We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Pyroglutamic acid (RMDB00267)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-03 12:31:57
Accession Number RMDB00267
Common Name Pyroglutamic acid
Description A cyclized derivative of L-glutamic acid. It is an uncommon amino acid derivative in which the free amino group of glutamic acid cyclizes to form a lactam. It is formed nonenzymatically from glutamate, glutamine, and gamma-glutamylated peptides, but it can also be produced by the action of gamma-glutamylcyclotransferase on an L-amino acid. Elevated blood levels may be associated with problems of glutamine or glutathione metabolism. This compound is found in substantial amounts in brain tissue and other tissue in bound form, esp. skin. Also present in plant tissues. It is sold, over the counter, as a "smart drug" for improving blood circulation in the brain.
Synonyms
  1. (-)-2-Pyrrolidone-5-carboxylate
  2. (-)-2-Pyrrolidone-5-carboxylic acid
  3. (-)-Pyroglutamate
  4. (-)-Pyroglutamic acid
  5. (5S)-2-Oxopyrrolidine-5-carboxylate
  6. (5S)-2-Oxopyrrolidine-5-carboxylic acid
  7. (S)-(-)-2-Pyrrolidone-5-carboxylate
  8. (S)-(-)-2-Pyrrolidone-5-carboxylic acid
  9. (S)-(-)-g-Butyrolactam-g-carboxylate
  10. (S)-(-)-g-Butyrolactam-g-carboxylic acid
  11. (S)-2-Pyrrolidone-5-carboxylate
  12. (S)-2-Pyrrolidone-5-carboxylic acid
  13. (S)-5-Oxo-2-pyrrolidinecarboxylate
  14. (S)-5-Oxo-2-pyrrolidinecarboxylic acid
  15. (S)-Pyroglutamate
  16. (S)-Pyroglutamic acid
  17. 2-L-Pyrrolidone-5-carboxylate
  18. 2-L-Pyrrolidone-5-carboxylic acid
  19. 2-Oxopyrrolidine-5(S)-carboxylate
  20. 2-Oxopyrrolidine-5(S)-carboxylic acid
  21. 2-Pyrrolidinone-5-carboxylate
  22. 2-Pyrrolidinone-5-carboxylic acid
  23. 5-Carboxy-2-pyrrolidinone
  24. 5-Oxo-L-proline
  25. 5-L-oxoproline
  26. 5-Oxoproline
  27. 5-Pyrrolidinone-2-carboxylate
  28. 5-Pyrrolidinone-2-carboxylic acid
  29. Ajidew A 100
  30. Glutimate
  31. Glutimic acid
  32. Glutiminate
  33. Glutiminic acid
  34. L-2-Pyrrolidone-5-carboxylate
  35. L-2-Pyrrolidone-5-carboxylic acid
  36. L-5-Carboxy-2-pyrrolidinone
  37. L-5-Oxo-2-pyrrolidinecarboxylate
  38. L-5-Oxo-2-pyrrolidinecarboxylic acid
  39. L-5-Oxoproline
  40. L-Glutamic acid g-lactam
  41. L-Glutimate
  42. L-Glutimic acid
  43. L-Glutiminate
  44. L-Glutiminic acid
  45. L-Pyroglutamate
  46. L-Pyroglutamic acid
  47. L-Pyrrolidinonecarboxylate
  48. L-Pyrrolidinonecarboxylic acid
  49. L-Pyrrolidonecarboxylate
  50. L-Pyrrolidonecarboxylic acid
  51. Oxoproline
  52. Oxopyrrolidinecarboxylate
  53. Oxopyrrolidinecarboxylic acid
  54. Pidolate
  55. Pidolic acid
  56. Pidolidone
  57. Pyroglutamate
  58. Pyroglutamic acid
  59. Pyrrolidinonecarboxylate
  60. Pyrrolidinonecarboxylic acid
  61. Pyrrolidone-5-carboxylate
  62. Pyrrolidone-5-carboxylic acid
  63. Pyrrolidonecarboxylic acid
  64. (S)-(-)-gamma-Butyrolactam-gamma-carboxylate
  65. (S)-(-)-gamma-Butyrolactam-gamma-carboxylic acid
Chemical IUPAC Name (2S)-5-oxopyrrolidine-2-carboxylic acid
Chemical Formula C5H7NO3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids; Amino Ketones
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid; secondary carboxylic acid amide; lactam; heterocyclic compound
Biofunction
  • Essential amino acid; Component of Glutathione metabolism
Application
Source
  • Endogenous
Average Molecular Weight 129.114
Monoisotopic Molecular Weight 129.042587
Isomeric SMILES OC(=O)[C@@H]1CCC(=O)N1
Canonical SMILES OC(=O)C1CCC(=O)N1
KEGG Compound ID C01879 Link Image
BioCyc ID CPD-589 Link Image
BiGG ID 1800372 Link Image
Wikipedia Link Pyroglutamic acid Link Image
METLIN ID 3251 Link Image
PubChem Compound 7405 Link Image
PubChem Substance 76605 Link Image
ChEBI ID 18183 Link Image
CAS Registry Number 98-79-3
InChI Identifier InChI=1/C5H7NO3/c7-4-2-1-3(6-4)5(8)9/h3H,1-2H2,(H,6,7)(H,8,9)/t3-/m0/s1
Synthesis Reference Pumpor, Ksenia; Boettcher, Christoph; Fehn, Susanna; Burger, Klaus. Hexafluoroacetone as protecting and activating reagent: an efficient strategy for activation of pyroglutamic acid and homologs.Heterocycles (2003), 61 259-269.
Melting Point (Experimental) Not Available
Experimental Water Solubility 476.0 mg/mL at 13 oC [BEILSTEIN] Source: PhysProp
Predicted Water Solubility 151.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -1.01 [Predicted by ALOGPS]; -3 [Predicted by PubChem via XLOGP]; -0.72 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1A8J Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 355.94 +/- 44.73 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 384 +/- 59 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 486 +/- 94 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 525 +/- 120 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. 5-oxoprolinase
  2. Gamma-glutamylcyclotransferase
Enzyme 1 [top]
Enzyme 1 ID 857
Enzyme 1 Name 5-oxoprolinase
Enzyme 1 Synonyms
  1. 5-oxo-L-prolinase
  2. 5-OPase
  3. Pyroglutamase
Enzyme 1 Gene Name OPLAH
Enzyme 1 Protein Sequence >5-oxoprolinase
MGGPEGRFHFAIDRGGTFTDVFAQCPGGHVRVLKLLSEDPANYVDAPTEGIRRILEQEGG
VLLPRDRPLDTSRIASIRMGTTVATNALLEQQGERVALLVTRGFRDLLHVCTQARAXLFD
LAVPMPETLYEEVLEVDERVVLYRGXPGAGTPVKGCTGDLLEVQQPVDLGGLRWKLEGLL
SRGIRSLAVVLMHSYTWAQHEQQVGALARELGFTHVSLSSEAMPMVRIVPRGHTACADAY
LTPTIQRYVQGFRRGFQGQLKDVQVLFMRSDGGLAPMDSFSGSRAVLSGPAGGVVGYSAT
TYRVEGGQPVIGFDMGGTSTDVSRYAGEFEHVFEASTAGVTLQAPQLDINTVAAGGGSRL
FFRSGLFVVGPESAGAHPGPACYRKGGPVTVTDANLVLGRLLPASFPCIFGPGEDQPLSP
EASRKALEAVATEVNSFLTNGPCPASPLSLEEVAMGFVRVANEAMCRPIRALTQARGHDP
SAHVLACFGGAGGQHACAIARALGMDTVHIHRHSGLLSALGLALADVVHEAQEPCSLPYA
PETFAQLDQRLGRLEEQCVEALRAQGFPRSQISTESFLHLRYQGTDCALMVSAHQHPASA
RSPRAGDFGAAFVERYMREFGFIIPERPVVVDDVRVRGTGSSSLRLEDVPKAHSGPPRVD
KMTQCYFEGGYQETPVYLLGELGCGHKLQGPCLIIDSNSTILVEPGCQAEVTETGDIRIS
VGAETASVVGTQLDPIHLTIFSHRFMSIAEQMGRILQRTAISTNIKERLDFSCALFGPDG
GLVSNVPHIPVHLGAMQETVQFQIQQLGADLHPGDVLLSNHPSAGGSHLPDLTVITPVFW
PGQTRPVFYVASRGHHADIGGITPGSMPPHSTSLQQEGAVFLSFKLVHGGVFQEEAVTEA
LRAPGKIPGCSGTRNLHDNLSDLRAQVAANQKGIQLVGELIGQYGLDVVQAYMGHIQANA
ELAVRDMLRAFGTARQARGLPLEVSAEDHMDDGSPIRLRVQINMSQGSAVFDFSGSGPEV
FGNLNAPRAITLSALIYCLRCLVGRDIPLNQGCLAPVRVVIPKGSILDPSPDAAVVGGNV
LTSQRVVDVILGAFGACAASQGCMNNVTLGNAHMGYYETVAGGAGAGPGWHGRSGVHSHM
TNTRITDPEILESRYPVILRRFELRLGSGGRGRFRGGDGIIRELLFREEALLSVLTERRA
FQPYGLMGGEPGARGLNLLIRKDGRTVNLGGKTSVPVYPGDVFCLHTPGGGGYGDPGDPA
PLPGSPLQPLAFPERGSVYEYRRAQEAV
Enzyme 1 Number of Residues 1288
Enzyme 1 Molecular Weight 137340.3
Enzyme 1 Theoretical pI 6.55
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Catalyzes the cleavage of 5-oxo-L-proline to form L- glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 46020038 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q75WB5 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name OPLA_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >3867 bp
ATGGGTGGCCCGGAGGGCCGCTTCCATTTTGCCATCGACCGTGGAGGCACCTTCACAGAT
GTCTTTGCCCAGTGCCCAGGGGGGCACGTGAGGGTCCTAAAGCTGCTTTCAGAAGACCCT
GCCAACTATGTAGACGCCCCCACTGAAGGCATCCGCCGCATCCTGGAGCAGGAGGGGGGC
GTGCTGCTGCCGCGGGACCGGCCCCTGGACACCAGTCGCATCGCCAGCATCCGCATGGGC
ACCACGGTGGCGACCAATGCGCTGTTGGAACAACAGGGAGAGCGGGTGGCACTGCTGGTG
ACGCGCGGGTTCCGAGACCTGCTGCACGTGTGCACCCAGGCCCGCGCGGANCTCTTTGAC
CTGGCCGTGCCCATGCCCGAGACGCTGTACGAGGAGGTGCTGGAAGTGGACGAACGGGTG
GTGCTCTATCGAGGGGANCCGGGTGCTGGGACACCCGTGAAAGGCTGCACAGGGGACCTA
CTGGAAGTGCAGCAGCCTGTGGACCTGGGGGGCCTGCGATGGAAGCTGGAAGGTCTCCTG
TCCCGGGGCATCCGTAGCTTGGCCGTGGTGCTCATGCACTCGTACACGTGGGCCCAGCAC
GAGCAGCAGGTGGGCGCCCTGGCCCGGGAACTGGGCTTCACGCATGTGTCGCTGTCCTCG
GAGGCCATGCCCATGGTGCGCATTGTGCCCCGGGGGCACACGGCCTGTGCTGACGCCTAT
CTCACGCCCACCATCCAGCGCTACGTGCAGGGCTTCCGACGTGGCTTCCAGGGTCAGCTC
AAGGACGTGCAGGTGCTGTTCATGCGCTCCGACGGTGGGCTGGCGCCCATGGACTCCTTC
AGCGGCTCCCGCGCTGTGCTCTCCGGGCCTGCGGGGGGCGTGGTTGGTTACTCAGCCACC
ACCTACCGGGTGGAGGGCGGCCAGCCAGTCATCGGCTTTGACATGGGAGGCACGTCTACC
GACGTGAGCCGCTATGCTGGCGAGTTTGAGCATGTTTTCGAGGCCAGCACGGCTGGTGTC
ACCCTCCAGGCCCCCCAGCTGGATATCAACACTGTGGCAGCCGGTGGGGGCTCCCGCCTC
TTTTTCAGGTCGGGCCTCTTCGTGGTGGGGCCAGAGTCTGCGGGAGCCCACCCTGGCCCC
GCCTGCTACCGAAAAGGGGGCCCTGTGACAGTGACGGATGCTAATCTGGTCCTGGGTCGC
CTGCTGCCTGCCTCCTTCCCCTGCATTTTTGGGCCGGGAGAGGACCAGCCACTGTCCCCG
GAGGCGTCCCGAAAGGCCCTGGAGGCTGTGGCCACGGAGGTCAACAGCTTCCTGACCAAT
GGGCCTTGCCCGGCCTCCCCGCTGAGCCTGGAGGAGGTGGCCATGGGGTTTGTGCGTGTG
GCCAACGAGGCCATGTGTCGGCCCATCCGTGCACTCACGCAGGCACGAGGTCATGACCCC
TCGGCCCACGTGCTGGCCTGCTTTGGGGGAGCTGGTGGGCAGCATGCTTGTGCCATTGCC
CGGGCCCTGGGCATGGACACTGTGCACATTCACAGGCACAGTGGGCTGCTGTCGGCGCTG
GGGCTGGCCCTGGCTGATGTGGTGCATGAGGCGCAGGAGCCCTGCTCCCTGCCATATGCT
CCCGAGACCTTTGCGCAGCTGGACCAGAGGCTGGGCCGCCTGGAGGAGCAGTGTGTGGAG
GCCCTGCGGGCCCAGGGCTTCCCCAGGTCCCAGATCAGCACCGAGAGCTTCCTGCACCTG
CGCTACCAGGGCACGGACTGCGCCCTGATGGTGTCTGCCCACCAGCACCCGGCCAGTGCC
CGCTCACCCCGAGCTGGTGACTTTGGGGCAGCCTTTGTGGAGAGGTACATGAGGGAGTTC
GGCTTCATTATTCCCGAGCGGCCGGTGGTGGTGGATGACGTGCGGGTCAGGGGCACCGGC
AGCAGCAGCCTTCGCCTCGAGGACGTCCCAAAAGCCCATAGTGGGCCTCCCCGGGTAGAT
AAGATGACCCAGTGCTACTTTGAGGGGGGCTACCAGGAGACCCCTGTGTACCTGTTGGGA
GAGCTGGGCTGTGGGCACAAGCTTCAGGGGCCCTGCCTCATCATTGACAGCAACAGTACC
ATCCTGGTGGAGCCAGGCTGCCAGGCAGAGGTGACTGAGACTGGGGACATCCGCATCTCT
GTGGGGGCTGAGACAGCCAGCGTGGTGGGCACGCAGCTTGACCCCATCCACCTTACCATC
TTCTCCCACCGCTTCATGAGCATTGCTGAGCAGATGGGCCGCATCCTGCAGCGCACGGCC
ATCTCCACCAACATCAAGGAGCGTCTGGACTTCTCCTGCGCCCTCTTTGGGCCCGACGGG
GGGCTGGTCTCCAACGTCCCTCACATCCCTGTGCACCTGGGTGCCATGCAGGAGACGGTG
CAGTTCCAGATTCAGCAGTTGGGGGCTGATCTCCACCCCGGCGATGTGCTGCTGAGCAAC
CACCCCAGCGCGGGGGGCAGCCACTTGCCAGACCTGACTGTCATCACACCGGTGTTTTGG
CCGGGTCAGACACGGCCTGTGTTCTATGTGGCCAGCCGTGGGCACCATGCAGACATTGGG
GGCATCACACCAGGCTCCATGCCCCCCCACTCCACCAGCCTGCAGCAGGAGGGCGCGGTC
TTCCTTTCCTTCAAACTTGTGCATGGGGGAGTCTTCCAGGAAGAGGCGGTGACTGAAGCC
CTGCGGGCGCCAGGCAAGATCCCAGGCTGCAGCGGGACACGGAACCTGCACGACAACCTG
TCGGATCTGCGCGCCCAGGTGGCGGCCAACCAGAAGGGCATCCAGCTGGTGGGCGAGCTC
ATCGGGCAGTACGGCCTGGACGTGGTGCAGGCCTACATGGGCCACATTCAGGCAAACGCG
GAGCTCGCTGTGAGGGACATGCTCCGGGCCTTTGGAACTGCCCGGCAGGCCCGGGGCCTG
CCCCTGGAGGTGTCTGCAGAGGACCACATGGACGACGGTTCCCCTATCCGACTCCGAGTG
CAGATCAACATGAGTCAGGGTAGCGCGGTGTTTGATTTCAGCGGCTCAGGGCCAGAGGTG
TTCGGCAACCTCAACGCGCCGCGGGCCATCACGCTGTCTGCGCTCATCTACTGTCTTCGC
TGTCTGGTTGGCCGCGACATCCCACTCAACCAGGGCTGCCTGGCTCCGGTGCGCGTGGTG
ATTCCTAAAGGCTCCATCCTAGACCCTTCCCCCGACGCGGCCGTGGTGGGCGGCAACGTG
CTCACGTCGCAGCGCGTGGTGGACGTCATCCTGGGGGCCTTCGGGGCCTGCGCCGCTTCC
CAGGGCTGCATGAACAACGTGACCTTGGGCAACGCCCACATGGGCTACTACGAGACGGTG
GCGGGCGGTGCGGGCGCGGGACCGGGTTGGCACGGGCGCAGCGGCGTGCACAGCCACATG
ACCAACACGCGCATCACCGACCCCGAGATCCTGGAGAGCAGGTACCCGGTTATCCTGCGC
CGCTTCGAGCTAAGGCTGGGGTCCGGGGGTCGCGGCCGCTTCCGGGGCGGCGATGGCATT
ATCCGTGAGCTGCTTTTCCGCGAGGAGGCGCTGCTGTCCGTGCTGACTGAGCGCCGCGCC
TTCCAGCCGTATGGCCTGATGGGGGGTGAGCCTGGTGCCCGGGGCCTAAACCTACTCATC
CGGAAGGACGGCCGGACAGTAAACCTGGGTGGGAAGACCTCGGTGCCCGTGTACCCCGGG
GACGTGTTCTGTCTGCACACACCAGGCGGTGGGGGCTACGGGGACCCGGGAGACCCCGCC
CCACTGCCAGGTTCGCCCTTGCAGCCCCTAGCCTTCCCGGAGAGGGGCAGCGTGTATGAG
TACCGCAGGGCCCAGGAGGCTGTGTGA
Enzyme 1 GenBank Gene ID AB121737 Link Image
Enzyme 1 GeneCard ID OPLAH Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:8
Enzyme 1 Locus 8q24.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 1242
Enzyme 2 Name Gamma-glutamylcyclotransferase
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name GGCT
Enzyme 2 Protein Sequence >Gamma-glutamylcyclotransferase
MANFGCEDLRSQDGESFLYFAYGSNLLTERIHLRNPSAVFYSVARLQDFKLDFGNPQGKT
SETWHGGIATIFESPGDEVWGVVWKMNKSNLSSLDKQEGVKSGMYVPIEVTVSTQEGKEI
TCRSYQMTNYESVPPSPQYKKVICMGAKENGLPLEYQKKLNSIEPNDYKGKVSEEIEDII
KKGEAKTH
Enzyme 2 Number of Residues 188
Enzyme 2 Molecular Weight 21176.7
Enzyme 2 Theoretical pI 5.37
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in acyltransferase activity
Enzyme 2 Specific Function Catalyzes the formation of 5-oxoproline from gamma- glutamyl dipeptides and may play a significant role in glutathione homeostasis. Induces release of cytochrome c from mitochondria with resultant induction of apoptosis
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 81674275 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q32LE4 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name GGCT_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >567 bp
ATGGCGAACTTCGGCTGCGAGGACCTCCGGAGTCAGGATGGGGAGAGTTTTCTCTACTTT
GCCTATGGCAGCAACCTGCTGACGGAGCGGATCCACCTCCGAAACCCCTCCGCCGTGTTC
TACAGCGTAGCCCGCTTGCAGGATTTTAAACTTGACTTTGGCAATCCCCAAGGCAAAACA
AGTGAAACTTGGCATGGAGGTATAGCCACCATTTTTGAAAGTCCTGGCGATGAAGTATGG
GGAGTAGTATGGAAAATGAACAAAAGCAATTTAAGTTCTCTGGATAAGCAAGAAGGGGTT
AAAAGTGGAATGTATGTCCCAATAGAAGTTACTGTTTCAACTCAAGAAGGAAAAGAAATA
ACCTGTCGAAGTTATCAGATGACAAATTATGAGAGTGTTCCCCCATCACCCCAGTATAAA
AAGGTCATTTGCATGGGCGCAAAAGAGAATGGTTTGCCCCTGGAGTACCAAAAGAAGTTA
AATTCAATAGAACCAAATGACTACAAAGGAAAGGTCTCAGAAGAAATCGAAGACATTATC
AAAAAGGGGGAAGCAAAGACTCATTAG
Enzyme 2 GenBank Gene ID BC109622 Link Image
Enzyme 2 GeneCard ID GGCT Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:7
Enzyme 2 Locus 7p15-p14
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available