We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for N-Acetyl-D-glucosamine (RMDB00215)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 14:28:04
Accession Number RMDB00215
Common Name N-Acetyl-D-glucosamine
Description N-Acetyl-D-Glucosamine (N-acetlyglucosamine) is a monosaccharide derivative of glucose. Chemically it is an amide between glucosamine and acetic acid. A single N-acetlyglucosamine moiety linked to serine or threonine residues on nuclear and cytoplasmic proteins -O-GlcNAc, is an ubiquitous post-translational protein modification. O-GlcNAc modified proteins are involved in sensing the nutrient status of the surrounding cellular environment and adjusting the activity of cellular proteins accordingly. O-GlcNAc regulates cellular responses to hormones such as insulin, initiates a protective response to stress, modulates a cell's capacity to grow and divide, and regulates gene transcription. In humans, it exists in skin, cartilage and blood vessel as a component of hyaluronic acid, and bone tissue, cornea and aorta as a component of keratan sulfate. (PMID 16237703)
Synonyms
  1. 2-(acetylamino)-2-deoxyhexose
  2. 2-Acetamido-2-deoxy-D-glucose
  3. 2-Acetamido-2-deoxyglucose
  4. 2-Acetamido-D-glucose
  5. 2-Acetylamino-2-deoxy-D-glucose
  6. Acetylglucosamine
  7. Glcnac
  8. N-acetylchitosamine
  9. N-acetylglucosamine
Chemical IUPAC Name N-[(3R,4R,5S,6R)-2,4,5-trihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide
Chemical Formula C8H15NO6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; primary alcohol; secondary alcohol; 1,2-diol; secondary carboxylic acid amide; heterocyclic compound
Biofunction
  • Component of Aminosugars metabolism; Component of Glutamate metabolism; Component of Keratan sulfate biosynthesis; Component of N-Glycan biosynthesis
Application
Source
  • Endogenous
Average Molecular Weight 221.208
Monoisotopic Molecular Weight 221.089935
Isomeric SMILES CC(=O)N[C@@H]1[C@H](O)O[C@@H](CO)[C@H](O)[C@H]1O
Canonical SMILES CC(=O)NC1C(O)OC(CO)C(O)C1O
KEGG Compound ID C00140 Link Image
BioCyc ID ALPHA-D-GALACTOSYL-13-BETA-D-GALACTOS Link Image
BiGG ID 34006 Link Image
Wikipedia Link N-acetylglucosamine Link Image
METLIN ID 3356 Link Image
PubChem Compound 439174 Link Image
PubChem Substance 24890642 Link Image
ChEBI ID 17411 Link Image
CAS Registry Number 7512-17-6
InChI Identifier InChI=1/C8H15NO6/c1-3(11)9-5-7(13)6(12)4(2-10)15-8(5)14/h4-8,10,12-14H,2H2,1H3,(H,9,11)/t4-,5-,6-,7-,8+/m0/s1
Synthesis Reference Zhang, He; Qi, Shanlong; Yang, Shenggui. Production of N-acetyl-D-glucosamine from chitin. Faming Zhuanli Shenqing Gongkai Shuomingshu (2006), 6pp.
Melting Point (Experimental) 210 oC
Experimental Water Solubility 167 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 254.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -2.60 [Predicted by ALOGPS]; -2.1 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 154L Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • lysosome
Biofluid Location
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 16 uM
Age N/A
Sex Both
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments N-acetyl-D-Glucosamine act as growth factor in rumen of cows for methogenic bacteria
References
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Beta-1,4-galactosyltransferase 1
  2. Beta-1,4-galactosyltransferase 3
  3. Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
  4. Lysozyme C, milk isozyme
  5. Lysozyme C-3
  6. Lysozyme-like protein 6
  7. N-acetyl-D-glucosamine kinase
  8. Lysozyme C, non-stomach isozyme
  9. Lysozyme C, intestinal isozyme
  10. N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
  11. Lysozyme C-1
  12. Lysozyme C, tracheal isozyme
  13. Lysozyme C
  14. Lysozyme-like protein 1
  15. Sperm acrosome-associated protein 5
  16. Lysozyme C-2
Enzyme 1 [top]
Enzyme 1 ID 604
Enzyme 1 Name Beta-1,4-galactosyltransferase 1
Enzyme 1 Synonyms
  1. Beta-1,4-GalTase 1
  2. Beta4Gal-T1
  3. b4Gal-T1
  4. UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
  5. UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
  6. Lactose synthase A protein
  7. N-acetyllactosamine synthase
  8. Nal synthetase
  9. Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
  10. Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
  11. Processed beta-1,4-galactosyltransferase 1
Enzyme 1 Gene Name B4GALT1
Enzyme 1 Protein Sequence >Beta-1,4-galactosyltransferase 1
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL
QGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTS
APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH
KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL
KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ
FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF
DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Enzyme 1 Number of Residues 402
Enzyme 1 Molecular Weight 44842.2
Enzyme 1 Theoretical pI 9.60
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in alpha-tubulin binding
Enzyme 1 Specific Function The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix
Enzyme 1 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 25-44
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 382 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P08037 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name B4GT1_BOVIN Link Image
Enzyme 1 PDB ID 1FR8 Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1209 bp
ATGAAGTTTCGGGAGCCGCTCCTGGGCGGCAGTGCCGCGATGCCGGGCGCGTCCCTGCAG
CGGGCCTGCCGCCTCCTCGTGGCTGTCTGCGCCCTGCATCTTGGCGTCACCCTCGTCTAT
TACCTGGCCGGCCGAGACCTAAGACGCCTGCCTCAGCTGGTCGGAGTCCACCCACCGCTT
CAGGGAAGCTCTCACGGCGCCGCCGCTATCGGGCAGCCCTCCGGGGAGCTCCGGCTGCGA
GGGGTCGCACCGCCGCCGCCTTTGCAGAACTCTTCCAAGCCGCGCTCGCGGGCCCCCTCC
AACCTAGACGCGTACTCTCACCCCGGCCCTGGCCCGGGCCCGGGGAGCAACTTGACTTCG
GCCCCAGTGCCCTCCACCACAACACGCTCGCTGACCGCATGCCCTGAGGAGTCCCCGCTG
CTCGTCGGCCCCATGCTGATTGAGTTTAACATACCTGTGGACCTGAAGCTTATCGAGCAG
CAGAACCCGAAGGTGAAGTTGGGTGGTCGCTACACCCCCATGGACTGCATCTCTCCTCAC
AAGGTGGCCATCATCATTCTATTCCGCAACCGGCAGGAACACCTCAAGTACTGGCTGTAT
TACTTGCACCCAATGGTACAGCGTCAGCAGTTAGACTATGGCATCTATGTTATCAACCAG
GCTGGAGAGTCCATGTTCAACCGCGCAAAGCTCCTCAATGTTGGCTTTAAAGAGGCCTTG
AAGGACTATGACTACAACTGCTTTGTGTTTAGCGATGTGGACCTCATCCCAATGAACGAC
CATAACACCTACAGGTGCTTTTCACAGCCACGGCACATTTCTGTAGCAATGGATAAGTTT
GGATTTAGCCTACCTTACGTGCAGTATTTTGGAGGTGTCTCTGCTCTAAGTAAACAACAG
TTTCTCAGCATCAATGGATTTCCTAATAACTACTGGGGCTGGGGAGGTGAAGATGATGAC
ATTTATAACAGATTAGCTTTTAGAGGCATGTCTGTGTCTCGCCCAAATGCTGTGATCGGG
AAGTGTCGGATGATCCGCCACTCGAGAGACAAGAAAAATGAACCTAATCCTCAGAGGTTT
GACCGAATTGCACATACAAAGGAGACAATGCTCTCTGATGGTTTGAACTCACTCACCTAC
ATGGTGTTAGAGGTCCAGAGGTACCCGTTGTATACCAAAATCACAGTGGACATCGGGACG
CCGAGCTAG
Enzyme 1 GenBank Gene ID X14558 Link Image
Enzyme 1 GeneCard ID B4GALT1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:9
Enzyme 1 Locus 9p13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 640
Enzyme 2 Name Beta-1,4-galactosyltransferase 3
Enzyme 2 Synonyms
  1. Beta-1,4-GalTase 3
  2. Beta4Gal-T3
  3. b4Gal-T3
  4. UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3
  5. UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3
  6. N-acetyllactosamine synthase
  7. Nal synthetase
  8. Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
  9. Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
Enzyme 2 Gene Name B4GALT3
Enzyme 2 Protein Sequence >Beta-1,4-galactosyltransferase 3
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGREQEPAFDYSHPHDVYSNLSH
MPGAPVAPGGLPAPQGLPYCPKRSPLLVGPISVSFSPVPSLAEIVERNPRVEPGGRYRPA
RCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNV
GVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGV
SALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGN
EENPHRFDLLVRTQNSWTQDGMNSLTYQLLSRELGPLYTNITADIGTDPRGPRTSSGPHY
PPGSSQAFRQEMLQRRPPARPGPLPTANHTAPHGSH
Enzyme 2 Number of Residues 396
Enzyme 2 Molecular Weight 44370.2
Enzyme 2 Theoretical pI 9.32
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in beta-N-acetylglucosaminylglycopeptide beta-
Enzyme 2 Specific Function Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids
Enzyme 2 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 11-31
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59857729 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5EA87 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name B4GT3_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1191 bp
ATGTTGCGGAGGTTGCTGGAGCGGCCCTGCACCCTGGCCCTACTTGTGGGCTCCCAGCTG
GCAGTCATGATGTACCTGTCATTGGGGGGCTTTCGAAGCCTCAGTGCCCTCTTTGGCCGA
GAGCAGGAGCCGGCATTTGACTATTCTCATCCCCATGATGTCTACAGTAACCTCAGTCAC
ATGCCTGGGGCCCCTGTTGCCCCAGGGGGCCTCCCAGCTCCTCAAGGCCTGCCATACTGT
CCCGAACGATCTCCTCTCTTAGTGGGTCCCATATCCGTGTCCTTTAGCCCAGTGCCATCG
CTGGCAGAGATTGTGGAGAGGAATCCCCGGGTAGAACCGGGGGGCCGATACCGCCCTGCA
AGGTGTGAGCCCCGGTCCCGGACAGCCATCATTGTGCCCCACCGTGCCCGGGAGCACCAC
CTGCGCCTGCTGCTCTACCACCTGCACCCGTTCCTGCAGCGCCAGCAGCTTGCTTACGGC
ATTTATGTCATCCACCAGGCTGGAAATGGAACATTTAACAGGGCAAAGCTGCTGAATGTC
GGGGTGCGGGAGGCCCTGCGAGATGAAGAATGGGACTGCTTGTTTCTGCATGATGTGGAT
CTCCTGCCAGAGAACGACCACAACCTGTATGTGTGCGATCCCCGAGGACCTCGGCACGTT
GCTGTTGCCATGAACAAATTTGGATACAGCCTCCCGTATCCCCAGTACTTTGGCGGGGTC
TCAGCGCTCACTCCTGACCAGTACCTGAAGATGAATGGCTTCCCCAATGAATACTGGGGC
TGGGGTGGTGAGGATGACGACATTGCTACCAGGGTTCGCTTGGCTGGGATGAAGATATCT
CGTCCCCCCACATCCGTGGGACACTATAAGATGGTGAAGCACCGAGGAGATAAGGGCAAC
GAGGAAAATCCCCACAGGTTTGACCTCCTGGTCCGTACCCAGAATTCCTGGACTCAAGAT
GGAATGAACTCACTGACATACCAGTTGCTGTCTCGAGAGCTGGGCCCTCTCTATACGAAC
ATCACAGCAGACATTGGAACTGACCCTCGGGGTCCCCGGACTTCCTCTGGTCCCCATTAC
CCGCCTGGTTCCTCCCAAGCCTTCCGTCAGGAGATGCTGCAGCGCCGGCCCCCAGCCAGG
CCTGGCCCTCTGCCTACTGCCAACCACACAGCTCCTCATGGTTCACACTGA
Enzyme 2 GenBank Gene ID BT020682 Link Image
Enzyme 2 GeneCard ID B4GALT3 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1q21-q23
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 651
Enzyme 3 Name Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
Enzyme 3 Synonyms
  1. POMGnT1
Enzyme 3 Gene Name POMGNT1
Enzyme 3 Protein Sequence >Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
MDDWKPSPLIKPFGARKKRSWYLTWKYKLTNQRALRRFCQTGAVLFLLVTVIVNIKLILD
TRRAISEASEDLEPEQDYDEALGRLEPPRRIGSGPRRVLDVEVYSSRSKVYVAVDGTTVL
EDEAQEQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDE
GSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLL
KTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVL
NVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTP
ISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLY
CISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMR
MPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRNVDSLKKDA
YEVEVHRLLSEAEVLDHSKNPCEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLRIW
DLDVRGNHRGLWRLFRKKNHFLVVGVPASPYSMKKPPSITPIFLESPPKEEGGPGAAEQT
Enzyme 3 Number of Residues 660
Enzyme 3 Molecular Weight 75076.1
Enzyme 3 Theoretical pI 6.70
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in alpha-1,3-mannosylglycoprotein 2-beta-N-ace
Enzyme 3 Specific Function Participates in O-mannosyl glycosylation. May be responsible for the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O- Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins. Is specific for alpha linked terminal mannose
Enzyme 3 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 38-58
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 59857671 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q5EAB6 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name PMGT1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1983 bp
ATGGACGACTGGAAGCCCAGCCCCCTCATCAAGCCCTTTGGGGCGCGAAAAAAGCGGAGC
TGGTATCTTACCTGGAAGTATAAACTGACCAACCAGCGGGCCCTGCGGAGGTTCTGTCAG
ACAGGAGCCGTGCTTTTCCTACTGGTGACCGTCATTGTCAACATCAAGTTGATCCTGGAC
ACACGACGAGCTATCAGCGAGGCCAGTGAAGACCTGGAGCCAGAACAAGACTATGATGAG
GCCCTGGGCCGATTGGAGCCTCCACGGCGCATAGGCAGTGGTCCCCGACGTGTCCTGGAT
GTGGAGGTATACTCAAGCCGCAGCAAAGTGTATGTGGCAGTGGACGGCACCACGGTGCTG
GAGGATGAGGCCCAGGAGCAGGGCCGGGGCATCCACGTCATCGTCCTCAACCAGGCCACG
GGCCATGTGATGGCAAAGCGAGTGTTTGACACCTATTCACCTCATGAGGATGAGGCCATG
GTGCTGTTCCTCAACATGGTGGCACCTGGCCGAGTGCTCATCTGCACCGTCAAGGACGAG
GGCTCCTTCCACCTCAAGGACACCGCCAAGGCTCTGCTGAGGAGCCTAGGCAGCCAGGCT
GGCCCTGCCCTGGGCTGGAGAGACACCTGGGCCTTCGTGGGACGAAAAGGAGGTCCTGTG
CTCGGGGAGAAACATTCTAAGTCACCTGCCCTCTCCTCCTGGGGGGATCCAGTTCTGCTG
AAGACAGATGTGCCGCTGAGCTCAGCTGAAGAGGCAGAGTGCCACTGGGCAGACACAGAG
CTGAACCGTCGCCGCCGCCGCTTCTGCAGCAAAGTTGAGGGCTATGGGAGCGTGTGCAGC
TGCAAGGACCCCACACCCATCGAGTTCAGCCCTGACCCACTCCCAGACAACAAGGTCCTC
AATGTGCCTGTGGCTGTCATTGCAGGGAACCGGCCCAATTACCTGTACAGGATGCTGCGC
TCTCTACTCTCAGCCCAGGGGGTGTCTCCCCAGATGATAACAGTTTTCATCGATGGCTAC
TATGAGGAGCCGATGGATGTGGTGGCGCTGTTTGGTCTGAGGGGCATCCAGCACACTCCC
ATCAGCATCAAGAACGCCCGTGTGTCTCAGCACTACAAGGCCAGCCTCACTGCCACTTTC
AACCTGTTTCCGGAAGCCAAGTTTGCTGTGGTTCTGGAAGAGGACCTGGACATTGCTGTG
GATTTTTTCAGTTTCCTGAGCCAATCCATCCACCTGCTGGAGGAGGACGACAGCTTGTAC
TGTATCTCTGCCTGGAATGACCAGGGCTATGAGCACACGGCAGAGGACCCAGCACTGCTA
TACCGTGTGGAGACCATGCCTGGGCTGGGCTGGGTGCTCAGGAAGTCCTTGTACAAGGAG
GAGCTTGAACCCAAGTGGCCCACACCAGAAAAGCTCTGGGACTGGGACATGTGGATGCGG
ATGCCGGAACAACGCCGAGGCCGAGAATGCATTATCCCTGACGTGTCCCGATCCTACCAC
TTCGGCATCGTTGGCCTCAACATGAATGGCTACTTCCATGAGGCCTACTTCAAGAAGCAC
AAGTTCAACACGGTTCCAGGTGTCCAGCTCAGGAACGTGGACAGTCTGAAGAAGGATGCT
TATGAAGTGGAAGTTCACAGGCTGCTCAGCGAAGCAGAGGTTCTGGACCACAGCAAGAAC
CCTTGTGAAGACTCTTTCCTGCCAGACACAGAGGGCCACACCTACGTGGCCTTTATCCGG
ATGGAGAAGGACGATGACTTCACCACCTGGACTCAGCTTGCCAAGTGCCTCCGAATCTGG
GACCTGGATGTGCGTGGCAACCACCGGGGCCTGTGGAGACTGTTTCGGAAGAAGAACCAC
TTCCTGGTGGTGGGGGTCCCAGCCTCCCCGTACTCGATGAAGAAGCCACCATCAATCACC
CCAATTTTCTTGGAGTCACCCCCAAAGGAGGAGGGAGGCCCAGGAGCTGCAGAACAGACA
TGA
Enzyme 3 GenBank Gene ID BT020653 Link Image
Enzyme 3 GeneCard ID POMGNT1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1p34.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 699
Enzyme 4 Name Lysozyme C, milk isozyme
Enzyme 4 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 4 Gene Name Not Available
Enzyme 4 Protein Sequence >Lysozyme C, milk isozyme
MKALLIVGLLLLSVAVQGKKFQRCELARTLKKLGLDGYRGVSLANWVCLARWESNYNTRA
TNYNRGDKSTDYGIFQINSRWWCNDGKTPKAVNACRIPCSALLKDDITQAVACAKRVVRD
PQGIKAWVAWRNKCQNRDLRSYVQGCRV
Enzyme 4 Number of Residues 148
Enzyme 4 Molecular Weight 16782.4
Enzyme 4 Theoretical pI 10.43
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in lysozyme activity
Enzyme 4 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-18
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 51012437 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q6B411 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name LYSM_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >447 bp
ATGAAGGCTCTCCTTATTGTGGGGCTTCTCCTCCTTTCTGTTGCTGTCCAGGGCAAGAAA
TTTCAGAGGTGTGAGCTTGCCAGAACTCTGAAGAAACTTGGATTGGATGGCTATCGAGGA
GTCAGCCTGGCAAACTGGGTGTGTTTGGCCAGATGGGAAAGCAATTACAACACACGTGCT
ACAAACTACAATCGTGGAGACAAAAGCACTGATTATGGGATATTTCAAATCAATAGCCGC
TGGTGGTGCAATGATGGCAAAACCCCAAAAGCAGTTAACGCCTGTCGTATACCCTGCAGC
GCTTTGCTGAAAGATGACATCACTCAAGCTGTAGCATGTGCAAAGAGGGTTGTCAGAGAT
CCACAAGGCATTAAAGCATGGGTGGCATGGAGAAACAAGTGTCAAAACCGAGATCTCAGG
AGTTATGTTCAGGGTTGCAGAGTGTAA
Enzyme 4 GenBank Gene ID AY684064 Link Image
Enzyme 4 GeneCard ID Not Available
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Not Available
Enzyme 4 Locus Not Available
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 700
Enzyme 5 Name Lysozyme C-3
Enzyme 5 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 5 Gene Name LYZ3
Enzyme 5 Protein Sequence >Lysozyme C-3
MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVQGCTL
Enzyme 5 Number of Residues 147
Enzyme 5 Molecular Weight 16316.5
Enzyme 5 Theoretical pI 7.70
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in lysozyme activity
Enzyme 5 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • 1-18
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 163334 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q06284 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name LYSC3_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence Not Available
Enzyme 5 GenBank Gene ID M95099 Link Image
Enzyme 5 GeneCard ID LYZ3 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Not Available
Enzyme 5 Locus Not Available
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 701
Enzyme 6 Name Lysozyme-like protein 6
Enzyme 6 Synonyms Not Available
Enzyme 6 Gene Name LYZL6
Enzyme 6 Protein Sequence >Lysozyme-like protein 6
MTSPLLISLASCLVAVNQASLIGRCDLAKVLHQEDLDGFEGYSLTDWLCLAFVESDFNIT
KVNENTDGSFDYGIFQINSHYWCNDYQSRTENNCQVDCQELLSPNLLAIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLA
Enzyme 6 Number of Residues 148
Enzyme 6 Molecular Weight 16558.7
Enzyme 6 Theoretical pI 5.08
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in lysozyme activity
Enzyme 6 Specific Function Hydrolysis of (1->4)-beta-linkages between N- acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • 1-19
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 88954093 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q29RT1 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name LYZL6_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >447 bp
ATGACAAGCCCACTGCTCATCTCGTTGGCCAGCTGCCTCGTTGCTGTGAATCAAGCCAGC
CTCATTGGCCGCTGTGACTTGGCCAAGGTGCTGCACCAGGAGGACTTGGATGGGTTTGAG
GGCTACTCCCTGACTGACTGGCTGTGCCTGGCTTTCGTAGAGAGTGATTTCAACATAACA
AAGGTAAATGAAAACACAGATGGCAGCTTTGACTATGGCATCTTCCAGATCAACAGCCAC
TACTGGTGCAACGATTACCAGAGTCGCACGGAAAACAATTGCCAAGTGGACTGTCAAGAA
CTGCTGAGCCCCAATCTTCTCGCAATTATCAACTGTGCAAAAAAGATTGTGTCCGGAGCT
GGGGGCATGAAGAACTGGGTAAAATGGAGGTTGCACTGTGCTGGCCGGCCCCTCTCCTAC
TGGATGACAGGCTGTCACCTGGCATGA
Enzyme 6 GenBank Gene ID BC114039 Link Image
Enzyme 6 GeneCard ID LYZL6 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 17q11.2
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 703
Enzyme 7 Name N-acetyl-D-glucosamine kinase
Enzyme 7 Synonyms
  1. N-acetylglucosamine kinase
  2. GlcNAc kinase
Enzyme 7 Gene Name NAGK
Enzyme 7 Protein Sequence >N-acetyl-D-glucosamine kinase
MVTLYGGVEGGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKA
GVDPLVPLRGLGLSLSGGDQEDAVRMLMEELRDRFPYLSESYLITTDAAGSIATATPDGG
VVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHD
IGYVKQAMFNYFQVPDRLGILTHLYRDFDKSRFAGFCRKVAEGAQQGDPLSRCIFRKAGE
MLGRHVVAVLPEIDPVLFQGEMGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNSFS
GFTLLKLRHSSALGAASLGAKHIGHLLPMDYSTSAIAFYSYTFS
Enzyme 7 Number of Residues 344
Enzyme 7 Molecular Weight 37267.2
Enzyme 7 Theoretical pI 5.83
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Carbohydrate transport and metabolism
Enzyme 7 Specific Function Converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. Also has ManNAc kinase activity
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 74354699 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q3SZM9 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name NAGK_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1035 bp
ATGGTTACGCTGTACGGGGGCGTAGAGGGGGGAGGCACACGATCCAAGGTCCTTTTACTC
TCAGAGGATGGGCAGATCCTGGCAGAAGCGGATGGACTCAGCACAAACCACTGGCTGATC
GGGACAGACAAGTGCGTGGAGAGGATCAACGAGATGGTGAACAGGGCCAAACGGAAAGCA
GGGGTGGATCCTTTGGTTCCTCTCCGAGGCTTGGGCCTATCCCTGAGCGGTGGGGATCAG
GAGGACGCGGTGAGGATGCTGATGGAGGAGCTGAGGGACCGATTTCCCTACCTGAGTGAA
AGCTACTTAATCACCACCGATGCCGCCGGCTCCATCGCCACAGCTACGCCGGATGGTGGG
GTCGTGCTCATCTCTGGGACAGGTTCCAACTGCAGGCTCATCAACCCCGACGGCTCTGAG
AGCGGCTGTGGTGGCTGGGGCCACATGATGGGAGATGAGGGCTCAGCCTACTGGATTGCA
CATCAAGCAGTGAAAATAGTGTTTGACTCCATCGACAACCTCGAGGCGGCTCCTCATGAC
ATTGGCTATGTCAAACAGGCCATGTTCAACTATTTCCAGGTGCCAGATCGGCTAGGAATC
CTCACCCACCTGTATAGGGACTTTGATAAATCCAGGTTTGCTGGGTTTTGCCGGAAAGTT
GCAGAAGGCGCTCAGCAGGGAGACCCCCTTTCCCGTTGCATCTTCAGGAAGGCCGGGGAG
ATGCTAGGCAGACATGTGGTGGCAGTGTTGCCTGAGATTGACCCGGTCTTATTCCAGGGA
GAGATGGGCCTTCCCATCCTGTGCGTGGGCTCTGTGTGGAAGAGCTGGGAGCTGCTGAAG
GAAGGTTTCCTTTTGGCGCTGACCCAAGGCAGAGAGATCCAGGCTCAGAACTCCTTCTCA
GGCTTCACCCTGTTGAAGCTTCGACACTCCTCCGCCCTGGGTGCTGCCAGCCTTGGGGCC
AAGCACATCGGGCACCTCCTCCCCATGGACTACAGCACCAGTGCCATTGCCTTCTACTCC
TATACCTTCTCCTAG
Enzyme 7 GenBank Gene ID BC102780 Link Image
Enzyme 7 GeneCard ID NAGK Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:2
Enzyme 7 Locus 2p13.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 704
Enzyme 8 Name Lysozyme C, non-stomach isozyme
Enzyme 8 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 8 Gene Name LYS
Enzyme 8 Protein Sequence >Lysozyme C, non-stomach isozyme
MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQA
TNYNAGDQSTDYGIFQINSHWWCNDGKTPGAVNACHLPCGALLQDDITQAVACAKRVVSD
PQGIRAWVAWRSHCQNQDLTSYIQGCGV
Enzyme 8 Number of Residues 148
Enzyme 8 Molecular Weight 16475.7
Enzyme 8 Theoretical pI 7.98
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in lysozyme activity
Enzyme 8 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • 1-18
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein Not Available
Enzyme 8 UniProtKB/Swiss-Prot ID P80189 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name LYSCN_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID L23757 Link Image
Enzyme 8 GeneCard ID LYS Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Not Available
Enzyme 8 Locus Not Available
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 705
Enzyme 9 Name Lysozyme C, intestinal isozyme
Enzyme 9 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 9 Gene Name Not Available
Enzyme 9 Protein Sequence >Lysozyme C, intestinal isozyme
MKAVLILGLLLLSVTVQGKKFEKCELARTLRRYGLDGYKGVSLANWMCLTYGESRYNTRV
TNYNPGSKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSAMLKDDITQAVACAKTIVSR
QGITAWVAWKNKCRNRDVSSYIRGCKL
Enzyme 9 Number of Residues 147
Enzyme 9 Molecular Weight 16390.9
Enzyme 9 Theoretical pI 10.03
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in lysozyme activity
Enzyme 9 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • 1-18
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 51012439 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q6B410 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name LYSI_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >444 bp
ATGAAGGCTGTCCTTATTCTGGGGCTTCTCCTCCTTTCTGTCACTGTCCAGGGCAAGAAA
TTTGAGAAGTGTGAGCTTGCCAGAACTCTGAGAAGATATGGACTGGATGGCTATAAGGGA
GTCAGCCTGGCAAATTGGATGTGTTTGACCTATGGAGAAAGCCGTTATAACACACGAGTT
ACAAACTACAATCCTGGAAGCAAAAGCACTGATTATGGGATATTTCAGATCAACAGCAAA
TGGTGGTGTAATGATGGCAAAACCCCAAAAGCAGTTAACGGCTGTGGTGTATCCTGCAGT
GCTATGCTGAAAGATGACATCACTCAAGCTGTAGCATGTGCAAAGACGATTGTCAGTAGG
CAAGGCATTACAGCATGGGTGGCGTGGAAAAACAAGTGTCGAAACCGAGATGTCAGCAGT
TATATTCGGGGTTGCAAACTGTAA
Enzyme 9 GenBank Gene ID AY684065 Link Image
Enzyme 9 GeneCard ID Not Available
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Not Available
Enzyme 9 Locus Not Available
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 706
Enzyme 10 Name N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
Enzyme 10 Synonyms
  1. Phosphodiester alpha-GlcNAcase
  2. Mannose 6-phosphate-uncovering enzyme
Enzyme 10 Gene Name NAGPA
Enzyme 10 Protein Sequence >N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase
MASSMGRFLLFFIALRGFLLEASGDFGSGASRDDDVLLPYSRARARLARDCTRVHAGRLE
HHESWPPAAQTAGAHRPSVRTFVSYFADRAVPGHLTRAPEPLRTFSVLEPGGPGGCASKR
RATVEETARPSGCTVAQNGGFFRMETGECLGNVVSGGRRVSSAGGLQNAQFGIRRDGTLV
TGYLSEEEVLDTENPFVQLLSGVVWLIRNGSIYINESQAAECEETQETGSFNRFVNVISA
RTAVGHDRKGQLVLLHVDGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTL
ASYPSDHCQDNMWRCPRRVSTVVCVHEPRCQPPDCSGHGTCMEGRCQCTGHFWRGAACDK
LDCGPANCSQHGLCTETGCRCEAGWTGSNCSEECPLGWYGPGCQSPCKCEHQCPCDPQTG
NCSVNWSPTLSSLFSRVKECFPPPEVTVQAEELSLLTRTTWLAITLALAFLLLISTAANV
SLFLGSRAARRRHLDGAYVYHPLQEVNGEHPAAEKEQLGDSSNPFKD
Enzyme 10 Number of Residues 527
Enzyme 10 Molecular Weight 57222.8
Enzyme 10 Theoretical pI 6.39
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in N-acetylglucosamine-1-phosphodiester alpha-
Enzyme 10 Specific Function Catalyzes the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides by removing GlcNAc residues from GlcNAc-alpha-P- mannose moieties, which are formed in the first step
Enzyme 10 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • 1-24
Enzyme 10 Transmembrane Regions
  • 464-484
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein Not Available
Enzyme 10 UniProtKB/Swiss-Prot ID P68827 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name NAGPA_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence Not Available
Enzyme 10 GenBank Gene ID Not Available
Enzyme 10 GeneCard ID NAGPA Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:1
Enzyme 10 Locus 16p13.3
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 707
Enzyme 11 Name Lysozyme C-1
Enzyme 11 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 11 Gene Name LYZ1
Enzyme 11 Protein Sequence >Lysozyme C-1
MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKQIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
Enzyme 11 Number of Residues 147
Enzyme 11 Molecular Weight 16278.5
Enzyme 11 Theoretical pI 7.24
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in lysozyme activity
Enzyme 11 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • 1-18
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 163330 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q06285 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name LYSC1_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence Not Available
Enzyme 11 GenBank Gene ID M95097 Link Image
Enzyme 11 GeneCard ID LYZ1 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Not Available
Enzyme 11 Locus Not Available
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 708
Enzyme 12 Name Lysozyme C, tracheal isozyme
Enzyme 12 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 12 Gene Name Not Available
Enzyme 12 Protein Sequence >Lysozyme C, tracheal isozyme
MKALLILGLLLLSVAVQGKTFKRCELAKTLKNLGLAGYKGVSLANWMCLAKGESNYNTQA
KNYNPGSKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGITAWVAWKNKCRNRDLTSYVKGCGV
Enzyme 12 Number of Residues 147
Enzyme 12 Molecular Weight 15928.5
Enzyme 12 Theoretical pI 10.07
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in lysozyme activity
Enzyme 12 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • 1-18
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 841212 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID Q27996 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name LYSCT_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID U19466 Link Image
Enzyme 12 GeneCard ID Not Available
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Not Available
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 709
Enzyme 13 Name Lysozyme C
Enzyme 13 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 13 Gene Name LYZ1
Enzyme 13 Protein Sequence >Lysozyme C
MKALVILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCRELMENDIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
Enzyme 13 Number of Residues 147
Enzyme 13 Molecular Weight 16372.6
Enzyme 13 Theoretical pI 7.70
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in lysozyme activity
Enzyme 13 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • 1-18
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 163313 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID P04421 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name LYSC_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >444 bp
ATGAAGGCTCTCATTATTCTGGGGTTTCTCTTCCTTTCTGTCGCTGTCCAAGGCAAGGTC
TTTGAGAGATGTGAGCTTGCCAGAACTCTGAAGAAACTTGGACTGGATGGCTATAAGGGA
GTCAGTCTGGCAAACTGGCTGTGTTTGACCAAATGGGAAAGCAGTTATAACACAAAAGCT
ACAAACTACAATCCTGGCAGTGAAAGCACTGATTATGGGATATTTCAGATCAACAGCAAA
TGGTGGTGTAATGATGGCAAAACCCCCAACGCAGTTGACGGCTGTCATGTATCCTGCAGC
GAATTAATGGAAAATGAGATCGCGAAAGCTGTAGCGTGTGCCAAGCAGATTGTCAGTGAG
CAAGGCATTACAGCATGGGTGGCATGGAAAAGTCACTGTCGAGACCATGACGTCAGCAGT
TATGTTGAGGGTTGCACGCTGTAA
Enzyme 13 GenBank Gene ID M26246 Link Image
Enzyme 13 GeneCard ID LYZ1 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Not Available
Enzyme 13 Locus Not Available
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References
  1. [PubMed Link Image]
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 710
Enzyme 14 Name Lysozyme-like protein 1
Enzyme 14 Synonyms Not Available
Enzyme 14 Gene Name LYZL1
Enzyme 14 Protein Sequence >Lysozyme-like protein 1
MKAAGILALMGCLVTVVEPKVYTRCKLAKIFSRASLDNYRGFSLGNWICMAYYESHYNTT
AQTQLEDGSTDYGIFQINSDTWCRSTKLQEKNRCHVACSALMTDDLTDAIICAKKIVKET
DGMNYWQGWKKNCEGRDLSEWKKGCEVS
Enzyme 14 Number of Residues 148
Enzyme 14 Molecular Weight 16779.1
Enzyme 14 Theoretical pI 7.91
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in lysozyme activity
Enzyme 14 Specific Function Hydrolysis of (1->4)-beta-linkages between N- acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • 1-19
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 117306309 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID A0JNM6 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name LYZL1_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >447 bp
ATGAAGGCTGCTGGTATTTTGGCCCTGATGGGCTGCCTGGTCACAGTCGTTGAGCCCAAA
GTCTACACTCGATGTAAACTGGCAAAAATATTTTCGAGGGCCAGCCTGGACAATTACCGA
GGCTTTAGCCTTGGAAACTGGATCTGCATGGCCTACTATGAGAGCCACTACAACACCACG
GCTCAGACCCAACTGGAGGACGGAAGCACCGACTATGGCATCTTTCAGATAAACAGCGAC
ACGTGGTGCAGAAGTACAAAGCTACAAGAGAAAAACCGCTGTCACGTGGCCTGCTCAGCC
TTGATGACTGATGACCTCACGGATGCAATTATCTGTGCCAAGAAAATTGTTAAAGAAACG
GATGGCATGAACTACTGGCAAGGCTGGAAGAAGAACTGTGAGGGCAGAGACCTGTCTGAG
TGGAAAAAGGGATGTGAGGTTTCATGA
Enzyme 14 GenBank Gene ID BC126794 Link Image
Enzyme 14 GeneCard ID LYZL1 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 10p11.23
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 711
Enzyme 15 Name Sperm acrosome-associated protein 5
Enzyme 15 Synonyms
  1. Lysozyme-like protein 5
Enzyme 15 Gene Name SPACA5
Enzyme 15 Protein Sequence >Sperm acrosome-associated protein 5
MQVSGTIVVILMAANVEAKIYERCDLAKKLEAAGLNGFKGYTIGDWLCMAHYESGFDTSF
VNHNPDGSSEYGIFQLNSAWWCYNGVTPSENLCHMDCHELLNRHILDDIMCAKKVVSSES
GMSAWDSWNQHCYGYDLSEWLRGCHMNAKPNKKIIS
Enzyme 15 Number of Residues 156
Enzyme 15 Molecular Weight 17579.8
Enzyme 15 Theoretical pI 5.84
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Involved in lysozyme activity
Enzyme 15 Specific Function Hydrolysis of (1->4)-beta-linkages between N- acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • 1-18
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 79158913 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q32PD6 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name LYZL5_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >471 bp
ATGCAGGTCTCAGGCACTATTGTGGTGATCCTGATGGCTGCCAACGTGGAGGCCAAGATC
TACGAACGCTGTGACCTGGCAAAGAAGCTGGAAGCAGCAGGCCTCAACGGCTTCAAGGGC
TATACCATTGGAGACTGGCTGTGCATGGCACACTATGAGAGTGGCTTTGACACTTCCTTC
GTGAACCACAATCCCGATGGCAGCAGTGAATATGGCATTTTTCAGCTGAATTCCGCCTGG
TGGTGTTACAATGGTGTTACACCCAGCGAGAACCTCTGCCACATGGATTGTCATGAACTG
CTCAACCGCCATATTCTGGATGACATTATGTGTGCCAAGAAGGTAGTGTCCTCAGAGAGT
GGCATGAGTGCTTGGGATTCTTGGAACCAACACTGTTATGGCTATGATTTATCTGAATGG
CTCAGGGGATGTCATATGAATGCAAAACCTAACAAAAAAATTATTTCATGA
Enzyme 15 GenBank Gene ID BC108157 Link Image
Enzyme 15 GeneCard ID SPACA5 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Not Available
Enzyme 15 Locus Not Available
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References Not Available
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 712
Enzyme 16 Name Lysozyme C-2
Enzyme 16 Synonyms
  1. 1,4-beta-N-acetylmuramidase C
Enzyme 16 Gene Name LYZ2
Enzyme 16 Protein Sequence >Lysozyme C-2
MKALVILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVEGCTL
Enzyme 16 Number of Residues 147
Enzyme 16 Molecular Weight 16303.5
Enzyme 16 Theoretical pI 7.31
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in lysozyme activity
Enzyme 16 Specific Function Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte- macrophage system and enhance the activity of immunoagents
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • 1-18
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 163332 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q06283 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name LYSC2_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence Not Available
Enzyme 16 GenBank Gene ID M95098 Link Image
Enzyme 16 GeneCard ID LYZ2 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Not Available
Enzyme 16 Locus Not Available
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available