATCATTAAGAAGGAG
AGTAACCGGCAGAGGGTTGGACTGGAGCTGATCGCCTCCGAGAACTTTGCCAGCCGGGCT
GTTCTGGAGGCCCTAGGCTCTTGCCTGAACAACAAGTACTCTGAGGGGTACCCAGGCCAG
AGGTACTATGGTGGGACGGAGTTCATCGACGAGCTAGAGGTCCTCTGTCAGAAGCGAGCG
CTGCAGGTCTATGGCCTGGACTCCCAGTGCTGGGGGGTTAACGTCCAGCCTTACTCAGGC
TCCCCAGCAAACTTCGCAGTGTACACGGCCCTGGTGGAGCCCCATGGCCGCATCATGGGC
CTGGACCTGCCAGATGGGGGCCACCTGACCCATGGGTTCATGACTGACAAGAAGAAGATT
TCTGCCACGTCCATCTTTTTTGAATCTATGCCCTACAAGGTGAATCCCGATACCGGCTAC
ATCAACTACGACCAGCTGGAGGAGAACGCCCGCCTCTTCCACCCGAGGCTGATCATTGCT
GGGACTAGCTGCTACTCCCGGAACCTGGACTACGCTCGGCTGCGCAAGATCGCTGATGAC
AACGGGGCGTACCTCATGGCCGACATGGCACATGTCAGTGGGCTGGTGGCGGCCGGCGTG
GTGCCTTCGCCCTTCGAGCACTGCCACGTGGTGTCCACCACCACCCACAAGACCCTGCGG
GGCTGCCGCGCCGGCATGATCTTCTACAGGAAGGGAGTGCGCAGTGTGGACCCCAAGACA
GGCAGAGAGACTCGCTACAACCTGGAGTCGCTCATCAACTCTGCTGTGTTCCCAGGCCTG
CAAGGGGGACCCCACAACCACGCCATTGCTGGGGTCGCGGTTGCTCTGAAGCAGGCCATG
ACTCCAGAATTCAGAGCCTACCAGCGCCAGGTGGTGGCCAACTGCAGGGCTCTGGCCGAG
GCCTTGATGGGACTGGGCTACAGAGTGGTCACAGGGGGTTCTGACAACCACTTGATCCTC
GTGGACCTCCGCTCCAAAGGCACAGATGGCGGCAGGGCAGAGAAAGTGCTGGAAGCCTGC
TCCATTGCCTGCAATAAGAACACCTGCCCAGGTGATAAAAGCGCGCTACGGCCCAGTGGG
CTGCGCCTGGGGACCCCAGCATTGACCTCCCGAGGGCTCTTGGAAGAAGATTTCCAAAAG
GTCGCCCATTTCATTCACAGAGGCATAGAGCTGACCCTGCAGATCCAGGACGCCGTAGGG
GTGAAGGCCACCCTGAAGGAGTTCATGGAGAAGCTGGCAGGGGCCGAGGAGCACCATCGG
GCCGTGGCGGCCCTCAGGGCAGAGGTGGAGAGCTTCGCCACCCTATTCCCGCTGCCTGGC
CTGCCTGGCTTCTAG
Enzyme 6 GenBank Gene ID BT020871 Link Image
Enzyme 6 GeneCard ID SHMT1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 17p11.2
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 88
Enzyme 7 Name L-serine dehydratase
Enzyme 7 Synonyms
  1. L-serine deaminase
Enzyme 7 Gene Name SDS
Enzyme 7 Protein Sequence >L-serine dehydratase
MMSGRPLHMETPVRDSMTLSKVAGTTAYLKLDSAQPSGSFKIRGIGHLCKMWAERGCEHF
VCSSAGNAGMAAAYAARKLGIPSTIVVPSTTPALTIQRLKNEGATVKVVGETLDEAIRVA
KDLEKNNSGWVYVPPFDDPLIWEGHSSIVKELKETMTEKPGAIVLAVGGGGLLCGVVQGL
AEVGWRDVPVITMETIGAESFHASTKAGKLVTLPCITSVAKALGVTTVAAQAMKVYREHP
IFSEVVSDQEAVAALEKFVDDEKILVEPACGAALAAVYSNVIQKLQGEGKLRTPLSSLVV
IVCGGSNISLAQLVALKKQLGMDGLSQ
Enzyme 7 Number of Residues 327
Enzyme 7 Molecular Weight 34440.8
Enzyme 7 Theoretical pI 7.44
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Amino acid transport and metabolism
Enzyme 7 Specific Function L-serine = pyruvate + NH(3)
Enzyme 7 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 111307504 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q0VCW4 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name SDHL_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >984 bp
ATGATGTCAGGAAGACCCTTGCACATGGAAACTCCGGTCCGTGACAGCATGACTCTGTCT
AAAGTGGCTGGCACCACGGCCTATCTCAAGCTAGACAGTGCCCAGCCCTCCGGCTCCTTC
AAGATCCGGGGCATCGGACACCTCTGCAAAATGTGGGCCGAGCGGGGCTGCGAGCATTTC
GTCTGCTCCTCAGCGGGCAATGCAGGCATGGCAGCCGCCTATGCTGCCAGGAAGCTGGGC
ATCCCCTCCACGATTGTCGTGCCCAGCACCACGCCTGCCCTCACCATCCAGCGGCTCAAG
AATGAGGGCGCCACGGTCAAAGTGGTGGGTGAGACATTGGATGAGGCCATCAGAGTGGCC
AAGGACCTGGAGAAAAACAACTCAGGCTGGGTCTATGTCCCCCCCTTTGACGACCCCCTC
ATCTGGGAAGGCCACTCTTCCATCGTGAAGGAGCTGAAGGAGACGATGACCGAAAAGCCA
GGGGCCATCGTGCTGGCAGTAGGGGGCGGAGGCCTCTTGTGCGGAGTGGTTCAGGGGCTG
GCAGAGGTGGGCTGGAGGGACGTGCCCGTCATCACCATGGAGACCATCGGAGCAGAGAGC
TTCCACGCTTCCACCAAGGCCGGCAAGCTCGTCACCCTGCCCTGCATTACCAGTGTTGCC
AAAGCCCTGGGCGTGACCACCGTGGCAGCGCAGGCTATGAAGGTTTATCGGGAACATCCC
ATTTTCTCTGAAGTTGTCTCGGACCAGGAAGCTGTGGCCGCTCTTGAGAAGTTTGTGGAT
GATGAGAAGATCCTGGTGGAGCCCGCCTGTGGGGCCGCCCTGGCCGCCGTCTACAGCAAC
GTGATTCAGAAGCTGCAAGGAGAGGGGAAACTCCGCACCCCGCTGTCCTCCCTCGTGGTC
ATTGTTTGTGGGGGCAGCAACATCAGCCTGGCGCAGCTGGTGGCGCTCAAGAAGCAGCTG
GGCATGGACGGGCTGTCCCAGTGA
Enzyme 7 GenBank Gene ID BC119966 Link Image
Enzyme 7 GeneCard ID SDS Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 12q24.13
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available