We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Aspartic acid (RMDB00191)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:45
Accession Number RMDB00191
Common Name L-Aspartic acid
Description Aspartic acid (Asp, D), also known as aspartate, the name of its anion, is one of the 20 natural proteinogenic amino acids which are the building blocks of proteins. As its name indicates, aspartic acid is the carboxylic acid analog of asparagine. As a neurotransmitter, aspartic acid may provide resistance to fatigue and thus lead to endurance, although the evidence to support this idea is not strong. (http://en.wikipedia.org/wiki/Aspartic_acid) Aspartic acid is a nonessential amino acid which is made from glutamic acid by enzymes using vitamin B6. The amino acid has important roles in the urea cycle and DNA metabolism. Aspartic acid is a major excitatory neurotransmitter, which is sometimes found to be increased in epileptic and stroke patients. It is decreased in depressed patients and in patients with brain atrophy. Aspartic acid supplements are being evaluated. Five grams can raise blood levels. Magnesium and zinc may be natural inhibitors of some of the actions of aspartic acid. Aspartic acid, with the amino acid phenylalanine, is a part of a new natural sweetener, aspartame. This sweetener is an advance in artificial sweeteners, and is probably safe in normal doses to all except phenylketonurics. The jury is still out on the long term effects it has on many brain neurohormones. Aspartic acid may be a significant immunostimulant of the thymus and can protect against some of the damaging effects of radiation. Many claims have been made for the special value of administering aspartic acid in the form of potassium and magnesium salts. Since aspartic acid is relatively nontoxic, studies are now in progress to elucidate its pharmacological and therapeutic roles. (http://www.dcnutrition.com/AminoAcids)
Synonyms
  1. (+)-Aspartate
  2. (+)-Aspartic acid
  3. (2S)-Aspartate
  4. (2S)-Aspartic acid
  5. (L)-Aspartate
  6. (L)-Aspartic acid
  7. (R)-2-aminosuccinate
  8. (S)-(+)-Aspartate
  9. (S)-(+)-Aspartic acid
  10. (S)-2-aminosuccinate
  11. (S)-2-aminosuccinic acid
  12. (S)-Aminobutanedioate
  13. (S)-Aminobutanedioic acid
  14. (S)-Aspartate
  15. (S)-Aspartic acid
  16. (S)-amino-Butanedioate
  17. (S)-amino-Butanedioic acid
  18. 2-Amino-3-methylsuccinate
  19. 2-Amino-3-methylsuccinic acid
  20. 2-Aminosuccinate
  21. 2-Aminosuccinic acid
  22. Aminosuccinate
  23. Asp
  24. Asparagate
  25. Asparagic acid
  26. Asparaginate
  27. Asparaginic acid
  28. Asparatate
  29. Aspartate
  30. H-Asp-OH
  31. L-(+)-Aspartate
  32. L-(+)-Aspartic acid
  33. L-Aminosuccinate
  34. L-Aminosuccinic acid
  35. L-Asparagate
  36. L-Asparagic acid
  37. L-Asparaginate
  38. L-Asparaginic acid
  39. L-Aspartate
  40. alpha-Aminosuccinate
  41. alpha-Aminosuccinic acid
Chemical IUPAC Name 2-aminobutanedioic acid
Chemical Formula C4H7NO4
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Essential amino acid; Non-essential amino acid; Component of Alanine and aspartate metabolism; Component of Arginine and proline metabolism; Component of Cysteine metabolism; Component of Glutamate metabolism; Component of Histidine metabolism; Component of Nitrogen metabolism; Component of Novobiocin biosynthesis; Component of Phenylalanine metabolism; Component of Phenylalanine, tyrosine and tryptophan biosynthesis; Component of Purine metabolism; Component of Tyrosine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 133.103
Monoisotopic Molecular Weight 133.037506
Isomeric SMILES N[C@@H](CC(O)=O)C(O)=O
Canonical SMILES NC(CC(O)=O)C(O)=O
KEGG Compound ID C00049 Link Image
BioCyc ID L-ASPARTATE Link Image
BiGG ID 33663 Link Image
Wikipedia Link Asp Link Image
METLIN ID 5206 Link Image
PubChem Compound 5960 Link Image
PubChem Substance 3351 Link Image
ChEBI ID 17053 Link Image
CAS Registry Number 56-84-8
InChI Identifier InChI=1/C4H7NO4/c5-2(4(8)9)1-3(6)7/h2H,1,5H2,(H,6,7)(H,8,9)/t2-/m0/s1
Synthesis Reference Pamfil, Maria; Lupescu, Irina; Savoiu, Valeria Gabriela. L-aspartic acid production from fumarate using Escherichia coli whole cells. Rom. (2005), 3pp.
Melting Point (Experimental) 270 oC
Experimental Water Solubility 5.39 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)]; 14 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 142.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity -3.89 [CHMELIK,J ET AL. (1991)] Source: PhysProp
Predicted LogP/Hydrophobicity -3.52 [Predicted by ALOGPS]; -3.7 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1GC4 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 114.7 +/- 46.6 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 37.2 +/- 0.4 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal)
Biofluid Rumen
Value 122 +/- 35 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 185 +/- 50 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 180 +/- 69 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Argininosuccinate synthase
  2. Adenylosuccinate synthetase isozyme 1
  3. Adenylosuccinate synthetase isozyme 2
  4. Aspartoacylase
  5. Asparagine synthetase [glutamine-hydrolyzing]
  6. Aspartyl-tRNA synthetase, cytoplasmic
  7. L-asparaginase
  8. Aspartyl aminopeptidase
  9. Aspartate aminotransferase, cytoplasmic
  10. Aspartyl/asparaginyl beta-hydroxylase
  11. Aspartate aminotransferase, mitochondrial
  12. Aspartyl-tRNA synthetase, mitochondrial
  13. Putative aspartate aminotransferase, cytoplasmic 2
  14. Glutamyl aminopeptidase
Enzyme 1 [top]
Enzyme 1 ID 237
Enzyme 1 Name Argininosuccinate synthase
Enzyme 1 Synonyms
  1. Citrulline--aspartate ligase
Enzyme 1 Gene Name ASS1
Enzyme 1 Protein Sequence >Argininosuccinate synthase
MSGKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDISKEFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQIRFELTCYSLAPQIKVIAPWRMPEFYNRFQGRNDLMEYAKQHGIPVPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNSPDMLEIEFKKGVPVKVTNVGD
GTTHSTALELFLYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVFKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPVDATGFININSLRLKEYHRLQNKVTAK
Enzyme 1 Number of Residues 412
Enzyme 1 Molecular Weight 46416.9
Enzyme 1 Theoretical pI 7.61
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Nucleotide transport and metabolism
Enzyme 1 Specific Function ATP + L-citrulline + L-aspartate = AMP + diphosphate + N(omega)-(L-arginino)succinate
Enzyme 1 Pathways
  • Nitrogen metabolism
  • urea cycle
  • (N(omega)-L- arginino)succinate from L-aspartate and L-citrulline:step 1/1
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 162697 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P14568 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ASSY_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1239 bp
ATGTCCGGCAAAGGCTCCGTGGTTCTGGCCTACAGTGGGGGCCTGGACACCTCCTGCATC
CTCGTGTGGCTGAAGGAGCAAGGCTATGACGTCATTGCCTACCTGGCCAACATCGGCCAG
AAAGAAGACTTTGAGGAAGCCAGGAAGAAGGCGCTGAAGCTTGGGGCCAAAAAGGTGTTC
ATTGAGGACATCAGCAAGGAGTTTGTGGAGGAGTTCATCTGGCCGGCCATCCAGTCCAGC
GCACTGTACGAGGACCGATACCTCCTGGGCACCTCTCTCGCCAGGCCCTGCATCGCCCGC
AAGCAGGTGGAGATCGCCCAGCGAGAAGGAGCCAAGTATGTGTCTCACGGCGCCACAGGA
AAGGGGAACGACCAGATCCGGTTTGAGCTCACCTGCTACTCGCTGGCCCCACAGATCAAG
GTCATCGCTCCCTGGAGGATGCCCGAGTTCTATAACCGCTTCCAGGGCCGCAACGATCTG
ATGGAGTATGCGAAGCAACATGGAATCCCCGTCCCAGTCACCCCCAAGAACCCGTGGAGC
ATGGACGAGAACCTGATGCATATCAGCTACGAGGCTGGAATCCTGGAGAACCCCAAGAAC
CAAGCGCCTCCAGGCCTCTACACAAAGACCCAGGACCCGGCCAAAGCCCCCAACAGCCCG
GACATGCTCGAGATCGAGTTCAAGAAAGGGGTCCCCGTGAAGGTGACCAACGTCGGGGAT
GGCACCACCCACAGCACAGCGTTGGAGCTTTTCCTGTACCTGAATGAAGTCGCTGGCAAG
CACGGCGTGGGCCGCATCGACATCGTGGAAAACCGCTTCATCGGGATGAAGTCCCGGGGT
ATCTACGAGACCCCAGCGGGGACGATCCTTTACCACGCTCATTTAGACATCGAGGCCTTC
ACCATGGACCGGGAAGTGCGCAAAATCAAGCAAGGCCTCGGCTTGAAATTCGCCGAGCTG
GTCTACACGGGTTTCTGGCACAGCCCCGAGTGTGAATTTGTCCGCCACTGCATTGCCAAG
TCCCAGGAGCGCGTGGAAGGGAAAGTGCAGGTGTCCGTCTTCAAGGGCCAGGTGTACATC
CTTGGCCGGGAGTCCCCACTGTCCCTCTACAATGAGGAGCTCGTGAGCATGAACGTGCAG
GGAGACTACGAGCCGGTTGATGCCACTGGTTTCATCAACATCAATTCCCTCAGGCTGAAG
GAATATCATCGCCTCCAGAACAAGGTCACCGCCAAATAG
Enzyme 1 GenBank Gene ID M26198 Link Image
Enzyme 1 GeneCard ID ASS1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:9
Enzyme 1 Locus 9q34.1
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 495
Enzyme 2 Name Adenylosuccinate synthetase isozyme 1
Enzyme 2 Synonyms
  1. AMPSase 1
  2. AdSS 1
  3. IMP--aspartate ligase 1
Enzyme 2 Gene Name ADSSL1
Enzyme 2 Protein Sequence >Adenylosuccinate synthetase isozyme 1
MSGTRASNDRPPSAGGVKRGRLQHEAATTGSRVTVVLGAQWGDEGKGKVVDLLATDADVV
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINPKAVSFIGNGVVVHLPGLFEEAEKNEKKG
LKDWEKRLVISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTRKGIGPAYSSKAARTGL
RICDLLSDFDEFSSRFKNLARQHQSMFPSLEVDVEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGEVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQSRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDALDEIKVGVAYKLGGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWE
DLPPQAQSYIRFVENHVGVAVKWVGVGKSRDSMIQLF
Enzyme 2 Number of Residues 457
Enzyme 2 Molecular Weight 50134.0
Enzyme 2 Theoretical pI 8.65
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Nucleotide transport and metabolism
Enzyme 2 Specific Function Plays an important role in the de novo pathway of purine nucleotide biosynthesis
Enzyme 2 Pathways
  • Purine metabolism
  • AMP biosynthesis via de novo pathway
  • AMP from IMP:step 1/2
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 148743868 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A5PJR4 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name PURA1_BOVIN Link Image
Enzyme 2 PDB ID 1MF1 Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1374 bp
ATGTCCGGGACCCGAGCCTCTAACGATCGGCCCCCCAGCGCGGGCGGCGTCAAGCGGGGG
CGGCTACAGCACGAGGCGGCGACCACCGGCTCCCGGGTGACCGTGGTGCTGGGCGCGCAG
TGGGGGGACGAGGGCAAAGGCAAGGTGGTGGACCTGCTGGCCACGGACGCCGACGTCGTC
AGCCGCTGCCAGGGAGGCAACAATGCTGGCCACACCGTGGTGGTGGATGGCAAGGAGTAC
GACTTCCACCTGCTGCCCAGTGGCATCATCAACCCCAAGGCCGTGTCCTTCATCGGCAAT
GGAGTGGTCGTCCACTTGCCGGGCTTGTTTGAAGAGGCAGAGAAGAACGAGAAGAAAGGC
CTGAAGGACTGGGAGAAGAGGCTCGTCATCTCTGACCGGGCCCACCTTGTGTTTGACTTT
CACCAGGCGGTGGACGGGCTCCAGGAGGTGCAGCGGCAGGCCCAGGAGGGCAAGAACATC
GGCACGACCCGGAAGGGGATCGGGCCGGCCTACTCGTCCAAGGCCGCCCGCACCGGCCTC
CGCATCTGCGACCTCCTGTCTGACTTCGACGAGTTCTCCTCCCGATTCAAGAACCTGGCA
CGCCAGCACCAGTCCATGTTCCCCAGTTTGGAAGTGGACGTTGAAGGTCAACTCAAAAGG
CTCAAGGGCTTCGCCGAGCGGATCCGCCCCATGGTCCGAGATGGCGTTTATTTCATGTAT
GAGGCGCTCCATGGCCCCCCTAAGAAGATCCTCGTGGAGGGTGCCAACGCAGCCCTCCTT
GACATTGACTTCGGGACCTACCCCTTCGTGACGTCCTCCAACTGCACGGTGGGCGGCGTG
TGCACCGGCCTGGGCATCCCGCCCCAGAACATAGGCGAGGTCTACGGTGTGGTCAAGGCC
TACACCACACGCGTGGGCATCGGCGCCTTCCCCACCGAGCAGATCAACGAGATCGGGGAC
CTGCTGCAGAGCCGCGGCCACGAGTGGGGCGTGACCACGGGCAGGAAGCGGCGCTGCGGC
TGGCTGGATCTGATGATCCTGAGATATGCCCACATGGTCAACGGATTCACCGCGCTGGCC
TTGACGAAACTGGACATCCTGGACGCCCTGGACGAGATCAAGGTCGGCGTGGCGTACAAG
CTTGGCGGGAAGCGGATCCCCTACTTCCCAGCCAACCAGGAGATCCTGCAGAAGGTGGAG
GTGGAATACGAGACGCTGCCAGGGTGGAAGGCGGACACCACGGGCGCCCGGAAGTGGGAG
GACCTCCCCCCGCAGGCCCAGAGCTACATCCGGTTCGTGGAGAACCACGTCGGCGTGGCA
GTGAAATGGGTTGGTGTCGGCAAGTCCAGAGATTCGATGATCCAGCTGTTTTAG
Enzyme 2 GenBank Gene ID BC142211 Link Image
Enzyme 2 GeneCard ID ADSSL1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 14q32.33
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 525
Enzyme 3 Name Adenylosuccinate synthetase isozyme 2
Enzyme 3 Synonyms
  1. AMPSase 2
  2. AdSS 2
  3. Adenylosuccinate synthetase, acidic isozyme
  4. IMP--aspartate ligase 2
Enzyme 3 Gene Name ADSS
Enzyme 3 Protein Sequence >Adenylosuccinate synthetase isozyme 2
MAFAETNPATSSLPNGDCGRPRTRPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFGGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMERIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHFPANQEVLNKVEVQYKTLPGWNTDISNARTFKE
LPINAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
Enzyme 3 Number of Residues 456
Enzyme 3 Molecular Weight 50156.1
Enzyme 3 Theoretical pI 6.72
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Nucleotide transport and metabolism
Enzyme 3 Specific Function Plays an important role in the de novo pathway of purine nucleotide biosynthesis
Enzyme 3 Pathways
  • Purine metabolism
  • AMP biosynthesis via de novo pathway
  • AMP from IMP:step 1/2
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 154425984 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID A7MBG0 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name PURA2_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence Not Available
Enzyme 3 GenBank Gene ID BC151541 Link Image
Enzyme 3 GeneCard ID ADSS Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1cen-q12
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 562
Enzyme 4 Name Aspartoacylase
Enzyme 4 Synonyms
  1. Aminoacylase-2
  2. ACY-2
Enzyme 4 Gene Name ASPA
Enzyme 4 Protein Sequence >Aspartoacylase
MTSCHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKK
CTRYIDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
NMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
PQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCAIEVYKIMRKVDYPRNESGEIS
AIIHPKLQDQDWKPLHPEDPVFLTLDGKTIPLGGDQTVYPVFVNEAAYYEKKEAFAKTTK
LTLNANSIRSSLH
Enzyme 4 Number of Residues 313
Enzyme 4 Molecular Weight 35737.6
Enzyme 4 Theoretical pI 6.65
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Amino acid transport and metabolism
Enzyme 4 Specific Function Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 4262832 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P46446 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name ACY2_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID S74726 Link Image
Enzyme 4 GeneCard ID ASPA Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 17pter-p13
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 563
Enzyme 5 Name Asparagine synthetase [glutamine-hydrolyzing]
Enzyme 5 Synonyms
  1. Glutamine-dependent asparagine synthetase
Enzyme 5 Gene Name ASNS
Enzyme 5 Protein Sequence >Asparagine synthetase [glutamine-hydrolyzing]
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKLQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVNLKHSMTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKHHHCRDEPLHALYDGVEKLFPGFEIETVKSNLRILFD
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVANHIGSEHHEVLFNSEEGIQVLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRVPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFRILQDYIEHQVDDAAMASAAQKFPINTPKTKEGYYYRQIFENHYPGRADWLPHYWMPR
WTNATDPSARTLTHYKAAAKA
Enzyme 5 Number of Residues 561
Enzyme 5 Molecular Weight 64219.1
Enzyme 5 Theoretical pI 6.77
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Amino acid transport and metabolism
Enzyme 5 Specific Function ATP + L-aspartate + L-glutamine + H(2)O = AMP + diphosphate + L-asparagine + L-glutamate
Enzyme 5 Pathways
  • Amino-acid biosynthesis
  • L-asparagine biosynthesis
  • L- asparagine from L-aspartate (L-Gln route):step 1/1
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 94534952 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q1LZA3 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name ASNS_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1686 bp
ATGTGTGGCATTTGGGCGCTCTTTGGCAGCGATGACTGCCTTTCTGTTCAGTGTCTGAGT
GCTATGAAGATTGCACACAGGGGTCCGGATGCATTCCGTTTTGAAAATGTTAATGGGTAC
ACCAATTGCTGCTTTGGATTTCACCGGTTGGCGGTAGTTGACCAGCTGTTTGGAATGCAG
CCAATTCGAGTGAAGAAATATCCTTACTTGTGGCTCTGTTACAACGGTGAAATCTACAAC
CACAAGAAGCTGCAACACCATTTTGAATTTGAATACCAGACCAAAGTGGATGGTGAAATA
ATCCTTCATCTTTATGACAAAGGAGGAATTGAACAAACAGTTTGTATGTTGGATGGAGTA
TTTGCATTTATTTTACTGGATACTGCCAATAAGAAAGTGTTCTTGGGCAGAGATACCTAT
GGAGTGAGACCTTTGTTTAAAGCCATGACAGAAGATGGATTTTTGGCCGTGTGTTCAGAA
GCTAAAGGACTGGTTAACTTGAAGCACTCCATGACTCCTTTTTTAAAAGTGGAGCCTTTT
CTGCCAGGACATTATGAAGTTTTGGACCTAAAGCCAAATGGCAAAGTGGCGTCGGTGGAA
ATGGTGAAGCACCATCACTGTAGAGACGAGCCTCTGCATGCCCTGTATGACGGCGTGGAG
AAACTCTTCCCAGGTTTTGAGATAGAAACTGTGAAGAGCAACCTCCGGATTCTTTTTGAC
AATGCCGTTAAGAAACGTTTGATGACGGACAGAAGGATTGGCTGCCTTTTATCAGGTGGC
TTGGATTCCAGTTTGGTTGCTGCCACTCTGTTGAAGCAGCTAAAAGAGGCCCAAGTTCAG
TACCCTCTCCAGACATTTGCGATTGGCATGGAAGACAGTCCCGATTTACTAGCTGCTAGA
AAGGTGGCAAATCATATTGGGAGCGAACACCATGAAGTCCTCTTTAACTCTGAGGAAGGC
ATTCAGGTCCTGGATGAAGTCATATTTTCCTTGGAAACTTATGATATTACAACAGTCCGT
GCTTCAGTAGGTATGTACTTAATTTCTAAGTACATTCGGAAGAACACAGATAGCGTGGTG
ATCTTCTCTGGAGAAGGTTCAGATGAACTTACGCAGGGTTATATATATTTTCACAAGGCT
CCTTCCCCGGAGAAAGCTGAGGAGGAGAGTGAGCGGCTTCTAAGGGAACTCTACTTGTTT
GATGTTCTCCGAGCAGATCGAACTACTGCAGCCCATGGCCTTGAATTGAGAGTCCCTTTC
TTGGATCATCGCTTTTCTTCCTACTACTTGTCTCTGCCACCAGATATGAGAGTTCCCAAG
AATGGGATAGAAAAGCATCTCCTGAGAGAGACATTTGAGGACTCCAATCTGATACCTAAA
GAGATTCTCTGGCGACCAAAAGAAGCCTTCAGTGATGGAATAACCTCAGTTAAAAATTCC
TGGTTTAGGATTTTACAGGACTATATTGAACATCAGGTTGATGATGCAGCGATGGCAAGC
GCAGCCCAGAAATTTCCCATCAATACCCCCAAAACAAAAGAAGGCTATTACTACCGTCAG
ATCTTTGAAAACCACTACCCAGGCCGTGCCGACTGGCTGCCCCATTACTGGATGCCCAGG
TGGACCAACGCCACGGACCCTTCTGCCCGCACTCTGACCCATTACAAGGCCGCTGCCAAA
GCTTAG
Enzyme 5 GenBank Gene ID BC116123 Link Image
Enzyme 5 GeneCard ID ASNS Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:7
Enzyme 5 Locus 7q21.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 564
Enzyme 6 Name Aspartyl-tRNA synthetase, cytoplasmic
Enzyme 6 Synonyms
  1. Aspartate--tRNA ligase
  2. AspRS
Enzyme 6 Gene Name DARS
Enzyme 6 Protein Sequence >Aspartyl-tRNA synthetase, cytoplasmic
MPSANASRRSQEKPREIMDAAEDYAKERYGVSSMIQSQEKPDRVLVRISDLTVQKAGEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISSAEPRLPLQLDDAVRPEVEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAIFRLQSGICHPFRETLTNKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVVEEIADTLVQIFKGLQKRFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGI
EMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM
RGEEILSGAQRIHDPQLVTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
Enzyme 6 Number of Residues 501
Enzyme 6 Molecular Weight 57035.7
Enzyme 6 Theoretical pI 6.84
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Translation, ribosomal structure and biogenesis
Enzyme 6 Specific Function ATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 74267650 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q3SYZ4 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name SYDC_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1506 bp
ATGCCCAGCGCCAACGCCAGCCGCAGGAGTCAGGAGAAGCCGCGGGAGATCATGGACGCG
GCGGAAGATTATGCAAAAGAAAGATACGGAGTATCTTCAATGATACAATCACAAGAAAAA
CCAGATCGAGTTTTGGTTCGAATTAGTGATTTGACAGTGCAAAAAGCTGGTGAAGTTGTT
TGGGTGCGTGCAAGGGTTCATACAAGCAGAGCTAAAGGAAAGCAGTGTTTCTTAGTCCTA
CGACAGCAGCAGTTTAATGTCCAGGCTCTTGTGGCGGTAGGAGACCATGCAAGCAAGCAG
ATGGTTAAATTTGCTGCCAACATCAACAAAGAGAGCATCGTTGATGTGGAAGGTGTTGTG
AGAAAAGTGAATCAGAAAATTGGAAGCTGTACACAACAAGATGTAGAGTTACATGTTCAA
AAGATTTATGTGATCAGTTCAGCTGAACCCCGCCTGCCCCTGCAGCTGGACGATGCTGTT
CGGCCTGAAGTGGAAGGAGAAGAGGAAGGAAGAGCTACTGTTAACCAGGATACGAGATTA
GACAACAGAGTCATTGATCTTAGGACATCAACTAGTCAGGCAATCTTCCGTCTCCAGTCT
GGCATCTGCCATCCTTTCCGAGAAACTTTAACTAACAAGGGTTTTGTGGAGATCCAAACT
CCTAAAATTATCTCAGCTGCCAGTGAAGGAGGAGCCAATGTATTTACTGTGTCATATTTT
AAAAATAATGCATACCTGGCTCAGTCTCCACAGCTGTACAAGCAAATGTGTATTTGTGCT
GATTTTGAGAAGGTTTTCTGTATTGGGCCAGTATTCAGAGCTGAAGACTCTAATACACAC
AGACATCTGACTGAATTTGTTGGCTTGGATATTGAAATGGCTTTTAATTACCATTACCAT
GAAGTTGTGGAAGAAATTGCCGACACTTTAGTGCAAATATTCAAAGGACTTCAGAAAAGG
TTTCAAACTGAAATTCAGACGGTGAATAAACAGTTCCCATGTGAGCCATTCAAATTTTTG
GAGCCAACTTTAAGACTAGAATACTGTGAAGCATTGGCTATGCTTAGGGAAGCTGGAATT
GAAATGGGAGATGAAGAAGATCTAAGTACACCAAATGAAAAACTGTTGGGTCGTTTGGTA
AAGGAAAAGTATGATACCGATTTTTATATTCTTGATAAATATCCATTGGCTGTAAGACCT
TTCTATACCATGCCTGACCCACGAAATCCTAAACAATCTAACTCTTATGATATGTTCATG
AGGGGAGAAGAAATACTGTCAGGAGCTCAAAGAATACATGACCCTCAGCTGGTAACAGAG
AGAGCCTTACATCATGGAATTGATTTGGAGAAAATTAAGGCATACATTGATTCCTTCCGT
TTTGGAGCCCCTCCTCATGCTGGTGGAGGCATTGGGTTGGAACGAGTGACTATGCTGTTT
TTGGGCTTGCACAATGTTCGTCAAACCTCAATGTTTCCCCGTGATCCCAAAAGACTTACT
CCTTAA
Enzyme 6 GenBank Gene ID BC103319 Link Image
Enzyme 6 GeneCard ID DARS Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 2q21.3
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 565
Enzyme 7 Name L-asparaginase
Enzyme 7 Synonyms
  1. L-asparagine amidohydrolase
  2. Asparaginase-like protein 1
Enzyme 7 Gene Name ASRGL1
Enzyme 7 Protein Sequence >L-asparaginase
MNPVVVVHGGGASNISKDRKERVRQGILRAATVGYNILKQGGSAVDAVEGAVTVLEDDPD
FNAGCGSVLNENGEVEMDASIMNGKDLSAGAVSAVRCIANPIKLARLVMDKTPHCFLTDQ
GAARFAAANGIPTIPGQQLVTERSRKRLEKEKLEKDAQKPDCQKNLGTVGAVALDCQGNL
AYATSTGGIVNKMPGRVGDTPCVGSGGYADNDIGAVSTTGHGESILKVNLARLALFHVEQ
GKSLEEAANASLGHMKSKVKGVGGIIMVNKAGEWAVKWTSTSMPWAAAKDGKLHSGIDFG
DTSIIDLS
Enzyme 7 Number of Residues 308
Enzyme 7 Molecular Weight 32050.2
Enzyme 7 Theoretical pI 7.47
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Amino acid transport and metabolism
Enzyme 7 Specific Function Acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 81673606 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q32LE5 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name ASGL1_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >927 bp
ATGAACCCCGTCGTCGTGGTCCACGGTGGCGGAGCCAGCAATATCTCCAAAGACCGGAAA
GAGCGGGTGCGCCAGGGCATCCTCAGAGCCGCCACCGTGGGTTACAACATCCTCAAGCAG
GGAGGGAGCGCCGTTGACGCGGTGGAAGGAGCCGTGACAGTGCTGGAAGACGATCCCGAC
TTCAACGCAGGTTGTGGATCTGTCTTGAACGAAAACGGGGAGGTTGAAATGGATGCCAGT
ATCATGAATGGGAAAGACCTGTCTGCAGGGGCGGTGTCTGCAGTCCGCTGTATCGCAAAT
CCCATTAAACTTGCACGGCTTGTTATGGACAAGACACCTCACTGCTTTCTGACTGACCAA
GGTGCAGCAAGATTTGCAGCAGCCAATGGGATTCCAACAATTCCTGGACAACAGCTGGTA
ACAGAAAGAAGCAGAAAACGCCTGGAAAAAGAAAAGCTTGAAAAAGATGCTCAGAAACCA
GACTGTCAGAAAAACTTGGGGACTGTGGGTGCTGTTGCCTTGGACTGCCAAGGAAACCTG
GCTTATGCAACCTCAACAGGGGGCATCGTCAACAAGATGCCGGGCCGCGTCGGGGACACG
CCGTGTGTAGGATCTGGAGGTTACGCTGACAATGACATCGGAGCTGTCTCAACGACAGGG
CACGGTGAGAGCATCCTGAAGGTGAATCTGGCCAGACTCGCGCTCTTCCACGTTGAACAG
GGAAAATCACTAGAAGAAGCTGCCAACGCATCACTGGGTCATATGAAGTCAAAGGTCAAG
GGCGTAGGTGGTATCATCATGGTCAACAAAGCAGGAGAGTGGGCGGTGAAGTGGACCTCC
ACATCCATGCCCTGGGCAGCGGCAAAGGATGGCAAGCTGCACTCGGGAATTGACTTCGGC
GACACGAGCATCATTGACCTGTCCTAA
Enzyme 7 GenBank Gene ID BC109621 Link Image
Enzyme 7 GeneCard ID ASRGL1 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 11q12.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 566
Enzyme 8 Name Aspartyl aminopeptidase
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name DNPEP
Enzyme 8 Protein Sequence >Aspartyl aminopeptidase
MSGRARKEAVQAAARELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKY
FLTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGG
IWSTWFDRDLTLAGRVIVKCPTSGRLEQRLVHVDRPILRIPHLAIHLQRNVNENFGPNME
MHLVPILATSIQEELEKGTPEPGPLNATDERHHSVLTSLLCAHLGLSPEDILEMELCLAD
TQPAVLGGAYEEFIFAPRLDNLHSCFCALQALIDSCSAPASLAADPHVRMIALYDNEEVG
SESAQGAQSLLTELVLRRISASPQHLTAFEEAIPKSYMISADMAHAVHPNYLDKHEENHR
PLFHKGPVIKVNSKQRYASNAVSEALIREVASSVGVPLQDLMVRNDSPCGTTIGPILASR
LGLRVLDLGSPQLAMHSIRETACTTGVLQTITLFKGFFELFPSLSRSLLVD
Enzyme 8 Number of Residues 471
Enzyme 8 Molecular Weight 51827.8
Enzyme 8 Theoretical pI 6.92
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Amino acid transport and metabolism
Enzyme 8 Specific Function Likely to play an important role in intracellular protein and peptide metabolism
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 88682882 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q2HJH1 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name DNPEP_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1416 bp
ATGAGCGGCAGGGCCCGCAAAGAGGCGGTTCAGGCCGCGGCCCGGGAACTGCTCAAGTTC
GTCAACCGGAGCCCCTCTCCTTTCCACGCGGTGGCCGAGTGCCGCAGTCGCCTCCTCCAG
GCCGGCTTCCATGAACTCAAGGAGACCGAGAGCTGGGATATCAAGCCGGAGAGCAAGTAC
TTCCTGACCAGGAACTCCTCCACCATCATCGCATTTGCTGTGGGGGGCCAGTACGTTCCC
GGCAATGGTTTCAGCCTCATTGGGGCCCACACGGACAGTCCCTGCCTCCGGGTGAAACGG
CGCTCTCGCCGCAGCCAGGTGGGCTTCCAGCAGGTTGGTGTGGAGACCTATGGTGGTGGG
ATCTGGAGCACCTGGTTTGACCGTGACCTGACCTTGGCTGGACGTGTCATTGTCAAGTGC
CCTACCTCAGGCCGGCTGGAGCAGCGGCTGGTGCACGTGGACAGGCCCATTCTTCGCATC
CCGCACCTGGCCATCCACCTGCAGAGAAATGTCAATGAGAATTTTGGGCCCAACATGGAG
ATGCACTTGGTCCCCATTCTTGCCACATCCATCCAGGAGGAGCTGGAGAAGGGGACTCCT
GAGCCAGGCCCCCTCAATGCTACAGATGAGCGGCACCACTCGGTCCTCACGTCCCTTCTC
TGCGCCCATCTGGGGCTGAGCCCCGAGGACATCTTGGAGATGGAACTGTGTCTCGCCGAC
ACTCAGCCAGCGGTCCTGGGTGGTGCCTACGAGGAGTTCATTTTTGCCCCTCGGCTGGAC
AACCTGCACAGCTGCTTCTGTGCCCTGCAGGCCTTGATCGATTCCTGCTCAGCCCCTGCC
TCTCTGGCCGCGGATCCCCACGTGCGCATGATCGCCCTCTATGACAATGAAGAGGTGGGG
TCAGAGAGTGCACAGGGCGCACAGTCACTGCTGACGGAGCTGGTGCTGCGGCGGATCTCG
GCTTCGCCCCAGCACCTGACGGCCTTCGAGGAAGCCATCCCCAAGTCCTACATGATCAGC
GCAGACATGGCCCATGCCGTGCACCCCAACTACCTGGACAAGCATGAGGAGAACCACAGG
CCCTTATTCCACAAGGGCCCTGTGATCAAGGTGAACAGCAAGCAACGCTATGCCTCAAAT
GCGGTTTCAGAGGCCCTGATCCGAGAGGTGGCCAGCAGTGTCGGGGTGCCCCTGCAGGAT
CTCATGGTCCGGAATGACTCGCCCTGCGGCACCACCATCGGACCTATCTTGGCCTCTCGG
CTAGGTCTGCGGGTGCTGGATTTAGGCAGCCCCCAGCTGGCCATGCATTCCATCCGGGAG
ACAGCCTGCACCACAGGAGTACTCCAGACCATCACTCTCTTTAAGGGCTTCTTTGAGCTG
TTCCCTTCTCTGAGCCGTAGCCTCCTGGTAGACTGA
Enzyme 8 GenBank Gene ID BC105402 Link Image
Enzyme 8 GeneCard ID DNPEP Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:2
Enzyme 8 Locus 2q35
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 567
Enzyme 9 Name Aspartate aminotransferase, cytoplasmic
Enzyme 9 Synonyms
  1. Transaminase A
  2. Glutamate oxaloacetate transaminase 1
Enzyme 9 Gene Name GOT1
Enzyme 9 Protein Sequence >Aspartate aminotransferase, cytoplasmic
MAPPSIFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDSQPWVLPVVRKVEQR
IANDSSINHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQCLGGTGALRIGAEFL
ARWYNGTNNKDTPVYVSSPTWENHNGVFIAAGFKDIRSYHYWDAAKRGLDLQGFLNDLEK
APEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGSLEKDAWA
IRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMEKIVRITWSNPP
AQGARIVARTLSDPELFNEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITEQIGM
FSFTGLNPKQVEYLINEKHIYLLPSGRINMCGLTTKNLEYVATSIHEAVTKIQ
Enzyme 9 Number of Residues 413
Enzyme 9 Molecular Weight 46398.5
Enzyme 9 Theoretical pI 7.56
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Amino acid transport and metabolism
Enzyme 9 Specific Function L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 184 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID P33097 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name AATC_BOVIN Link Image
Enzyme 9 PDB ID 1AJS Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1242 bp
ATGGCGCCTCCATCAATCTTTGCCGAGGTTCCTCAGGCCCAGCCGGTCCTTGTCTTTAAG
CTAACTGCTGACTTCCGGGAGGATCCGGACCCCCGCAAGGTCAACCTGGGAGTGGGAGCT
TATCGCACCGATGATAGCCAGCCCTGGGTTTTACCAGTCGTGAGGAAGGTGGAGCAGAGG
ATTGCTAACGACAGCAGCATAAACCATGAGTATCTGCCCATCCTGGGCCTGGCAGAGTTC
CGAACTTGTGCTTCCCGCCTGGCCCTTGGGGATGACAGCCCAGCTCTGCAAGAGAAGCGG
GTGGGAGGGGTGCAGTGCTTGGGGGGAACAGGTGCACTTCGAATCGGAGCTGAGTTCTTG
GCGCGCTGGTACAATGGAACAAACAACAAGGACACACCCGTCTATGTGTCCTCGCCAACC
TGGGAGAATCATAATGGTGTCTTTATTGCTGCTGGATTTAAAGACATTCGGTCCTATCAC
TATTGGGATGCAGCGAAGAGAGGACTAGACCTCCAGGGTTTCCTGAATGATTTGGAGAAA
GCTCCCGAGTTCTCCATCTTTGTCCTCCATGCCTGTGCGCACAACCCGACTGGGACTGAC
CCGACTCCGGAGCAGTGGAAGCAGATCGCCTCCGTCATGAAGCGCCGGTTTCTGTTCCCC
TTCTTTGACTCGGCCTATCAGGCGTTCGCATCTGGCAGCCTGGAGAAAGACGCCTGGGCC
ATTCGCTATTTTGTGTCTGAAGGGTTCGAGCTCTTCTGTGCCCAGTCCTTCTCCAAAAAC
TTCGGGCTCTACAATGAGCGTGTGGGGAATCTGACTGTGGTTGCCAAAGAACCAGATAGC
ATCCTGCGGGTCCTTTCCCAGATGGAGAAGATCGTGCGAATTACATGGTCCAATCCCCCA
GCTCAGGGAGCACGGATCGTGGCACGTACCCTGTCTGATCCTGAGCTCTTTAATGAATGG
ACAGGTAACGTGAAGACAATGGCAGACCGCATTCTGACCATGAGATCTGAGCTCAGGGCA
CGATTAGAAGCCCTCAAGACCCCAGGAACCTGGAACCACATCACAGAGCAGATCGGAATG
TTCAGCTTCACCGGGTTGAACCCCAAGCAGGTTGAGTATCTGATCAATGAAAAGCACATC
TATCTGCTGCCAAGTGGTCGGATCAACATGTGTGGCTTAACCACCAAAAATCTAGAGTAC
GTGGCCACCTCCATCCATGAAGCAGTCACCAAAATCCAGTGA
Enzyme 9 GenBank Gene ID X66020 Link Image
Enzyme 9 GeneCard ID GOT1 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 10q24.1-q25.1
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 568
Enzyme 10 Name Aspartyl/asparaginyl beta-hydroxylase
Enzyme 10 Synonyms
  1. Aspartate beta-hydroxylase
  2. ASP beta-hydroxylase
  3. Peptide-aspartate beta-dioxygenase
Enzyme 10 Gene Name ASPH
Enzyme 10 Protein Sequence >Aspartyl/asparaginyl beta-hydroxylase
MAPRKNAKGGGGNSSSSSSGSPTGCTSGGSSSPGARRETKQGGLKNGRKGGLSGSSFFTW
FMVIALLGVWTSVAVVWFDLVDYEEVLAKAKDFRYNLSEVLQGKLGIYDADGDGDFDVDD
AKVLLGLKEKPAPKPTVPPEEADMYPWLEDQVLESPGRQNIEDEVYEQVQSLDETVYSEP
GENLPQEPEGPAEELQPDDHVFVGSDADDRYEPMGTGAVHEETEDSYHIEETASPAYSQD
MEDMMYEQENPDSSEPVVVDDAERTYQETDDVTYRDYDEQDHAVDNSNTILEEPHMPPAE
EQQEVPPETNKKADEPGKKGKVKKKKPKLLNKFDKTIKAELDAAEKLRKRGKIEEAVNAF
EELVRKYPQSPGARYGKAQCEDDLAEKRRSNEILRRAIETYQEAASLPDAPTDLVKLSLK
RRSDRQQFLGHMRGSLLTLQKLVQLFPDDTALKNDLGVGYLLIGDNDSAKKVYEEVLSVT
PNDGFAKVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAY
RWYELGHQRGHFASVWQRSLYNVQGLKAQPWWTPKETGYTELVKSLERNWKLIRDEGLAA
MDRTHGLFLPEDENLREKGDWSQFTLWQQGRKNENACKGAPKTCSLLDKFPETTGCRRGQ
IKYSIMHPGTHVWPHTGPTNCRLRMHLGLVIPKEGCKIRCANETRTWEEGKVLIFDDSFE
HEVWQDAASFRLIFIVDVWHPELTPHQRRSLPAI
Enzyme 10 Number of Residues 754
Enzyme 10 Molecular Weight 84998.2
Enzyme 10 Theoretical pI 4.81
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 10 Specific Function Specifically hydroxylates an Asp or Asn residue in certain epidermal growth factor-like (EGF) domains of a number of proteins
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • 57-77
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 162694 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q28056 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name ASPH_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >2265 bp
ATGGCCCCGCGCAAGAATGCCAAGGGCGGCGGCGGCAACAGCAGCAGCAGCAGCTCTGGC
AGTCCGACCGGCTGCACCAGCGGCGGCAGCAGCAGCCCCGGGGCCCGGAGAGAGACGAAA
CAGGGAGGACTCAAGAATGGGAGGAAAGGAGGACTTTCTGGAAGTTCATTTTTCACATGG
TTTATGGTCATTGCACTGCTCGGAGTCTGGACATCAGTAGCTGTGGTCTGGTTTGATCTT
GTTGATTATGAAGAAGTGTTAGCCAAAGCAAAGGACTTCCGTTATAACTTGTCAGAGGTA
CTTCAAGGAAAACTTGGAATCTATGATGCTGATGGTGATGGAGATTTTGATGTGGATGAT
GCCAAAGTTTTATTAGGCCTTAAAGAAAAACCTGCTCCAAAGCCAACAGTGCCACCAGAA
GAGGCAGACATGTACCCTTGGCTGGAAGATCAGGTTCTGGAGAGCCCAGGACGTCAGAAT
ATTGAAGATGAAGTATATGAACAAGTTCAGTCACTTGATGAAACAGTATACTCAGAACCT
GGAGAGAACCTGCCCCAAGAACCAGAAGGACCAGCAGAAGAGCTGCAGCCCGACGACCAT
GTCTTTGTAGGAAGTGATGCAGATGACAGATACGAACCCATGGGAACTGGAGCCGTTCAT
GAAGAAACTGAAGATAGCTACCATATAGAAGAGACAGCTTCGCCAGCCTACAGTCAAGAT
ATGGAAGACATGATGTATGAGCAGGAAAATCCAGATTCCAGTGAACCAGTAGTAGTAGAT
GATGCTGAAAGAACATACCAAGAAACAGATGATGTCACCTACCGAGACTATGATGAACAA
GATCATGCTGTAGATAATTCAAACACAATTTTAGAAGAACCGCACATGCCCCCTGCAGAG
GAACAGCAAGAAGTACCACCAGAAACAAATAAGAAAGCAGATGAGCCAGGAAAAAAAGGA
AAAGTGAAGAAAAAGAAGCCTAAACTATTAAATAAATTTGATAAGACTATTAAAGCTGAG
CTCGATGCTGCAGAAAAACTCCGTAAAAGGGGAAAAATTGAGGAAGCAGTGAATGCATTT
GAAGAACTGGTTCGCAAGTACCCTCAGAGTCCAGGAGCTCGGTATGGGAAAGCACAGTGT
GAAGATGATTTGGCTGAGAAGAGAAGGAGCAATGAGATCCTGCGCAGGGCCATCGAGACC
TACCAGGAGGCGGCCAGTCTGCCTGATGCCCCCACAGACTTGGTGAAGCTGAGCCTGAAG
CGGAGGTCAGACAGACAGCAGTTTCTAGGTCACATGAGAGGATCCTTGCTTACTCTTCAG
AAATTAGTTCAACTATTTCCTGATGATACTGCCTTAAAGAATGACCTTGGAGTTGGATAC
CTCTTGATAGGTGACAATGACAGTGCCAAGAAGGTCTATGAAGAGGTTCTGAGCGTGACA
CCCAATGATGGTTTTGCTAAAGTGCATTATGGCTTTATCCTGAAGGCACAGAACAAGATT
GCTGAGAGCATCCCCTATCTGAAGGAAGGAATAGAATCTGGGGATCCTGGTACTGATGAT
GGGAGATTTTATTTTCACCTGGGGGACGCCATGCAGAGAGTTGGAAACAAAGAGGCATAT
CGGTGGTACGAGCTGGGGCACCAGAGGGGCCACTTTGCCTCCGTGTGGCAGCGCTCACTG
TACAACGTGCAGGGATTGAAAGCCCAGCCGTGGTGGACCCCCAAAGAGACCGGCTACACC
GAGTTAGTGAAGTCCTTAGAAAGAAACTGGAAGTTAATCAGAGATGAAGGCCTTGCAGCA
ATGGATAGAACCCATGGCCTCTTCCTGCCTGAAGATGAGAACCTGAGGGAAAAGGGTGAC
TGGAGTCAGTTTACGCTGTGGCAGCAAGGAAGAAAAAATGAAAATGCCTGTAAAGGAGCT
CCTAAGACCTGTTCTTTACTAGATAAATTCCCTGAGACAACAGGATGCCGAAGAGGACAG
ATCAAATATTCCATCATGCACCCGGGAACCCACGTGTGGCCGCACACGGGACCCACGAAC
TGTAGGCTCCGAATGCACCTGGGCTTGGTGATTCCCAAGGAAGGCTGCAAGATCCGATGC
GCCAACGAGACCAGGACGTGGGAAGAAGGCAAGGTGCTCATCTTTGACGACTCCTTTGAA
CACGAGGTGTGGCAGGATGCCGCGTCTTTCCGGCTCATCTTCATTGTGGATGTGTGGCAC
CCTGAGCTGACACCCCATCAGAGACGCAGCCTTCCTGCAATTTAG
Enzyme 10 GenBank Gene ID M91213 Link Image
Enzyme 10 GeneCard ID ASPH Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:8
Enzyme 10 Locus 8q12.1
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 569
Enzyme 11 Name Aspartate aminotransferase, mitochondrial
Enzyme 11 Synonyms
  1. mAspAT
  2. Transaminase A
  3. Glutamate oxaloacetate transaminase 2
  4. Fatty acid-binding protein
  5. FABP-1
  6. FABPpm
Enzyme 11 Gene Name GOT2
Enzyme 11 Protein Sequence >Aspartate aminotransferase, mitochondrial
MALLHSGRFLSGVAAAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLAEFCKASAELALGENNEV
LKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQSYR
YYDPKTCGFDFTGAIEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATVVKKNNLFA
FFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE
AKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLHEVKGMADRIISMRTQLVS
NLKKEGSSHNWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVAY
LAHAIHQVTK
Enzyme 11 Number of Residues 430
Enzyme 11 Molecular Weight 47513.2
Enzyme 11 Theoretical pI 9.45
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Amino acid transport and metabolism
Enzyme 11 Specific Function Facilitates cellular uptake of long-chain free fatty acids
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 415324 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID P12344 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name AATM_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >1293 bp
ATGGCCCTGCTGCACTCTGGCCGCTTCCTGTCCGGAGTCGCCGCGGCTTTCCACCCAGGC
CTCGCTGCCGCGGCTTCTGCCAGAGCCAGCTCCTGGTGGGCTCATGTGGAGATGGGGCCC
CCAGATCCCATCCTGGGAGTAACAGAAGCCTTTAAGAGAGACACCAACAGCAAAAAGATG
AACCTGGGAGTTGGTGCCTACCGGGATGATAATGGAAAGCCTTACGTGCTTCCAAGTGTC
CGGAAGGCGGAGGCCCAGATTGCTGCAAAAAATTTGGATAAAGAATACCTGCCCATTGCG
GGGCTGGCTGAATTTTGTAAGGCATCTGCAGAACTAGCCCTGGGTGAGAACAATGAAGTG
TTGAAAAGTGGCCGGTATGTCACCGTGCAGACCATTTCTGGAACCGGGGCCTTAAGGATC
GGAGCCAGTTTTCTGCAAAGATTTTTTAAGTTCAGCCGGGATGTCTTCCTGCCCAAACCA
ACCTGGGGGAATCATACACCCATCTTCAGGGATGCTGGCATGCAGCTCCAGAGTTATCGG
TACTATGACCCCAAGACGTGCGGCTTTGACTTCACAGGCGCTATTGAGGACATTTCAAAA
ATACCAGCGCAGAGTGTCATTCTCCTGCACGCCTGTGCCCACAACCCCACGGGAGTGGAC
CCTCGTCCTGAGCAGTGGAAGGAGATGGCGACAGTGGTGAAGAAAAACAATCTCTTTGCA
TTCTTTGACATGGCCTACCAAGGCTTTGCCAGTGGCGATGGTAACAAGGATGCCTGGGCT
GTGCGCCACTTCATCGAACAGGGCATTAATGTTTGTCTCTGCCAGTCCTATGCCAAGAAC
ATGGGCTTATACGGTGAGCGTGTGGGAGCCTTCACTGTGGTCTGCAAAGATGCCGAGGAA
GCCAAAAGAGTTGAGTCCCAGTTGAAGATCCTGATCCGTCCCATGTATTCCAACCCCCCT
ATCAATGGGGCCCGGATTGCCTCCACTATTCTCACCAGCCCGGATTTGCGGAAACAATGG
TTGCACGAAGTGAAGGGCATGGCCGACCGCATCATCAGCATGCGGACACAGCTGGTGTCC
AACCTCAAGAAGGAGGGCTCCTCCCACAACTGGCAGCACATCATTGACCAGATCGGCATG
TTTTGTTACACAGGCCTAAAGCCTGAACAGGTGGAGCGGCTGACCAAGGAGTTCTCCATC
TACATGACAAAGGATGGCCGCATCTCTGTGGCAGGGGTCACCTCAGGCAACGTGGCATAC
CTTGCTCACGCCATTCACCAGGTCACCAAGTAA
Enzyme 11 GenBank Gene ID Z25466 Link Image
Enzyme 11 GeneCard ID GOT2 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 16q21
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 570
Enzyme 12 Name Aspartyl-tRNA synthetase, mitochondrial
Enzyme 12 Synonyms
  1. Aspartate--tRNA ligase
  2. AspRS
Enzyme 12 Gene Name DARS2
Enzyme 12 Protein Sequence >Aspartyl-tRNA synthetase, mitochondrial
MFCWLSRLCGELSTPTRRTTQLIWSSAARSMVLSSQRIPELSSFVARTNTCGELRSSHLG
QEVTLCGWIQFRRQNIFLVLRDFHGLVQVVIPQDESAASVKKILCEAPMESVVQVSGTVI
SRPPGQKNPKMPTGEIEIKVKTAKLLNSCKKLPFEIKDFMKKTETLRLQYRYLDLRSVQM
QYNLRLRSQMVMKMREYLCNLHGFVDVETPTLFKRTPGGAKEFVIPSREPGKFYSLPQSP
QQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGVQSLIEGLLQY
SWPSDKDPLVVPFPSMPFAEALASYGTDKPDTRFGMKIVDISDMFRNTEVGFLQDALSKP
QGTVKAICIRKGAKYLKRKDIESIRKFAADHFNEEVLPIFLKTNENWNSPVAKFIMEEQG
LGLVKLLETQEEDVVLLTAGEHKKACSLMGKLRLECADLLEARGVVLRDPALFSFLWVVD
FPLFLPKEENPQELESAHHPFTAPHPSDIHLLYTEPHKVRSQHYDLVLNGNEIGGGSIRI
HNSELQHCVLDTVLKEDVKLLSHLLQALDYGAPPHGGIALGLDRLMCLVTGAPSIRDVIA
FPKSFRGHDLMSNAPDSIPPEELKPYHIQVSWPMDAETEKSSSNHPCRSES
Enzyme 12 Number of Residues 651
Enzyme 12 Molecular Weight 73687.4
Enzyme 12 Theoretical pI 7.39
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Translation, ribosomal structure and biogenesis
Enzyme 12 Specific Function ATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 151554225 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID A6QPU5 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name SYDM_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >1956 bp
ATGTTCTGTTGGTTAAGTCGACTGTGCGGGGAATTATCCACACCCACCAGAAGGACCACC
CAGTTGATCTGGAGTTCTGCCGCCCGAAGTATGGTACTGAGTTCACAGAGAATTCCAGAA
CTCAGTAGCTTTGTTGCCCGGACCAACACATGTGGAGAGTTGCGTTCTTCTCACTTAGGC
CAAGAAGTCACCTTATGTGGATGGATTCAGTTTCGAAGGCAAAATATCTTCCTGGTCCTA
AGAGATTTCCATGGACTTGTTCAAGTTGTCATTCCCCAGGATGAGTCTGCTGCTTCGGTG
AAGAAGATTTTATGTGAAGCTCCCATGGAATCTGTGGTGCAAGTGTCTGGGACAGTAATT
TCCCGACCTCCAGGACAAAAGAATCCAAAAATGCCAACAGGTGAGATTGAAATCAAAGTT
AAGACAGCTAAACTTCTGAATTCCTGCAAGAAGCTGCCCTTTGAAATTAAGGACTTTATG
AAGAAAACAGAGACTCTTCGTTTGCAGTACCGCTACTTAGATTTGCGTAGTGTCCAAATG
CAGTATAACCTGCGACTGAGATCCCAGATGGTCATGAAAATGCGGGAATATCTCTGTAAT
CTACATGGTTTTGTGGATGTAGAAACACCAACATTATTCAAGAGGACTCCAGGGGGTGCA
AAAGAGTTTGTAATACCATCCAGGGAACCTGGGAAGTTTTATTCTCTCCCTCAGAGTCCT
CAACAGTTTAAGCAGCTTCTGATGGTTGGTGGTCTAGACAGATATTTTCAGGTTGCCCGA
TGTTACCGAGACGAAGGTTCAAGACCAGACAGACAGCCTGAATTTACTCAGATCGACATA
GAGATGTCCTTTGTAGACCAGACGGGCGTCCAGAGTCTAATTGAGGGCTTGCTCCAGTAT
TCGTGGCCCAGTGACAAAGATCCTCTGGTGGTCCCTTTTCCTTCCATGCCTTTTGCTGAG
GCACTGGCCAGCTATGGAACCGATAAACCTGACACTCGCTTTGGGATGAAGATTGTAGAT
ATCAGTGACATGTTCAGAAACACAGAAGTTGGATTTCTCCAAGATGCCCTTAGTAAACCC
CAAGGAACTGTCAAAGCCATATGTATCCGTAAAGGAGCAAAATATTTGAAAAGGAAGGAC
ATTGAATCCATTAGAAAATTTGCAGCTGACCATTTTAATGAGGAAGTCTTACCTATATTC
CTGAAAACCAATGAAAACTGGAATTCTCCAGTTGCTAAGTTCATAATGGAGGAGCAAGGC
TTGGGACTCGTCAAACTGTTGGAGACCCAAGAGGAGGACGTGGTCCTGCTCACTGCCGGA
GAGCACAAGAAAGCATGCTCTTTGATGGGAAAATTACGACTGGAGTGTGCTGACCTTCTA
GAAGCAAGAGGAGTGGTGCTTCGTGACCCCGCTCTGTTCTCTTTCCTTTGGGTGGTGGAT
TTCCCCCTCTTCCTTCCCAAGGAGGAAAATCCCCAAGAGCTGGAGTCAGCCCACCACCCA
TTTACTGCTCCCCATCCGAGTGACATTCACCTTCTTTACACTGAGCCCCACAAGGTCCGT
AGCCAACACTATGACTTGGTTTTAAACGGCAATGAGATAGGAGGTGGTTCTATCCGAATT
CATAATTCAGAGCTTCAGCATTGCGTCCTGGACACAGTACTAAAGGAAGATGTGAAATTG
CTCTCCCATCTGCTCCAGGCTTTAGATTATGGGGCGCCCCCTCATGGAGGAATTGCCTTA
GGGTTAGACAGACTGATGTGCCTTGTCACTGGAGCACCAAGCATCAGAGATGTCATAGCC
TTCCCCAAATCCTTCCGGGGGCACGATCTCATGAGCAATGCCCCAGATTCTATCCCTCCT
GAGGAACTGAAGCCCTATCACATCCAGGTCTCCTGGCCAATGGATGCAGAAACAGAAAAG
AGCTCATCGAATCATCCATGCCGTTCAGAAAGTTGA
Enzyme 12 GenBank Gene ID BC149492 Link Image
Enzyme 12 GeneCard ID DARS2 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:1
Enzyme 12 Locus 1q25.1
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 571
Enzyme 13 Name Putative aspartate aminotransferase, cytoplasmic 2
Enzyme 13 Synonyms
  1. Transaminase A-like protein 1
  2. Glutamate oxaloacetate transaminase 1-like protein 1
Enzyme 13 Gene Name GOT1L1
Enzyme 13 Protein Sequence >Putative aspartate aminotransferase, cytoplasmic 2
MPTLSVFTDVPMAQKLEGSLLKTYKQDDNPNKMFLAYKVCMTSKGRPWVSSVVRKTRMQI
AQDPSLNYEYTPVMGMKSFVQASLNLLFGKNSQVIVENRAGGVQTVGDSGAFQLGAQFLK
SWCQSSQIVYIVSSQKEPHGLIFQDMGFTVYEHTFWDSAHLCLDPNMLLDVVKHAPHGCV
FVIGSMGNCQLTPSQWTQLMTLMKSKEIFPFFDIPYQGLSTGDLEEDARFLHYFVSQGFE
FFCSQSLSKNFGIYDEGVGTLVVVTLDNQLLLRVLSQLMNFARALWLNPPTTGARIITSV
LCNPAMQGEWRQSLEGVVENVMMTKEKVKEKLRLLGTPGSWDHITEQKGSHSYLGLNSQQ
VEYLISEKHIYIPKNGRINFTCINSYNIDYITSSINEAVCFTKDSER
Enzyme 13 Number of Residues 407
Enzyme 13 Molecular Weight 45917.5
Enzyme 13 Theoretical pI 6.97
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Amino acid transport and metabolism
Enzyme 13 Specific Function L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 83406131 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q2T9S8 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name AATC2_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >1224 bp
ATGCCCACTCTGTCTGTGTTCACAGATGTGCCCATGGCCCAGAAGCTAGAGGGCAGCTTG
CTCAAGACCTACAAGCAAGATGACAACCCTAACAAGATGTTCCTGGCCTATAAAGTCTGC
ATGACCAGCAAAGGCAGACCCTGGGTGTCCTCCGTGGTGCGCAAGACTCGAATGCAGATT
GCCCAAGATCCCTCCCTGAACTATGAGTACACGCCGGTGATGGGCATGAAATCATTCGTC
CAGGCTTCCCTGAACCTCCTCTTTGGAAAGAACAGCCAAGTCATTGTGGAGAACAGGGCA
GGGGGTGTGCAAACCGTCGGGGACAGCGGCGCTTTCCAACTCGGGGCTCAGTTCCTCAAA
TCTTGGTGTCAGAGTTCTCAGATAGTTTACATCGTTTCTTCTCAAAAAGAACCTCATGGA
CTCATCTTCCAGGACATGGGCTTTACAGTTTATGAACACACCTTCTGGGACTCTGCGCAT
CTGTGCTTGGACCCTAACATGCTCCTCGATGTGGTGAAGCATGCCCCGCATGGCTGCGTC
TTTGTGATCGGGAGTATGGGCAACTGTCAGCTGACCCCTAGTCAGTGGACACAGTTGATG
ACCCTGATGAAGAGCAAGGAGATATTTCCATTTTTTGACATTCCCTATCAAGGTTTATCC
ACTGGTGACCTGGAGGAGGATGCTAGATTCTTACACTACTTTGTGTCTCAAGGCTTTGAG
TTTTTCTGCAGCCAGTCTCTATCCAAGAATTTTGGCATTTATGATGAAGGAGTGGGCACT
CTCGTGGTGGTGACCCTCGACAACCAGCTCCTGCTGCGCGTCCTCTCCCAGCTGATGAAC
TTTGCGCGGGCCCTGTGGCTAAACCCTCCCACCACGGGCGCTCGCATCATCACCTCTGTC
CTCTGTAACCCTGCTATGCAGGGAGAATGGAGACAGAGTCTGGAAGGGGTTGTAGAGAAC
GTCATGATGACCAAGGAAAAGGTGAAGGAGAAGCTCCGGCTTCTGGGAACCCCTGGCTCC
TGGGATCACATCACTGAGCAGAAAGGGTCCCACAGCTATCTTGGACTCAACTCCCAACAG
GTGGAATACCTGATCAGTGAAAAGCATATCTATATCCCTAAGAATGGTCGGATCAACTTC
ACCTGTATCAATTCCTACAACATAGATTACATCACTTCGAGCATCAATGAGGCTGTCTGC
TTCACAAAGGACTCAGAGAGATAG
Enzyme 13 GenBank Gene ID BC111285 Link Image
Enzyme 13 GeneCard ID GOT1L1 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:8
Enzyme 13 Locus 8p12
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 572
Enzyme 14 Name Glutamyl aminopeptidase
Enzyme 14 Synonyms
  1. EAP
  2. Aminopeptidase A
  3. APA
  4. CD249 antigen
Enzyme 14 Gene Name ENPEP
Enzyme 14 Protein Sequence >Glutamyl aminopeptidase
MILEERSSWEGSKRYCIKTKHVAIICAVVVAVGLIVGLSVGLTRSCDSTEGMTQGTTQGT
TQAPSHLPPVTSPPEDQGVCPASEDESGGWKDFRLPDFIKPVHYDLEVKPLMEQDTYTGS
VDISINVSSSTRYLWLHLRETRITRLPVLRRPSGEQVQVRQCFEYKKQEYVVVEAEEELE
PNTGEGPYHLILEFAGWLNGSLVGFYRTTYVEKGQTKSIAATDHEPTDARKSFPCFDEPN
KKATYTISIVHSKEYKALSNMPVEKEESVDDIWSRTTFQKSVPMSTYLVCFAVHQFDSVT
RISNRGIPLTIYVQPEQKHTAEYAANITKSVFDYFEDYFGMSYSLPKLDKIAIPDFGTGA
MENWGLITYRETNLLYDPDESASSNKQRVAAVIAHELVHQWFGNIVTMEWWDDLWLNEGF
ASFFEYLGVAYAEKDWQMRDQMILDDVLPVQEDDSLMSSHPIVVTVATPDEITSVFDGIS
YSKGASILRMLENWITREKFQIGCQNYLKKHKFENAKTSDFWAALEEASNLPVKEVMDTW
TNQMGYPVLNVDNMKNITQKRFLLDPRANASEPHSAFGYTWNIPIKWTEDDEQRITLYNR
SETGGITLESTLSGNAFLKINPDHIGFYRVNYEVSTWEWIATNLSVNHTDFSSADRASFI
DDAFALARAQLLNYKEALNLTKYLKEEKEYLPWHRVISAVTYIISMFEDDKELYPVIEKY
FRDQVKPIADSLGWNDVGDHLTKLLRASVLGLACKMGDSDALNNASQLFQEWLTGTVSLP
VNLRLLVYRYGMQNSGNETSWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLL
KDSNLIKTQDVFTVIQYISYNSYGKTMAWNWIQLNWEYLVNRYTLNNRNLGRIVTIAEPF
NTELQLWQIKSFFERYPEAGAGQKPREQVLETVKNNIEWLKQNRDTIRNWFLDLNG
Enzyme 14 Number of Residues 956
Enzyme 14 Molecular Weight 109800.1
Enzyme 14 Theoretical pI 4.92
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Amino acid transport and metabolism
Enzyme 14 Specific Function Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • 22-42
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 81674650 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q32LQ0 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name AMPE_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >2871 bp
ATGATCTTGGAGGAGAGATCATCTTGGGAAGGCTCTAAGAGATACTGCATTAAGACGAAA
CATGTGGCCATTATCTGCGCAGTGGTGGTGGCTGTCGGATTAATAGTAGGACTTTCTGTG
GGTCTGACCAGATCATGTGACTCTACAGAGGGCATGACCCAGGGCACGACCCAGGGCACG
ACCCAGGCTCCTTCCCACCTGCCTCCCGTTACCAGCCCTCCAGAGGACCAGGGGGTCTGC
CCTGCCAGTGAGGATGAAAGCGGAGGCTGGAAAGACTTCAGGCTGCCGGACTTCATCAAA
CCAGTGCACTACGACCTGGAGGTGAAGCCCCTGATGGAGCAGGACACGTACACGGGCAGC
GTGGACATCTCCATCAACGTGAGCTCATCCACCCGGTACCTGTGGCTACATCTCCGGGAG
ACGAGGATCACCAGGCTCCCGGTGCTGAGGAGGCCGTCTGGGGAGCAGGTTCAAGTCAGG
CAGTGCTTCGAATACAAGAAGCAGGAGTATGTGGTGGTGGAAGCAGAAGAAGAGCTTGAG
CCCAACACTGGCGAGGGTCCCTACCACCTGATCCTGGAGTTCGCCGGCTGGCTGAACGGC
TCGCTCGTGGGATTTTACAGAACGACATACGTGGAGAAAGGACAAACCAAGAGCATAGCA
GCCACTGATCATGAACCAACAGATGCCAGGAAATCCTTCCCTTGTTTTGATGAGCCCAAC
AAAAAGGCAACGTATACAATATCCATTGTCCACTCCAAAGAATATAAGGCGCTTTCGAAT
ATGCCAGTGGAGAAAGAAGAGTCAGTGGATGATATATGGAGTCGGACAACTTTCCAGAAG
TCTGTTCCCATGAGTACTTACCTGGTGTGCTTTGCAGTGCATCAGTTTGACTCTGTAACG
AGAATATCAAACAGGGGGATACCTCTCACTATATATGTCCAGCCAGAGCAAAAGCACACA
GCTGAATATGCTGCAAACATAACTAAAAGTGTGTTTGACTATTTTGAAGACTACTTTGGT
ATGAGTTATTCTCTTCCTAAATTAGATAAAATTGCTATTCCAGATTTCGGCACTGGGGCT
ATGGAGAACTGGGGACTCATCACTTACAGAGAAACAAACCTGCTTTATGACCCTGATGAA
TCTGCCTCATCAAACAAACAGAGGGTGGCTGCTGTGATAGCCCATGAGCTTGTGCATCAG
TGGTTTGGAAATATTGTGACCATGGAATGGTGGGACGACTTGTGGCTAAATGAAGGATTT
GCTTCCTTCTTTGAGTACCTGGGAGTAGCCTATGCAGAAAAAGACTGGCAAATGCGTGAT
CAGATGATACTTGATGATGTATTACCTGTGCAAGAGGATGATTCTTTGATGTCTTCACAC
CCAATAGTAGTCACTGTAGCAACTCCTGATGAAATAACATCTGTTTTTGATGGAATTTCC
TATAGTAAGGGAGCTTCCATTCTGAGAATGCTTGAAAACTGGATAACACGAGAGAAATTT
CAAATAGGATGTCAGAATTACTTGAAAAAACACAAATTTGAGAATGCCAAAACTTCAGAT
TTCTGGGCAGCACTTGAAGAGGCAAGTAATCTCCCAGTGAAAGAAGTAATGGACACCTGG
ACCAATCAGATGGGTTACCCTGTACTTAACGTGGACAATATGAAGAACATCACACAGAAA
CGCTTTCTATTGGACCCGAGAGCTAATGCTTCTGAGCCACATTCAGCTTTTGGTTACACA
TGGAATATTCCAATTAAATGGACTGAAGATGATGAACAAAGGATTACATTATACAATAGG
TCAGAAACAGGAGGAATCACTTTGGAATCTACTCTTAGTGGGAATGCTTTTCTCAAAATA
AACCCTGATCATATTGGCTTTTATCGTGTAAATTATGAAGTGTCAACTTGGGAATGGATA
GCTACGAATCTTTCCGTCAACCACACGGACTTTTCTTCTGCTGATCGTGCAAGTTTTATT
GATGATGCTTTTGCCTTGGCACGAGCTCAGCTTCTAAATTATAAGGAGGCTCTGAACTTG
ACCAAGTATCTCAAGGAAGAAAAGGAATATTTACCATGGCACAGAGTCATTTCAGCTGTA
ACCTATATTATTAGCATGTTTGAAGATGATAAAGAGCTATACCCTGTGATTGAGAAATAC
TTCCGAGATCAAGTGAAGCCCATTGCAGATTCTCTGGGATGGAATGATGTTGGAGACCAC
CTCACAAAATTACTCCGTGCGTCTGTATTAGGACTGGCGTGCAAGATGGGAGACAGCGAT
GCCTTGAACAACGCTTCCCAGTTATTTCAGGAGTGGCTAACTGGGACTGTAAGTCTTCCT
GTAAATCTCAGGCTTCTGGTATATCGGTATGGTATGCAGAACTCTGGCAATGAGACTTCA
TGGAATTACACTCTCGAGCAATACCAGAAAACTTCATTAGCTCAAGAAAAAGAAAAGCTA
CTGTATGGATTAGCATCAGTGAAGAATGTTACTCTTTTGTCAAGGTATTTGGATTTACTC
AAGGACTCAAACCTTATTAAAACGCAGGATGTGTTTACAGTCATTCAGTACATCTCATAC
AACAGCTATGGGAAGACTATGGCCTGGAATTGGATACAACTCAACTGGGAATATCTAGTC
AACAGGTATACACTCAATAACAGAAACCTTGGCCGGATTGTCACTATAGCAGAGCCATTC
AACACTGAACTACAACTCTGGCAGATCAAGAGCTTTTTCGAAAGATATCCTGAAGCTGGA
GCGGGACAAAAACCTAGGGAGCAAGTACTGGAAACAGTGAAAAACAATATCGAGTGGCTA
AAACAAAACAGGGACACCATAAGAAACTGGTTTCTTGATTTGAATGGTTAA
Enzyme 14 GenBank Gene ID BC109476 Link Image
Enzyme 14 GeneCard ID ENPEP Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:4
Enzyme 14 Locus 4q25
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available