We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Beta-D-Glucose (RMDB00516)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:58:02
Accession Number RMDB00516
Common Name Beta-D-Glucose
Description A glucoside is a glycoside that is derived from glucose. Glucosides are common in plants, but rare in animals. Glucose is produced when a glucoside is hydrolysed by purely chemical means, or decomposed by fermentation or enzymes. This group contains a benzene and also an ethylene group, being derived from styrolene. Coniferin, C16H22O8, occurs in the cambium of conifer wood. Emulsin converts it into glucose and coniferyl alcohol, while oxidation gives glycovanillin, which yields with emulsin glucose and vanillin. Syringin, which occurs in the bark of Syringe vulgaris, is a methoxyconiferin. Phloridzus occurs in the root-bark of various fruit trees; it hydrolyses to glucose and phloretin, which is the phloroglucin ester of paraoxyhydratropic acid. It is related to the pentosides naringin, C21HEOi1, which hydrolyses to rhamnose and naringenin, the phioroglucin ester of para-oxycinnamic acid, and hesperidin, which hydrolyses to rhamnose and hesperetin, the phloroglucin ester of meta-oxy-para-methoxycinnamic acid or isoferulic acid, C10H10O4. A primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. It is used therapeutically in fluid and nutrient replacement. Classification of the glucosides is a matter of some difficulty. One based on the chemical constitution of the non-glucose part of the molecules has been proposed that frames four groups: (I) ethylene derivatives, (2) benzene derivatives, (3) styrolene derivatives, (4) anthracene derivatives. A group may also be made to include the cyanogenetic glucosides, i.e. those containing prussic acid. Other classifications follow a botanical classification, which has several advantages; in particular, plants of allied genera contain similar compounds. In this article the chemical classification will be followed, and only the more important compounds will be discussed here.
Synonyms
  1. b-D-Glucopyranose
  2. b-Dextrose
  3. b-Glucose
  4. beta-Dextrose
  5. beta-Glucose
  6. beta-delta-Glucopyranose
  7. beta-D-Glucopyranose
  8. beta-D-Glucose
Chemical IUPAC Name (2R,3R,4S,5R,6R)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol
Chemical Formula C6H12O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; primary alcohol; secondary alcohol; 1,2-diol; heterocyclic compound
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 180.156
Monoisotopic Molecular Weight 180.063385
Isomeric SMILES OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O
Canonical SMILES OCC1OC(O)C(O)C(O)C1O
KEGG Compound ID C00221 Link Image
BioCyc ID Not Available
BiGG ID Not Available
Wikipedia Link Not Available
METLIN ID 3755 Link Image
PubChem Compound 64689 Link Image
PubChem Substance 834527 Link Image
ChEBI ID Not Available
CAS Registry Number 492-61-5
InChI Identifier InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6-/m1/s1
Synthesis Reference Wenck, Helmut; Kinedt, Claudia; Bader, Hans Joachim. Production of b-D-glucose. Praxis der Naturwissenschaften, Chemie (1986), 35(4), 23.
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 782.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -3.24 [SANGSTER (1994)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.57 [Predicted by ALOGPS]; -2.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
Biofluid Location
  • Rumen
Tissue Location Not Available
Concentrations (Normal)
Biofluid Rumen
Value 763.813 +/- 751.731 uM
Age N/A
Sex N/A
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References Not Available
Metabolic Enzymes
  1. Aldose 1-epimerase
Enzyme 1 [top]
Enzyme 1 ID 120
Enzyme 1 Name Aldose 1-epimerase
Enzyme 1 Synonyms
  1. Galactose mutarotase
Enzyme 1 Gene Name GALM
Enzyme 1 Protein Sequence >Aldose 1-epimerase
MVSVTRAVFGDLPLGAGTVEKFQLQSDQLRVDIISWGCTITALEVKDRQGRASDVVLGFD
ELEGYLQKQPYFGAVVGRVANRIAKGTFTLDGKEYKLAINNGPNSLHGGVKGFDKVLWTP
RVLSNGVEFSRVSPDGEEGYPGELKVWVMYTLDGGELVVNYRAQASQTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDEVLIPTGEIASVQGTAFDLRKPVELGKHLQEFHVN
GFDHNFCLKGSKEKRFCARVHHAGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKSGAGYPK
HSGFCLETQSWPDAVNQPHFPPVLLKPGEEYDHTTWFKFSVA
Enzyme 1 Number of Residues 342
Enzyme 1 Molecular Weight 37614.2
Enzyme 1 Theoretical pI 6.29
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Carbohydrate transport and metabolism
Enzyme 1 Specific Function Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose
Enzyme 1 Pathways
  • Carbohydrate metabolism
  • hexose metabolism
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 59857745 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q5EA79 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name GALM_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1029 bp
ATGGTTTCGGTGACCAGAGCCGTGTTTGGAGACCTGCCCCTGGGAGCAGGGACAGTGGAG
AAGTTCCAGCTGCAGTCAGACCAGCTGAGAGTGGACATCATCTCCTGGGGCTGCACCATC
ACAGCCCTGGAGGTCAAAGACAGGCAGGGCAGAGCCTCAGATGTGGTGCTCGGCTTTGAC
GAGTTGGAAGGGTACCTCCAAAAGCAGCCCTACTTTGGAGCTGTGGTTGGCAGGGTGGCC
AACCGAATTGCCAAAGGAACGTTCACGTTGGATGGGAAGGAGTATAAACTAGCCATTAAC
AACGGGCCCAACAGCCTGCATGGAGGAGTCAAAGGGTTTGACAAGGTCCTCTGGACCCCT
CGGGTGCTGTCAAATGGTGTCGAGTTCTCACGGGTCAGTCCAGACGGTGAGGAAGGCTAC
CCTGGAGAGTTAAAAGTCTGGGTGATGTACACACTGGATGGCGGTGAGCTTGTGGTCAAC
TATCGAGCACAGGCCAGTCAGACCACCCCAGTCAATCTGACCAATCATTCTTACTTCAAC
CTGGCAGGCCAGGGTTCCCCAAATATATATGACCATGAAGTCACTATAGAAGCTGATGCT
TTTTTGCCTGTGGATGAAGTCCTGATTCCTACAGGAGAAATTGCTTCAGTGCAAGGAACG
GCATTTGACCTGAGGAAGCCAGTGGAGCTTGGAAAACACCTGCAGGAGTTCCACGTGAAT
GGCTTTGACCACAATTTCTGTCTGAAGGGATCTAAAGAAAAGCGTTTCTGTGCACGGGTC
CATCATGCTGGAAGCGGGCGGGTACTGGAAGTGTACACCACCCAACCTGGGGTCCAGTTT
TACACGGGCAACTTCCTGGATGGCACGCTGAAGGGCAAGAGTGGAGCAGGCTACCCCAAG
CACTCCGGATTCTGCCTTGAGACTCAGAGCTGGCCTGATGCAGTCAATCAGCCTCACTTT
CCGCCTGTGTTGCTGAAGCCTGGTGAGGAGTATGACCACACCACTTGGTTCAAGTTTTCT
GTGGCCTAA
Enzyme 1 GenBank Gene ID BT020690 Link Image
Enzyme 1 GeneCard ID GALM Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:2
Enzyme 1 Locus 2p22.1
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available