We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Lactic acid (RMDB00190)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 12:35:27
Accession Number RMDB00190
Common Name L-Lactic acid
Description Lactic acid plays a role in several biochemical processes and is produced in the muscles during intense activity. Lactate measurement in the critically ill has been traditionally used to stratify patients with poor outcome. However, plasma lactate levels are the result of a finely tuned interplay of factors that affect the balance between its production and its clearance. When the oxygen supply does not match its consumption, organisms such as man who are forced to produce ATP for their integrity adapt in many different ways up to the point when energy failure occurs. Lactate, being part of the adaptive response, may then be used to assess the severity of the supply/demand imbalance. In such a scenario, the time to intervention becomes relevant: early and effective treatment may allow the cell to revert to a normal state, as long as the oxygen machinery (i.e. mitochondria) is intact. Conversely, once the mitochondria are deranged, energy failure occurs even in the presence of normoxia. The lactate increase in critically ill patients may therefore be viewed as an early marker of a potentially reversible state. (PMID 16356243) A number of studies have demonstrated that malignant transformation is associated with an increase in glycolytic flux and in anaerobic and aerobic cellular lactate excretion. Using quantitative bioluminescence imaging in various primary carcinomas in patients (uterine cervix, head and neck, colorectal region) at first diagnosis of the disease, lactate concentrations in tumors in vivo could be relatively low or extremely high (up to 40 micromol/g) in different individual tumors or within the same lesion. In all tumor entities investigated, high molar concentrations of lactate were correlated with a high incidence of distant metastasis already in an early stage of the disease. Low lactate tumors (< median of approx. 8 micromol/g) were associated with both a longer overall and disease free survival compared to high lactate lesions (lactate > approx. 8 micromol/g). Lactate dehydrogenase was found to be upregulated in most of these tumors compared to surrounding normal tissue. (PMID 15279558)
Synonyms
  1. (+)-Lactate
  2. (+)-Lactic acid
  3. (S)-(+)-2-Hydroxypropanoate
  4. (S)-(+)-2-Hydroxypropanoic acid
  5. (S)-2-Hydroxypropanoic acid
  6. (S)-2-Hydroxypropionate
  7. (S)-2-Hydroxypropionic acid
  8. (S)-2-hydroxy-Propanoate
  9. (S)-2-hydroxy-Propanoic acid
  10. (S)-Lactate
  11. (S)-Lactic acid
  12. (alpha)-Lactate
  13. (alpha)-Lactic acid
  14. 1-Hydroxyethane 1-carboxylate
  15. 1-Hydroxyethane 1-carboxylic acid
  16. 1-Hydroxyethanecarboxylate
  17. 1-Hydroxyethanecarboxylic acid
  18. 2-Hydroxypropanoate
  19. 2-Hydroxypropionate
  20. L-2-Hydroxypropanoate
  21. L-2-Hydroxypropanoic acid
  22. Milk acid
  23. Sarcolactic acid
  24. a-Hydroxypropanoate
  25. a-Hydroxypropionate
  26. a-Hydroxypropionic acid
  27. alpha-Hydroxypropanoate
  28. alpha-Hydroxypropionate
  29. l-(+)- lactic acid
  30. alpha-Hydroxypropionic acid
  31. (S)-2-Hydroxypropanoate
  32. 2-Hydroxypropanoic acid
  33. a-Hydroxypropanoic acid
  34. alpha-Hydroxypropanoic acid
Chemical IUPAC Name (2S)-2-hydroxypropanoic acid
Chemical Formula C3H6O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Hydroxy Acids
Sub Class
  • Short chain hydroxy acids
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; carboxylic acid; alpha-hydroxyacid
Biofunction
  • Component of Cysteine metabolism; Component of Propanoate metabolism; Component of Pyruvate metabolism
Application
Source
  • Endogenous
Average Molecular Weight 90.078
Monoisotopic Molecular Weight 90.031693
Isomeric SMILES C[C@H](O)C(O)=O
Canonical SMILES CC(O)C(O)=O
KEGG Compound ID C00186 Link Image
BioCyc ID L-LACTATE Link Image
BiGG ID 34179 Link Image
Wikipedia Link Lactate Link Image
METLIN ID 5205 Link Image
PubChem Compound 107689 Link Image
PubChem Substance 7990899 Link Image
ChEBI ID 16651 Link Image
CAS Registry Number 79-33-4
InChI Identifier InChI=1/C3H6O3/c1-2(4)3(5)6/h2,4H,1H3,(H,5,6)/t2-/m0/s1
Synthesis Reference Lao, Hanzhang; Sun, Jianrong; Wang, Jian; Qian, Zhiliang. Process for preparation of high-purity L-lactic acid. Faming Zhuanli Shenqing Gongkai Shuomingshu (2007), 9pp.
Melting Point (Experimental) 16.8 oC (BP = 119 oC)
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1000.0 mg/mL [MEYLAN,WM et al. (1996)]; 562.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Liquid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.79 [Predicted by ALOGPS]; -0.6 [Predicted by PubChem via XLOGP]; -0.65 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location
  • Rumen
  • Cow_Milk
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 360 +/- 130 uM
Age N/A
Sex Both
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
Biofluid Rumen
Value 133.9 +/- 17.25 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 123.0 +/- 1.4 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal)
Biofluid Rumen
Value 159 +/- 22 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 252 +/- 61 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 180 +/- 118 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. L-lactate dehydrogenase A-like 6B
  2. L-lactate dehydrogenase B chain
  3. L-lactate dehydrogenase A chain
  4. L-lactate dehydrogenase
  5. L-lactate dehydrogenase
Enzyme 1 [top]
Enzyme 1 ID 573
Enzyme 1 Name L-lactate dehydrogenase A-like 6B
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name LDHAL6B
Enzyme 1 Protein Sequence >L-lactate dehydrogenase A-like 6B
MSWTVGILRASQRAGTVRANFLCLGMAPSPCPPAATPLGGAWAVAPASKMATVKCELMKN
FTSEEPVRNSKISIVGTGSVGMACAVSILLKGLSDELALVDVDEGRLKGETMDLQHGSLF
VKMPNIVSSRDYVVTANSNLVIITAGARQEKGETRLNLVQRNVAIFKLMMSSIVQYSPRC
KLIVVSNPVDILTYVAWKLSAFPQNRVIGSGCNLDTARFRFLIGQRLSIHSESCHGWILG
EHGDSSVPVWSGVNIAGVPLKELNLDIGTDKDPEQWKNVHKDVVASAYEIIKMKGYTYWA
IGLSVADLTESILKNLRRVHPVSTRIKGLYGINEEVFLSVPCILGESGITDLIKVKLAPE
EEARLQKSAKTLWDIQKELKF
Enzyme 1 Number of Residues 381
Enzyme 1 Molecular Weight 41592.0
Enzyme 1 Theoretical pI 8.88
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Energy production and conversion
Enzyme 1 Specific Function (S)-lactate + NAD(+) = pyruvate + NADH
Enzyme 1 Pathways
  • Fermentation
  • pyruvate fermentation to lactate
  • (S)- lactate from pyruvate:step 1/1
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 74354178 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q3T056 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name LDH6B_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1146 bp
ATGAGCTGGACTGTGGGAATCCTGCGGGCCAGCCAGAGAGCGGGCACTGTGAGGGCGAAT
TTCCTGTGCCTGGGAATGGCCCCAAGCCCCTGCCCGCCGGCAGCCACCCCCCTCGGGGGC
GCCTGGGCCGTGGCCCCCGCGTCCAAGATGGCGACGGTCAAGTGTGAGCTGATGAAGAAT
TTCACCTCAGAGGAGCCTGTTCGCAACAGTAAGATCTCTATCGTAGGAACCGGATCGGTT
GGCATGGCCTGTGCCGTCAGCATCCTGTTAAAAGGCTTGAGCGATGAACTCGCCCTGGTG
GATGTTGATGAAGGCCGACTGAAGGGTGAGACAATGGATCTTCAGCATGGCAGCCTTTTC
GTGAAAATGCCAAACATTGTTTCCAGCAGAGATTACGTTGTCACTGCAAACTCCAACCTC
GTGATTATCACGGCAGGTGCACGCCAGGAAAAAGGAGAAACACGCCTTAATTTAGTCCAG
CGAAATGTGGCCATCTTTAAATTAATGATGTCCAGTATTGTTCAGTACAGTCCGCGCTGC
AAACTGATTGTGGTTTCCAATCCGGTGGATATCTTGACGTACGTAGCCTGGAAGTTGAGT
GCCTTTCCCCAAAACCGTGTTATTGGAAGTGGTTGTAATCTGGACACTGCCCGTTTCCGT
TTCTTGATTGGGCAAAGGCTTAGTATCCATTCTGAAAGCTGTCATGGGTGGATCCTTGGA
GAGCACGGAGACTCAAGTGTTCCTGTGTGGAGTGGAGTGAACATCGCAGGTGTCCCTCTG
AAGGAACTGAACTTAGATATAGGAACTGATAAAGATCCGGAGCAGTGGAAAAATGTTCAC
AAAGATGTGGTTGCTAGTGCCTATGAGATTATTAAAATGAAAGGTTATACTTATTGGGCC
ATTGGCCTGTCTGTAGCTGACCTAACAGAAAGTATTTTGAAGAATCTTAGGAGAGTGCAT
CCAGTTTCCACCAGAATTAAGGGTCTCTATGGAATAAATGAAGAAGTATTCCTCAGTGTT
CCTTGTATCCTGGGGGAGAGTGGTATTACTGACCTTATAAAAGTAAAGTTGGCCCCTGAA
GAAGAGGCTCGTCTGCAGAAGAGTGCAAAAACACTTTGGGATATTCAAAAGGAGCTTAAG
TTTTAA
Enzyme 1 GenBank Gene ID BC102557 Link Image
Enzyme 1 GeneCard ID LDHAL6B Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 15q22.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 574
Enzyme 2 Name L-lactate dehydrogenase B chain
Enzyme 2 Synonyms
  1. LDH-B
Enzyme 2 Gene Name LDHB
Enzyme 2 Protein Sequence >L-lactate dehydrogenase B chain
MATLKEKLIAPVAEEETRIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDEEVAQLKKSADTLWGIQKDLKDL
Enzyme 2 Number of Residues 334
Enzyme 2 Molecular Weight 36723.4
Enzyme 2 Theoretical pI 6.40
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Energy production and conversion
Enzyme 2 Specific Function (S)-lactate + NAD(+) = pyruvate + NADH
Enzyme 2 Pathways
  • Fermentation
  • pyruvate fermentation to lactate
  • (S)- lactate from pyruvate:step 1/1
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 8979739 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5E9B1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name LDHB_BOVIN Link Image
Enzyme 2 PDB ID 1I0Z Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1005 bp
ATGGCAACTCTTAAGGAAAAATTGATTGCACCAGTTGCAGAAGAAGAGACAACGATCCCA
AACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCATGTGCCATCAGCATT
CTGGGAAAGTCTCTGACTGACGAGCTTGCTCTTGTGGATGTTTTGGAAGATAAACTCAAA
GGAGAAATGATGGACCTGCAGCACGGGAGCTTATTCCTTCAGACACCAAAAATTGTGGCA
GACAAAGATTACTCTGTCACTGCCAATTCCAAGATCGTGGTGGTAACTGCAGGAGTTCGC
CAGCAAGAAGGGGAGAGTCGCCTGAATTTGGTGCAAAGGAACGTTAACGTCTTCAAGTTC
ATCATTCCTCAGATCGTCAAGTACAGTCCTGCCTGCATCATCATTGTGGTTTCCAACCCA
GTGGATATTCTCACATATGTTACCTGGAAACTAAGTGGATTACCCAAGCACCGTGTGATT
GGGAGTGGATGTAACCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGC
ATTCATCCCAGCAGCTGCCACGGATGGATTTTGGGGGAACATGGCGACTCAAGCGTGGCT
GTGTGGAGTGGAGTGAATGTGGCAGGCGTTTCTCTCCAGGAACTGAATCCAGAAATGGGA
ACAGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAGAGTGCCTAT
GAAGTCATCAAGCTAAAAGGATATACCAACTGGGCTATTGGATTAAGTGTGGCTGATCTT
ATTGAATCCATGTTGAAAAATCTATCGAGGATTCACCCAGTGTCAACAATGGTGAAGGGC
ATGTATGGCATTGAGAATGAAGTCTTCCTGAGCCTTCCGTGTATCCTGAATGCTCGAGGG
TTAACCAGTGTTATCAACCAGAAGCTGAAGGATGAAGAGGTTGCTCAACTCAAGAAAAGT
GCAGACACCCTCTGGGGCATCCAAAAGGACCTGAAGGACCTGTGA
Enzyme 2 GenBank Gene ID AJ401268 Link Image
Enzyme 2 GeneCard ID LDHB Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 12p12.2-p12.1
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 575
Enzyme 3 Name L-lactate dehydrogenase A chain
Enzyme 3 Synonyms
  1. LDH-A
  2. LDH muscle subunit
  3. LDH-M
Enzyme 3 Gene Name LDHA
Enzyme 3 Protein Sequence >L-lactate dehydrogenase A chain
MATLKDQLIQNLLKEEHVPQNKITIVGVGAVGMACAISILMKDLADEVALVDVMEDKLKG
EMMDLQHGSLFLRTPKIVSGKDYNVTANSRLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNIVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEQWKAVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTHEEEACLKKSADTLWGIQKELQF
Enzyme 3 Number of Residues 332
Enzyme 3 Molecular Weight 36597.4
Enzyme 3 Theoretical pI 8.14
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Energy production and conversion
Enzyme 3 Specific Function (S)-lactate + NAD(+) = pyruvate + NADH
Enzyme 3 Pathways
  • Fermentation
  • pyruvate fermentation to lactate
  • (S)- lactate from pyruvate:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 217590 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P19858 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name LDHA_BOVIN Link Image
Enzyme 3 PDB ID 9LDT Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence Not Available
Enzyme 3 GenBank Gene ID D90141 Link Image
Enzyme 3 GeneCard ID LDHA Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 11p15.4
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 576
Enzyme 4 Name L-lactate dehydrogenase
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name LDHB
Enzyme 4 Protein Sequence >L-lactate dehydrogenase
MATLKEKLIAPVAEEETRIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLE
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDEEVAQLKKSADTLWGIQKDLKDL
Enzyme 4 Number of Residues 334
Enzyme 4 Molecular Weight 36724.3
Enzyme 4 Theoretical pI 5.93
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Energy production and conversion
Enzyme 4 Specific Function (S)-lactate + NAD(+) = pyruvate + NADH
Enzyme 4 Pathways
  • Fermentation
  • pyruvate fermentation to lactate
  • (S)- lactate from pyruvate:step 1/1
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 154425698 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID B0JYN3 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name B0JYN3_BOVIN Link Image
Enzyme 4 PDB ID 1I0Z Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1005 bp
ATGGCAACTCTTAAGGAAAAATTGATTGCACCAGTTGCAGAAGAAGAGACAAGGATCCCA
AACAATAAGATCACTGTAGTGGGTGTTGGACAAGTTGGTATGGCATGTGCCATCAGCATT
CTGGGAAAGTCTCTGACTGACGAGCTTGCTCTTGTGGATGTTTTGGAAGATAAACTCGAA
GGAGAAATGATGGACCTGCAGCACGGGAGCTTATTCCTTCAGACACCAAAAATTGTGGCA
GACAAAGATTACTCTGTCACTGCCAATTCCAAGATCGTGGTGGTAACTGCAGGAGTTCGC
CAGCAAGAAGGGGAGAGTCGCCTGAATTTGGTGCAAAGGAACGTTAACGTCTTCAAGTTC
ATCATTCCTCAGATCGTCAAGTACAGTCCTGACTGCATCATCATTGTGGTTTCCAACCCA
GTGGATATTCTCACATATGTTACCTGGAAACTAAGTGGATTACCCAAGCACCGTGTGATT
GGGAGTGGATGTAACCTGGATTCTGCTAGATTTCGCTACCTTATGGCTGAAAAACTTGGC
ATTCATCCCAGCAGCTGCCACGGATGGATTTTGGGGGAACATGGCGACTCAAGCGTGGCT
GTGTGGAGTGGAGTGAATGTGGCAGGCGTTTCTCTCCAGGAACTGAATCCAGAAATGGGA
ACAGACAATGATAGTGAAAATTGGAAGGAAGTGCATAAGATGGTGGTTGAGAGTGCCTAT
GAAGTCATCAAGCTAAAAGGATATACCAACTGGGCTATTGGATTAAGTGTGGCTGATCTT
ATTGAATCCATGTTGAAAAATCTATCGAGGATTCACCCAGTGTCAACAATGGTGAAGGGC
ATGTATGGCATTGAGAATGAAGTCTTCCTGAGCCTTCCGTGTATCCTGAATGCTCGAGGG
TTAACCAGTGTTATCAACCAGAAGCTGAAGGATGAAGAGGTTGCTCAACTCAAGAAAAGT
GCAGACACCCTCTGGGGCATCCAAAAGGACCTGAAGGACCTGTGA
Enzyme 4 GenBank Gene ID BC151427 Link Image
Enzyme 4 GeneCard ID LDHB Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 12p12.2-p12.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 577
Enzyme 5 Name L-lactate dehydrogenase
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name LDHC
Enzyme 5 Protein Sequence >L-lactate dehydrogenase
MSSVKEQLIENLIEEDEVSQSKITIVGTGAVGMACAICILLKDLADELALVDVVTDKLKG
ETMDLQHGSLFFNTPKIVSGKDYTVSANSKLVIITAGARQQEGESRLNLVQRNVDIMKSV
IPAIVQNSPDCKMLIVSNPVDILTYVVWKLSGLPATRVIGSGCNLDSARFRYLIGQKLGV
HPSSCHGWIIGEHGDSSVPLWSGVNVAGVALKSLDPKLGRDSDKDSWKNIHKEVVGRAHM
E
Enzyme 5 Number of Residues 241
Enzyme 5 Molecular Weight 26073.9
Enzyme 5 Theoretical pI 6.51
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Energy production and conversion
Enzyme 5 Specific Function (S)-lactate + NAD(+) = pyruvate + NADH
Enzyme 5 Pathways
  • Fermentation
  • pyruvate fermentation to lactate
  • (S)- lactate from pyruvate:step 1/1
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 86822218 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q2KJG0 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name Q2KJG0_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >726 bp
ATGTCATCTGTCAAGGAGCAGCTTATTGAGAATCTAATTGAGGAAGATGAAGTCTCCCAG
AGTAAGATCACCATTGTTGGAACTGGTGCTGTAGGCATGGCGTGTGCGATTTGTATCTTG
CTGAAGGATTTGGCTGATGAGCTTGCCCTTGTTGATGTTGTGACAGACAAACTGAAGGGA
GAAACAATGGATCTTCAGCATGGCAGTCTTTTCTTTAACACTCCAAAGATTGTCTCTGGA
AAAGATTACACTGTATCTGCAAATTCCAAATTAGTTATTATTACAGCAGGTGCACGGCAG
CAAGAGGGAGAAAGTCGCCTTAACCTGGTCCAACGTAATGTGGATATCATGAAGTCAGTC
ATTCCTGCCATAGTCCAAAATAGTCCTGACTGTAAGATGCTTATTGTTTCAAATCCAGTG
GATATTTTGACATACGTTGTCTGGAAGTTAAGTGGTTTACCTGCAACTCGTGTAATTGGA
AGTGGTTGTAATCTAGACTCTGCCCGTTTCCGTTACCTAATTGGACAGAAGTTAGGTGTA
CATCCCTCCAGCTGCCATGGTTGGATTATTGGTGAACATGGTGATTCTAGTGTGCCTTTA
TGGAGTGGAGTAAATGTTGCTGGTGTTGCTCTGAAGAGTCTAGACCCTAAGTTAGGAAGA
GATTCAGACAAGGACTCTTGGAAAAATATCCATAAGGAAGTTGTTGGAAGGGCTCATATG
GAATAA
Enzyme 5 GenBank Gene ID BC105361 Link Image
Enzyme 5 GeneCard ID LDHC Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 11p15.5-p15.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available