We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Magnesium (RMDB00547)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-15 22:24:16
Update Date 2009-07-08 12:59:13
Accession Number RMDB00547
Common Name Magnesium
Description Magnesium salts are essential in nutrition, being required for the activity of many enzymes, especially those concerned with oxidative phosphorylation. Physiologically, it exists as an ion in the body. It is a component of both intra- and extracellular fluids and is excreted in the urine and feces. Deficiency causes irritability of the nervous system with tetany, vasodilatation, convulsions, tremors, depression, and psychotic behavior. Magnesium ion in large amounts is an ionic laxative, and magnesium sulfate (Epsom salts) is sometimes used for this purpose. So-called "milk of magnesia" is a water suspension of one of the few insoluble magnesium compounds, magnesium hydroxide; the undissolved particles give rise to its appearance and name. Milk of magnesia is a mild base, and is commonly used as an antacid.
Synonyms
  1. Magnesium
  2. Magnesium ions
Chemical IUPAC Name magnesium
Chemical Formula [Mg]2+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals; Protein component; Enzyme co-factor
Application
Source
  • Exogenous
Average Molecular Weight 24.305
Monoisotopic Molecular Weight 23.985041
Isomeric SMILES [Mg++]
Canonical SMILES [Mg++]
KEGG Compound ID C00305 Link Image
BioCyc ID 13-HYDROXY-MAGNESIUM-PROTOPORP Link Image
BiGG ID Not Available
Wikipedia Link Magnesium Link Image
METLIN ID Not Available
PubChem Compound 888 Link Image
PubChem Substance 3599 Link Image
ChEBI ID 25107 Link Image
CAS Registry Number 7439-95-4
InChI Identifier InChI=1/Mg/q+2
Synthesis Reference Not Available
Melting Point (Experimental) 651 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 325 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.57 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 101.62 +/- 6.51 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Serine racemase
  2. Inositol-tetrakisphosphate 1-kinase
  3. Nicotinamide mononucleotide adenylyltransferase 1
  4. Heparanase
  5. Poly(ADP-ribose) glycohydrolase ARH3
  6. [Protein ADP-ribosylarginine] hydrolase
  7. Sodium/potassium-transporting ATPase subunit alpha-1
  8. Activin receptor type-2A
  9. Cytosolic purine 5'-nucleotidase
  10. Fructose-1,6-bisphosphatase isozyme 2
  11. Activin receptor type-2B
  12. Calcium-transporting ATPase type 2C member 1
  13. Probable phospholipid-transporting ATPase IIB
  14. Sodium/potassium-transporting ATPase subunit alpha-2
  15. Ectonucleoside triphosphate diphosphohydrolase 1
  16. S-adenosylmethionine synthetase
  17. ATP-citrate synthase
  18. Fructose-1,6-bisphosphatase 1
  19. Activated CDC42 kinase 1
  20. Eyes absent homolog 2
  21. 3'(2'),5'-bisphosphate nucleotidase 1
  22. Probable phospholipid-transporting ATPase IA
  23. Alkaline phosphatase
  24. Activin receptor type-1
  25. Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  26. Enolase-phosphatase E1
  27. Pyridoxal phosphate phosphatase
  28. Pyridoxal phosphate phosphatase PHOSPHO2
  29. Squalene synthetase
  30. Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
  31. Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
  32. Cholinephosphotransferase 1
  33. Ethanolaminephosphotransferase 1
  34. S-adenosylmethionine synthetase isoform type-1
  35. Catechol O-methyltransferase
  36. Fumarylacetoacetase
  37. cGMP-specific 3',5'-cyclic phosphodiesterase
  38. Hypoxanthine-guanine phosphoribosyltransferase
  39. Galactose-3-O-sulfotransferase 3
  40. Adenylate cyclase type 1
  41. Poly(A)-specific ribonuclease PARN
  42. U8 snoRNA-decapping enzyme
  43. Diphosphoinositol polyphosphate phosphohydrolase 3-beta
  44. Phosphoglucomutase-1
  45. DNA-(apurinic or apyrimidinic site) lyase
  46. Isocitrate dehydrogenase [NADP], mitochondrial
  47. Pyruvate kinase
  48. Endonuclease G, mitochondrial
  49. Isopentenyl-diphosphate Delta-isomerase 1
  50. Flap endonuclease 1
  51. Mitochondrial enolase superfamily member 1
  52. Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
  53. Beta-enolase
  54. Inositol monophosphatase
  55. Pyruvate kinase
  56. Interleukin-1 receptor-associated kinase 1
  57. Myosin light chain kinase, smooth muscle
  58. Polyribonucleotide 5'-hydroxyl-kinase Clp1
  59. Inositol polyphosphate 1-phosphatase
  60. Testis-specific serine/threonine-protein kinase 1
  61. Alkaline phosphatase, tissue-nonspecific isozyme
  62. Alpha-enolase
  63. Pyruvate kinase
  64. Adenylate cyclase type 7
  65. Intestinal alkaline phosphatase
  66. Protein phosphatase 1B
  67. Ribonuclease ZC3H12A
  68. Integrin-linked kinase-associated serine/threonine phosphatase 2C
  69. Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
  70. DNA polymerase beta
  71. Serine/threonine-protein kinase 4
  72. Mitogen-activated protein kinase kinase kinase 7
  73. Mitogen-activated protein kinase kinase kinase 13
  74. Alkaline phosphatase
  75. Bis(5'-adenosyl)-triphosphatase
  76. Ribose-phosphate pyrophosphokinase
  77. 6-phosphofructokinase, liver type
  78. 5'-nucleotidase domain-containing protein 1
  79. Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  80. Ribose-phosphate pyrophosphokinase 1
  81. Interleukin-1 receptor-associated kinase 4
  82. Endoribonuclease Dicer
  83. Phosphoserine phosphatase
  84. Nucleoside diphosphate kinase 7
  85. Inositol monophosphatase 3
  86. Acetolactate synthase-like protein
  87. Nucleoside diphosphate-linked moiety X motif 17
  88. Inorganic pyrophosphatase
  89. Enolase
  90. TFIIH basal transcription factor complex helicase subunit
  91. Alkaline phosphatase
  92. Protein phosphatase 1K, mitochondrial
  93. Adenylosuccinate synthetase isozyme 1
  94. Glycerophosphodiester phosphodiesterase 1
  95. Pyruvate kinase
  96. [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
  97. Cytosol aminopeptidase
  98. Diphosphoinositol polyphosphate phosphohydrolase 1
  99. Thioredoxin reductase 2, mitochondrial
  100. TGF-beta receptor type-1
  101. Nucleoside diphosphate kinase A 1
  102. Protein phosphatase 1G
  103. Tubulin--tyrosine ligase
  104. Fumarylacetoacetate hydrolase domain-containing protein 2
  105. Nucleoside diphosphate kinase B
  106. Inosine triphosphate pyrophosphatase
  107. Acyl-coenzyme A synthetase ACSM1, mitochondrial
  108. Serine/threonine-protein kinase 25
  109. Protein phosphatase 1L
  110. Peroxisomal NADH pyrophosphatase NUDT12
  111. Serine/threonine-protein kinase 12
  112. DNA-directed RNA polymerase III subunit RPC1
  113. Serine/threonine-protein kinase 38
  114. Isocitrate dehydrogenase [NADP] cytoplasmic
  115. Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial
  116. Nucleoside diphosphate kinase A 2
  117. Fumarylacetoacetate hydrolase domain-containing protein 1
  118. Three prime repair exonuclease 1
  119. Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
  120. ADP-dependent glucokinase
  121. 6-phosphofructokinase, muscle type
  122. Protein phosphatase 1A
  123. Adenylosuccinate synthetase isozyme 2
  124. Uridine diphosphate glucose pyrophosphatase
Enzyme 1 [top]
Enzyme 1 ID 82
Enzyme 1 Name Serine racemase
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name SRR
Enzyme 1 Protein Sequence >Serine racemase
MCDQYCISFADVEKAHINIRDFIHLTPVLTSSILNQITGRNLFFKCELFQKTGSFKIRGA
LNAIRGLISAHPEEKPRAVVAHSSGNHGQALSFAARLEGIPAYVIVPETAPNCKKLAIQA
YGASIVYSEQSEESRENITKRIAEETEGIMVHPNQEPAVIAGQGTIAMEVLNQVPLVDAL
VVPVGGGGMLAGIAVTVKALRPSVKVYAAEPLNADDCYQSKLKGELTPNPYPPETIADGI
KSSIGLNTWPIIRDLVDDVFTVTEDEIKYATQLVWERMKLLIEPTAGVGVAVVLSQHFRT
VPAEVKNICIVLSGGNVDLTSLTWVKKQDEKAAP
Enzyme 1 Number of Residues 334
Enzyme 1 Molecular Weight 36180.4
Enzyme 1 Theoretical pI 5.92
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Catalyzes the synthesis of D-serine from L-serine
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 117306359 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A0JNI4 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SRR_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1005 bp
ATGTGTGATCAGTACTGCATCTCCTTTGCTGATGTTGAAAAAGCTCATATCAACATTCGA
GATTTTATTCACCTCACACCAGTACTAACAAGTTCCATTTTGAATCAAATAACAGGACGT
AATCTTTTCTTCAAATGTGAACTCTTCCAGAAAACTGGATCTTTTAAGATTCGTGGTGCC
CTTAATGCAATCAGAGGCCTGATTTCTGCCCATCCAGAAGAGAAGCCCAGAGCTGTTGTT
GCTCACAGCAGCGGAAACCATGGCCAGGCTCTCTCCTTTGCTGCCAGATTGGAAGGGATT
CCTGCTTATGTCATAGTGCCGGAAACAGCTCCCAACTGTAAAAAACTGGCAATACAAGCC
TATGGAGCCTCTATAGTATACAGTGAACAGAGCGAAGAGTCCAGAGAAAATATTACAAAG
AGAATTGCGGAAGAAACAGAAGGCATTATGGTACATCCCAACCAGGAGCCTGCAGTGATA
GCTGGGCAAGGGACAATTGCCATGGAAGTGCTAAACCAGGTTCCCTTGGTAGACGCACTG
GTGGTACCTGTAGGAGGAGGAGGAATGCTTGCTGGAATAGCCGTTACAGTGAAGGCTCTG
AGACCCAGTGTGAAGGTATATGCTGCTGAACCCTTGAATGCAGATGACTGCTACCAGTCC
AAACTGAAAGGGGAACTGACCCCCAACCCCTATCCTCCGGAAACCATAGCAGATGGTATC
AAATCCAGCATTGGCTTAAACACCTGGCCTATTATAAGAGACCTCGTGGATGATGTCTTC
ACTGTCACAGAGGATGAAATTAAGTATGCAACCCAGCTGGTGTGGGAGAGGATGAAATTG
CTTATTGAACCTACAGCTGGTGTTGGAGTGGCCGTTGTGCTGTCTCAGCATTTTCGAACA
GTTCCTGCAGAAGTAAAGAACATCTGTATTGTGCTCAGTGGTGGAAATGTAGACTTAACC
TCCCTAACTTGGGTGAAGAAGCAGGATGAAAAGGCAGCTCCTTAG
Enzyme 1 GenBank Gene ID BC126700 Link Image
Enzyme 1 GeneCard ID SRR Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17p13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 89
Enzyme 2 Name Inositol-tetrakisphosphate 1-kinase
Enzyme 2 Synonyms
  1. Inositol-triphosphate 5/6-kinase
  2. Inositol 1,3,4-trisphosphate 5/6-kinase
  3. Ins(1,3,4)P(3) 5/6-kinase
Enzyme 2 Gene Name ITPK1
Enzyme 2 Protein Sequence >Inositol-tetrakisphosphate 1-kinase
MQTFLKGKRVGYWLSEKKIKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQALELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
KDDRICSPPFMELTSLCGDDTMRLLEENGLAFPFICKTRVAHGTNSHEMAIVFNQEGLSA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTALDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDINAFP
GYEGVSEFFTDLLNHIASVLQGQSSGVAGAGDVAPLKHSRLLAEQAGGLAAERTCSASPG
CCSSMMGQEPPWTPEADMGGVGAGSTAKLPHQRLGCTAGVSPSFQQHCVASLATKASSQ
Enzyme 2 Number of Residues 419
Enzyme 2 Molecular Weight 45841.8
Enzyme 2 Theoretical pI 6.09
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in ATP binding
Enzyme 2 Specific Function Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also acts as an inositol polyphosphate phosphatase that dephosphorylate Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 to Ins(1,3,4)P3, and Ins(1,3,4,5,6)P5 to Ins(3,4,5,6)P4. May also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. Probably acts as the rate-limiting enzyme of the InsP6 pathway. Modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein Not Available
Enzyme 2 UniProtKB/Swiss-Prot ID P0C0T1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name ITPK1_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence Not Available
Enzyme 2 GenBank Gene ID DT820636 Link Image
Enzyme 2 GeneCard ID ITPK1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 14q31
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 105
Enzyme 3 Name Nicotinamide mononucleotide adenylyltransferase 1
Enzyme 3 Synonyms
  1. NMN adenylyltransferase 1
  2. Nicotinate-nucleotide adenylyltransferase 1
  3. NaMN adenylyltransferase 1
Enzyme 3 Gene Name NMNAT1
Enzyme 3 Protein Sequence >Nicotinamide mononucleotide adenylyltransferase 1
MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGKYKVIKGIISPVGDAYKKKGL
ISAYHRVIMAELATKNSKWVEVDTWESLQKEWTETAKVLRHHQEKLEASICDPQQNSPVL
EKPGRKRKWAEQKQDISEKKSLEQTKTKGVPKVKLLCGADFLESFGVPNLWKSEDITKIL
GDYGLICITRAGNDAQKFIYESDVLWKHQNNIHLVNEWITNDISSTKIRRALRRGQSIRY
LVPDLVEEYIEKHNLYSSESEERNVGVVLAPLQRNTTEVKA
Enzyme 3 Number of Residues 281
Enzyme 3 Molecular Weight 32199.7
Enzyme 3 Theoretical pI 9.03
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Coenzyme transport and metabolism
Enzyme 3 Specific Function Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. Can use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD(+). For the pyrophosphorolytic activity, prefers NAD(+) and NAAD as substrates and degrades NADH, nicotinic acid adenine dinucleotide phosphate (NHD) and nicotinamide guanine dinucleotide (NGD) less effectively. Fails to cleave phosphorylated dinucleotides NADP(+), NADPH and NAADP(+). Protects against axonal degeneration following mechanical or toxic insults
Enzyme 3 Pathways
  • Cofactor biosynthesis
  • NAD(+) biosynthesis
  • NAD(+) from nicotinamide D-ribonucleotide:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 111304486 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q0VD50 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name NMNA1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >846 bp
ATGGAGAACTCAGAGAAGACAGAAGTAGTTCTCCTTGCTTGTGGGTCCTTTAATCCTATC
ACCAACATGCACCTCCGGCTGTTTGAGCTGGCCAAGGACTACATGAATGGAACAGGAAAA
TATAAAGTTATCAAAGGCATAATTTCTCCAGTTGGTGATGCATATAAGAAGAAAGGACTC
ATCTCTGCCTATCACCGAGTTATCATGGCAGAACTTGCCACCAAGAACTCAAAATGGGTA
GAAGTTGACACATGGGAAAGTCTTCAGAAAGAGTGGACAGAGACAGCCAAGGTGCTAAGA
CACCATCAAGAGAAGCTGGAGGCCAGTATCTGTGATCCCCAGCAGAACTCACCTGTGTTG
GAAAAGCCTGGACGGAAGAGAAAGTGGGCTGAACAAAAACAAGATATTAGTGAAAAGAAA
TCCCTAGAGCAAACAAAAACGAAAGGTGTGCCAAAGGTGAAGCTGCTGTGTGGAGCAGAT
TTTTTGGAGTCCTTTGGTGTGCCCAATCTATGGAAGAGTGAGGATATCACCAAAATCCTG
GGGGACTATGGACTCATATGTATTACTCGGGCTGGAAATGACGCCCAGAAGTTCATCTAC
GAATCCGACGTGCTGTGGAAACACCAGAACAACATTCACCTGGTGAACGAATGGATCACC
AATGACATCTCCTCCACGAAGATCCGGCGAGCCCTCAGACGGGGCCAGAGCATTCGCTAC
TTGGTACCCGATCTTGTCGAAGAATATATTGAAAAGCATAATCTGTATAGCTCTGAGAGT
GAGGAGAGGAATGTTGGAGTGGTCCTGGCTCCTTTGCAGAGAAACACTACAGAAGTTAAG
GCATAA
Enzyme 3 GenBank Gene ID BC119834 Link Image
Enzyme 3 GeneCard ID NMNAT1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1p32-p35
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 115
Enzyme 4 Name Heparanase
Enzyme 4 Synonyms
  1. Heparanase 8 kDa subunit
  2. Heparanase 50 kDa subunit
Enzyme 4 Gene Name HPSE
Enzyme 4 Protein Sequence >Heparanase
MLACRKPGLRPPLLLLLPLLGPLGPCSPGTPAAAAPADDAAELEFFTERPLHLVSPAFLS
FTIDANLATDPRFFTFLGSSKLRTLARGLAPAYLRFGGNKGDFLIFDPKKEPAFEERSYW
LSQSNQDICKSGSIPSDVEEKLRLEWPFQEQVLLREQYQKKFTNSTYSRSSVDMLYTFAS
CSGLNLIFGVNALLRTTDMHWDSSNAQLLLDYCSSKNYNISWELGNEPNSFQRKAGIFIN
GRQLGEDFIEFRKLLGKSAFKNAKLYGPDIGQPRRNTVKMLKSFLKAGGEVIDSVTWHHY
YVNGRIATKEDFLNPDILDTFISSVQKTLRIVEKIRPLKKVWLGETSSAFGGGAPFLSNT
FAAGFMWLDKLGLSARMGIEVVMRQVLFGAGNYHLVDGNFEPLPDYWLSLLFKKLVGNKV
LMASVKGPDRSKFRVYLHCTNTKHPRYKEGDLTLYALNLHNVTKHLELPHHLFNKQVDKY
LIKPSGTDGLLSKSVQLNGQILKMVDEQTLPALTEKPLHPGSSLGMPPFSYGFFVIRNAK
VAACI
Enzyme 4 Number of Residues 545
Enzyme 4 Molecular Weight 61076.0
Enzyme 4 Theoretical pI 9.61
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in calcium ion binding
Enzyme 4 Specific Function Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme. Cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Also implicated in the extravasation of leukocytes and tumor cell lines. Contributes to metastasis and angiogenesis
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-37
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 13606095 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q9MYY0 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name HPSE_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID AF281160 Link Image
Enzyme 4 GeneCard ID HPSE Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:4
Enzyme 4 Locus 4q21.3
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 132
Enzyme 5 Name Poly(ADP-ribose) glycohydrolase ARH3
Enzyme 5 Synonyms
  1. ADP-ribosylhydrolase 3
  2. [Protein ADP-ribosylarginine] hydrolase-like protein 2
Enzyme 5 Gene Name ADPRHL2
Enzyme 5 Protein Sequence >Poly(ADP-ribose) glycohydrolase ARH3
MAAAAAMTAAGCGGAGAARSLSRFRGCLAGALLGDCVGAVYEARDTVDLTSVLRQVQDLE
PDPGSPGSARTEALCYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAG
VITVFRKHLSPRCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQ
LTHASSLGYNGAILQALAVHLALQGESSSEHFLEQLLGHMEELESDAQSVLDARELGMEE
RPYSSRLKKIGELLEQDSVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEIPSTFN
SLQRTLVYSISLGGDTDTIATMAGAIAGAYYGMEQVPESWQQSCEGYEETDVLAQSLHRV
FQKSL
Enzyme 5 Number of Residues 365
Enzyme 5 Molecular Weight 39220.6
Enzyme 5 Theoretical pI 4.56
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 5 Specific Function Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells. Generates ADP-ribose from poly-(ADP-ribose), but does not hydrolyze ADP- ribose-arginine, -cysteine, -diphthamide, or -asparagine bonds
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 74268242 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q3SYV9 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name ARHL2_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1098 bp
ATGGCGGCGGCGGCAGCGATGACGGCGGCGGGCTGCGGAGGGGCTGGGGCGGCACGCTCC
CTCTCCCGCTTCCGAGGCTGCCTGGCAGGCGCGCTGCTCGGGGACTGCGTGGGCGCCGTC
TACGAGGCGCGCGACACCGTCGACCTGACGTCAGTCCTGCGTCAGGTCCAGGATTTGGAG
CCGGACCCCGGCTCTCCCGGGAGCGCGCGGACAGAAGCACTGTGCTACACGGACGACACA
GCCATGGCCAGGGCGCTGGTGCAGTCCCTGCTGGCCAAGGAGGCCTTCGACGAGGTGGAC
ATGGCTCACAGGTTTGCTCAGGAGTACAAGAAGGACCCTGACCGGGGTTACGGTGCTGGA
GTGATCACCGTCTTCAGGAAACACCTAAGCCCCAGATGCCGGGATGTCTTTGAGCCTGCA
CGCGCCCAGTTCAATGGCAAAGGCTCCTACGGCAACGGGGGTGCCATGCGGGTGGCCGGC
ATCTCCCTGGCCTATAGCAGCGTGCAGGATGTGCAGAAGTTCGCCCGGCTCTCGGCCCAG
CTGACACACGCCTCCTCCCTGGGTTACAATGGTGCCATCCTGCAGGCCCTGGCTGTGCAC
CTGGCCTTGCAGGGCGAGTCGTCCAGTGAGCACTTCCTCGAGCAGCTCCTTGGCCACATG
GAAGAGCTGGAGAGTGATGCCCAGTCCGTGCTGGATGCCAGGGAGTTGGGCATGGAGGAG
CGTCCGTACTCCAGCCGACTGAAGAAGATCGGGGAGCTTCTAGAGCAGGACTCAGTGACC
AGAGAGGAGGTGGTGTCCGAGCTAGGAAATGGCATTGCTGCCTTTGAATCTGTGCCCACC
GCCATCTATTGCTTCCTGCGCTGCATGGAGCCCGACCCCGAGATCCCCTCTACCTTCAAC
AGCCTCCAAAGGACTCTCGTCTATTCCATCTCGCTCGGTGGGGACACGGACACCATTGCC
ACCATGGCCGGGGCCATTGCTGGCGCCTACTATGGGATGGAACAGGTGCCAGAGAGCTGG
CAGCAAAGCTGTGAAGGCTATGAGGAGACTGACGTCCTGGCCCAGAGCCTGCACCGGGTC
TTCCAGAAGAGTCTTTGA
Enzyme 5 GenBank Gene ID BC103360 Link Image
Enzyme 5 GeneCard ID ADPRHL2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 1p34.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 134
Enzyme 6 Name [Protein ADP-ribosylarginine] hydrolase
Enzyme 6 Synonyms
  1. ADP-ribosylarginine hydrolase
  2. ADP-ribose-L-arginine cleaving enzyme
Enzyme 6 Gene Name ADPRH
Enzyme 6 Protein Sequence >[Protein ADP-ribosylarginine] hydrolase
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGFFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR
Enzyme 6 Number of Residues 353
Enzyme 6 Molecular Weight 39152.0
Enzyme 6 Theoretical pI 6.45
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 6 Specific Function Catalyzes the reverse reaction of mono-ADP-ribosylation
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 81673929 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q32KR8 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name ADPRH_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1062 bp
ATGTGTGGGGCCCTGATGGAGAGGTATGTGGCAGCCATGGTGCTGAGTGCAGCTGGAGAT
GCCTTGGGATACTTCAATGGAAAGTGGGAGTTCCTCCAGAATGGGGAGAAAATTCACAGG
CAGCTGGCCCAGCTTGGTGGCTTGGATGCCATAGATGTGGAGAGGTGGAGAGTCAGCGAT
GACACCGTGATGCACCTGGCCACAGCAGAAGCACTCCTGGAAGCTGGCAAAGTCTCAGAC
TTGACTCACTTGTATTCCCTCCTTGCTAAGCATTACCAGGACTGCATGGGAGACATGGAT
GGCCGGGCACCAGGGGGTGCCTCAGTGCAGAACGCCATGCTGCTGGAGCCAGACAAAGCC
GATGGCTGGAGGATTCCCTTTAACAGTCATGAGGGTGGCTGCGGGGCCGCCATGAGGGCC
ATGTGCATTGGTCTCCGGTTCCCTCACAGCAGTCAGCTGGACTCACTGATCCAGGTGAGC
ATCGAGAGCGGCCGGATGACCCATCACCATCCCACAGGCTACCTGGGAGCCCTTGTGTCT
GCTCTTTTTACAGCCTATGCTGTGAACGGCAAGCCTCCCCAGCAGTGGGGAAGAGGACTG
ATGGAGGTACTTCCGGAAGCTAAAAAGTACATTGTCCAATCAGGCTTCTTTGTGGAGCAG
AATCTTCAACACTGGTCTTACTTCCAAGACCAGTGGGAAAAGTACCTAAAACTCAGAGGA
ATTTGGGATGGCAAATCAGCCCCTACCTTCCCCAAGCCCTTTGATGTGAAGGAAAGGGAT
CAGTTCTACAGTTCTGTGAGCTACTCTGGCTGGGGCGGCAGCAGTGGACACGATGCCCCC
ATGATTGCCTATGATGCCATCCTGGCTGCAGGAGACTCCTGGAAGGAGCTTGCCCACCGA
GCATTTTTCCACGGTGGAGACAGTGATTCTACCGCTGCAATTGCTGGCTGTTGGTGGGGA
GTGATGTATGGTTTTAAAGGAGTAAGTCCCTCCAACTATGAGAAGCTAGAATACAGAAAC
CGGCTGGAAGAGACAGCTAGGGCTTTGTATTCTCTTAGGTAA
Enzyme 6 GenBank Gene ID BC109957 Link Image
Enzyme 6 GeneCard ID ADPRH Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:3
Enzyme 6 Locus 3q13.31-q13.33
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 145
Enzyme 7 Name Sodium/potassium-transporting ATPase subunit alpha-1
Enzyme 7 Synonyms
  1. Sodium pump subunit alpha-1
  2. Na(+)/K(+) ATPase alpha-1 subunit
Enzyme 7 Gene Name ATP1A1
Enzyme 7 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-1
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAVLCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALS
RIAGLCNRAVFQANQDNLPILKRAVAGDASESALLKCIEVCCGSVKEMRERYTKIVEIPF
NSTNKYQLSIHKNANAGEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDARA
CVVHGSDLKDMTPEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPQTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPNHLLGIRVTWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
Enzyme 7 Number of Residues 1021
Enzyme 7 Molecular Weight 112641.7
Enzyme 7 Theoretical pI 5.19
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Inorganic ion transport and metabolism
Enzyme 7 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 771-790 801-821 842-864 917-936 950-968 984-1004
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 115305284 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q08DA1 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name AT1A1_BOVIN Link Image
Enzyme 7 PDB ID 1MO8 Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >3066 bp
ATGGGGAAGGGGGTTGGACGTGATAAATATGAACCGGCAGCTGTTTCAGAGCATGGGGAC
AAGAAAAAAGCCAAGAAAGAGAGGGATATGGACGAGCTGAAGAAAGAAGTTTCTATGGAT
GATCATAAACTTAGCCTTGATGAACTTCATCGCAAATATGGAACAGACTTGAGCCGAGGC
TTAACAACTGCTCGAGCTGCCGAGATCCTAGCCAGAGATGGACCCAACGCCCTCACGCCC
CCTCCCACGACCCCTGAATGGGTCAAGTTCTGTCGACAGCTGTTTGGGGGGTTCTCAATG
TTACTGTGGATTGGAGCAGTTCTTTGCTTCCTGGCCTATGGTATCCAAGCTGCTACAGAA
GAGGAACCTCAAAATGATAATCTGTACCTTGGTGTGGTGCTGTCTGCTGTCGTCATCATA
ACCGGGTGTTTCTCCTACTATCAAGAAGCTAAAAGCTCAAAGATCATGGAGTCCTTCAAA
AACATGGTTCCTCAGCAAGCCCTCGTGATTCGAAATGGTGAGAAAATGAGCATAAATGCG
GAAGAGGTTGTCGTCGGAGATCTGGTGGAAGTGAAAGGAGGGGATCGAATTCCTGCCGAT
CTCAGGATCATTTCTGCAAATGGCTGCAAGGTGGATAACTCCTCACTCACGGGAGAATCA
GAGCCACAGACCAGGTCTCCGGATTTCACCAATGAAAATCCCCTGGAGACACGGAACATT
GCCTTTTTTTCAACTAACTGTGTTGAAGGCACTGCACGTGGCATTGTCGTGTATACTGGG
GATCGAACCGTGATGGGCAGAATTGCCACGCTGGCTTCTGGGCTGGAGGGGGGCCAGACT
CCCATCGCTGCGGAAATTGAACATTTTATCCACATCATCACGGGTGTGGCTGTGTTCCTG
GGCGTGTCGTTCTTCATCCTTTCTCTGATCCTTGAGTACACCTGGCTGGAGGCTGTCATC
TTCCTCATCGGCATCATTGTAGCCAACGTGCCAGAGGGTTTGCTGGCCACCGTCACGGTG
TGCCTGACGCTGACTGCAAAGCGCATGGCCAGGAAAAACTGCTTAGTGAAGAACCTGGAG
GCTGTGGAGACCTTGGGATCCACGTCCACCATCTGCTCAGACAAAACTGGAACTCTGACC
CAGAACCGAATGACAGTGGCCCACATGTGGTTCGACAACCAAATCCACGAGGCGGACACG
ACAGAGAATCAGAGCGGTGTTTCATTTGACAAGACTTCGGCCACGTGGCTCGCTCTGTCC
AGAATTGCAGGTCTTTGTAACAGGGCCGTGTTTCAGGCTAACCAGGATAACCTGCCTATC
CTGAAGCGGGCTGTAGCGGGTGATGCCTCAGAGTCTGCGCTCCTGAAGTGCATTGAGGTG
TGCTGCGGTTCTGTGAAGGAGATGAGAGAGAGATACACCAAGATCGTCGAGATCCCATTC
AACTCCACCAACAAGTACCAGTTATCCATCCACAAGAACGCCAATGCAGGTGAGCCCCGG
CACCTACTGGTGATGAAAGGTGCCCCAGAAAGGATCTTGGACCGCTGCAGCTCCATCCTC
ATCCATGGCAAGGAGCAGCCCCTGGACGAGGAGCTGAAGGACGCTTTTCAGAATGCCTAC
CTGGAGCTGGGTGGCCTCGGAGAGCGTGTGCTGGGTTTTTGCCACTTGCTGCTGCCAGAT
GAGCAGTTTCCTGAAGGCTTCCAGTTTGACACCGACGATGTGAACTTCCCTGTTGATAAT
CTCTGCTTCGTGGGACTCATCTCCATGATTGACCCACCACGGGCTGCTGTCCCAGATGCT
GTGGGCAAATGCCGAAGTGCTGGAATCAAGGTCATCATGGTCACCGGAGACCATCCCATC
ACTGCCAAAGCCATTGCCAAAGGTGTGGGGATCATCTCAGAAGGTAATGAGACTGTAGAA
GACATTGCTGCCCGCCTCAACATCCCAGTGAGCCAGGTGAACCCCAGGGATGCCCGGGCC
TGCGTGGTGCATGGAAGTGATCTGAAGGACATGACTCCCGAGCAGCTGGATGACATCTTG
AAGTACCACACAGAGATTGTGTTCGCCAGGACCTCTCCGCAGCAGAAGCTCATCATTGTG
GAAGGCTGCCAGAGACAGGGTGCCATCGTGGCTGTAACTGGAGACGGTGTCAATGACTCC
CCGGCTTTGAAGAAGGCAGACATTGGGGTTGCCATGGGGATTGCAGGCTCAGACGTGTCT
AAGCAAGCTGCTGACATGATTCTCCTAGATGACAACTTTGCCTCAATTGTGACTGGAGTA
GAGGAAGGTCGTCTGATCTTTGATAACTTGAAGAAATCCATTGCTTATACCCTCACCAGT
AACATTCCTGAGATTACCCCCTTCCTGATATTTATTATTGCAAACATTCCACTCCCTCTG
GGGACCGTCACCATCCTCTGCATCGACTTGGGAACGGACATGGTCCCTGCTATCTCCTTG
GCTTATGAGCAGGCTGAGAGCGACATCATGAAGAGGCAGCCCAGAAACCCCCAGACGGAC
AAACTCGTGAACGAGCGGCTGATCAGCATGGCCTATGGACAGATTGGTATGATCCAGGCC
CTGGGGGGCTTCTTCACTTACTTTGTTATCATGGCTGAGAACGGCTTCCTCCCAAATCAC
CTGCTGGGCATCCGAGTGACCTGGGATGACCGTTGGATCAACGATGTGGAGGACAGCTAT
GGGCAGCAGTGGACCTATGAACAGAGGAAGATTGTGGAGTTCACCTGCCACACGGCCTTC
TTTGTCAGTATCGTGGTGGTGCAGTGGGCTGACCTGGTCATCTGCAAGACCAGGAGGAAT
TCTGTCTTCCAGCAGGGGATGAAGAACAAGATCTTAATATTTGGCCTCTTTGAAGAGACA
GCCCTTGCTGCTTTCCTTTCCTACTGCCCTGGAATGGGTGTTGCCCTGAGGATGTATCCC
CTCAAACCTACCTGGTGGTTCTGTGCCTTCCCCTACTCTCTTCTCATCTTCGTGTATGAC
GAAGTCCGGAAGCTCATCATCAGGCGACGTCCTGGCGGTTGGGTGGAGAAGGAGACCTAC
TACTAG
Enzyme 7 GenBank Gene ID BC123864 Link Image
Enzyme 7 GeneCard ID ATP1A1 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 1p21
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 146
Enzyme 8 Name Activin receptor type-2A
Enzyme 8 Synonyms
  1. Activin receptor type IIA
  2. ACTR-IIA
Enzyme 8 Gene Name ACVR2A
Enzyme 8 Protein Sequence >Activin receptor type-2A
MGAAAKLAFAVFLISCSSGAILGRSETQECIFYNANWERDRTNRTGVESCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNERFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
Enzyme 8 Number of Residues 513
Enzyme 8 Molecular Weight 57951.2
Enzyme 8 Theoretical pI 5.90
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in activin receptor activity
Enzyme 8 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • 1-19
Enzyme 8 Transmembrane Regions
  • 136-161
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 393114 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q28043 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name AVR2A_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1542 bp
ATGGGAGCCGCTGCAAAGTTGGCGTTTGCCGTCTTTCTTATCTCTTGTTCTTCAGGTGCT
ATACTTGGTAGATCAGAAACTCAGGAGTGTATTTTCTATAATGCTAATTGGGAAAGAGAT
AGAACGAATCGCACTGGTGTTGAATCCTGTTACGGTGACAAAGATAAACGGCGGCATTGT
TTTGCTACATGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAGCAAGGTTGTTGGCTG
GATGATATCAACTGCTATGACAGGACTGATTGTATAGAAAAAAAAGATAGCCCTGAAGTA
TATTTTTGTTGCTGTGAGGGCAATATGTGTAACGAAAGGTTTTCTTATTTTCCGGAGATG
GAGGTCACACAGCCTACGTCGAATCCAGTAACTCCTAAGCCTCCCTATTACAACATCTTG
CTCTATTCTTTGGTGCCACTTATGTTAATTGCGGGGATTGTCATTTGTGCATTTTGGGTG
TACAGACATCATAAGATGGCTTACCCTCCTGTGCTCGTTCCAACTCAAGACCCAGGACCA
CCCCCACCTTCTCCATTACTAGGTTTGAAGCCATTACAGTTACTAGAAGTGAAAGCAAGA
GGAAGATTTGGTTGTGTGTGGAAAGCCCAGTTACTCAATGAATATGTGGCTGTGAAAATA
TTTCCAATACAGGATAAACAGTCATGGCAGAATGAATATGAAGTCTATAGTTTGCCTGGA
ATGAAGCATGAGAACATACTGCAGTTCATTGGTGCAGAGAAACGAGGCACCAGTGTTGAT
GTGGATCTTTGGCTAATCACAGCATTTCATGAAAAGGGTTCACTATCAGACTTTCTTAAG
GCTAATGTGGTCTCTTGGAATGAATTGTGTCATATTGCAGAAACCATGGCTAGAGGATTG
GCATATTTACATGAGGATATACCTGGCCTAAAAGATGGCCACAAACCCGCCATATCTCAC
AGGGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAATCTGACAGCCTGCATTGCTGAC
TTTGGGTTGGCGTTGAAGTTTGAGGCTGGCAAGTCTGCAGGTGATACTCATGGACAGGTG
GGTACCCGAAGGTATATGGCTCCAGAGGTGTTAGAGGGTGCTATCAACTTCCAAAGGGAT
GCATTTTTGAGGATAGATATGTACGCCATGGGATTAGTCCTGTGGGAACTGGCTTCTCGC
TGTACTGCTGCAGATGGACCTGTAGATGAATACATGCTGCCATTTGAGGAAGAAATTGGC
CAGCATCCCTCTCTTGAAGACATGCAGGAAGTTGTTGTGCATAAAAAAAAGAGGCCTGTT
TTAAGAGATTATTGGCAGAAACATGCTGGAATGGCAATGCTCTGTGAAACGATAGAAGAA
TGTTGGGATCACGATGCAGAAGCCAGGTTATCAGCTGGATGTGTAGGTGAAAGAATTACT
CAGATGCAAAGACTAACAAATATCATTACCACAGAGGACATTGTAACAGTGGTCACGATG
GTGACAAATGTTGACTTTCCTCCCAAAGAATCTAGTCTATGA
Enzyme 8 GenBank Gene ID L21717 Link Image
Enzyme 8 GeneCard ID ACVR2A Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:2
Enzyme 8 Locus 2q22.3
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 149
Enzyme 9 Name Cytosolic purine 5'-nucleotidase
Enzyme 9 Synonyms
  1. 5'-nucleotidase cytosolic II
  2. Cytosolic IMP/GMP-specific 5'-nucleotidase
Enzyme 9 Gene Name NT5C2
Enzyme 9 Protein Sequence >Cytosolic purine 5'-nucleotidase
MTTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY
KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV
CAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTS
CETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMK
EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT
VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTVCDLLGAKGKDILYIGDHIFGDILKS
KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA
HVLMPHESTVEHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLA
PQEITHCHDEDDDEEEEEEE
Enzyme 9 Number of Residues 560
Enzyme 9 Molecular Weight 64840.1
Enzyme 9 Theoretical pI 6.15
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in 5'-nucleotidase activity
Enzyme 9 Specific Function May have a critical role in the maintenance of a constant composition of intracellular purine/pyrimidine nucleotides in cooperation with other nucleotidases. Preferentially hydrolyzes inosine 5'-monophosphate (IMP) and other purine nucleotides
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 2668557 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID O46411 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name 5NTC_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1683 bp
ATGACAACCTCCTGGAGTGATCGGTTACAAAATGCAGCAGATATGCCTGCTAACATGGAT
AAACATGCCCTGAAAAAGTATCGGCGAGAAGCCTATCATCGGGTGTTTGTGAACCGGAGT
TTAGCCATGGAAAAAATAAAGTGTTTTGGGTTTGACATGGATTATACACTTGCTGTGTAC
AAGTCCCCGGAGTATGAGTCCCTTGGCTTTGAGCTTACTGTGGAGAGATTAGTTTCTATT
GGCTATCCTCAGGAACTTCTCAGCTTTGCATATGACTCTACATTCCCTACCAGGGGACTA
GTATTTGATACACTGTATGGAAATCTTTTGAAAGTTGATGCCTATGGAAACCTCTTGGTC
TGTGCACATGGATTTAACTTCATAAGGGGACCAGAAACTAGAGAGCAGTATCCAAATAAA
TTTATTCAACGAGATGACACTGAAAGATTTTACATTCTGAACACACTATTCAACCTACCA
GAGACCTACCTGTTGGCCTGCCTAGTAGATTTTTTTACTAATTGTCCCAGATACACCAGC
TGTGAAACAGGATTTAAAGATGGGGACCTCTTCATGTCTTACCGGAGTATGTTCCAGGAT
GTAAGAGACGCAGTTGACTGGGTTCATTACAAGGGTTCCCTTAAGGAAAAGACAGTTGAA
AATCTTGAGAAGTATGTAGTCAAAGATGGAAAACTGCCTTTGCTTCTGAGCCGGATGAAG
GAAGTAGGAAAAGTATTTCTTGCCACCAACAGTGACTATAAATATACAGATAAAATTATG
ACTTACCTGTTTGATTTCCCACATGGCCCCAAGCCTGGGAGCTCTCATCGGCCGTGGCAG
TCCTACTTTGACCTGATCTTGGTGGACGCACGGAAACCACTGTTCTTCGGAGAAGGCACA
GTACTGCGTCAGGTGGATACTAAAACTGGCAAGCTGAAAATTGGTACCTACACGGGCCCC
TTACAGCATGGCATCGTCTACTCTGGGGGTTCATCTGATACAGTTTGTGACCTGTTGGGA
GCCAAGGGCAAAGATATTTTGTATATTGGAGATCACATTTTTGGGGACATTTTAAAATCA
AAGAAACGGCAAGGGTGGCGAACTTTCTTGGTGATTCCTGAACTCGCACAGGAACTGCAT
GTCTGGACCGATAAGAGTTCACTTTTCGAAGAGCTTCAGAGCTTGGATATTTTCTTGGCT
GAACTCTACAAGCACCTTGACAGCAGCAGCAATGAGCGCCCAGATATCAGCTCCATCCAA
AGACGTATTAAGAAAGTAACTCACGACATGGACATGTGCTACGGGATGATGGGGAGCCTG
TTCCGCAGTGGCTCCCGGCAGACCCTTTTCGCCAGTCAGGTGATGCGCTATGCTGATCTC
TACGCAGCATCTTTCATCAACCTGCTGTACTACCCATTCAGCTACCTCTTCAGAGCGGCC
CACGTCTTGATGCCTCATGAGTCAACAGTGGAACACACACATGTAGATATCAATGAGATG
GAGTCCCCTCTCGCCACCCGGAACCGCACATCAGTGGATTTCAAAGATACCGACTACAAG
CGGCACCAACTGACACGGTCGATTAGTGAGATTAAGCCCCCCAACCTCTTCCCACTGGCC
CCCCAGGAAATTACACACTGCCATGACGAAGATGATGATGAGGAGGAAGAAGAGGAGGAG
TGA
Enzyme 9 GenBank Gene ID U73690 Link Image
Enzyme 9 GeneCard ID NT5C2 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 10q24.32-q24.33
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 150
Enzyme 10 Name Fructose-1,6-bisphosphatase isozyme 2
Enzyme 10 Synonyms
  1. FBPase 2
  2. D-fructose-1,6-bisphosphate 1-phosphohydrolase 2
Enzyme 10 Gene Name FBP2
Enzyme 10 Protein Sequence >Fructose-1,6-bisphosphatase isozyme 2
MGDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLANLYGI
AGSVNVTGDEVKKLDVLSNALVINMLQSSYSTCVLVSEENKEAIITSKEKRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQPGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGR
Enzyme 10 Number of Residues 339
Enzyme 10 Molecular Weight 36766.9
Enzyme 10 Theoretical pI 7.81
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Carbohydrate transport and metabolism
Enzyme 10 Specific Function D-fructose 1,6-bisphosphate + H(2)O = D- fructose 6-phosphate + phosphate
Enzyme 10 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 86823226 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q2KJJ9 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name F16P2_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1020 bp
ATGGGGGACAGAAGCCCCTTCGAAACGGACATGCTCACCCTGACCCGCTATGTTATGGAA
AAGGGGCGTCAGGCCAAAGGCACCGGGGAGCTCACGCAGCTGCTCAACTCCATGCTGACG
GCCATCAAAGCCATCTCCTCAGCTGTGCGTAAGGCGGGCCTGGCCAACCTGTACGGAATC
GCGGGAAGCGTGAACGTGACGGGGGATGAGGTGAAGAAACTGGACGTGTTATCCAATGCC
CTGGTGATCAACATGCTCCAGTCCTCCTACAGCACCTGCGTCCTGGTGTCGGAAGAGAAT
AAAGAAGCCATTATCACCTCCAAGGAGAAGAGGGGGAAATACGTGGTCTGCTTTGACCCT
CTGGACGGATCTTCCAACATTGACTGCCTGGCTTCCATTGGAACCATATTTGCCATCTAC
AGAAAGACCTCAGAGGATGAGCCTTCTGAAAAGGATGCCCTGCAGCCAGGTCGCAACATT
GTGGCTGCTGGCTATGCACTCTATGGAAGTGCAACCCTGGTGGCTCTTTCCACAGGGCAA
GGAGTGGACCTCTTCATGCTTGACCCAGCTCTTGGTGAATTTGTCTTGGTGGAAAAAGAT
GTCAAGATTAAAAAGAAAGGAAAGATTTACAGCCTCAACGAGGGCTATGCCAAGTATTTT
GATGCTGCCACCACAGAATATGTGCAGAAAAAGAAGTTTCCTGAGGACGGCAGTGCTCCC
TATGGGGCCAGGTACGTGGGCTCCATGGTGGCTGATGTGCACCGCACCCTTGTCTATGGA
GGGATCTTCCTGTACCCAGCAAACCAGAAAAGTCCGAAGGGCAAGCTCCGGCTCCTGTAT
GAGTGCAATCCTGTGGCCTACATCATCGAGCAGGCGGGAGGGCTGGCGACCACAGGCACC
CAACCCGTGCTGGACGTGAAGCCTGAAGCCATTCACCAACGAGTCCCCCTCATTCTAGGG
TCCCCAGAAGATGTACAGGAATATCTCACCTGTGTACAGAAAAATCAGGCAGGCAGGTAG
Enzyme 10 GenBank Gene ID BC102390 Link Image
Enzyme 10 GeneCard ID FBP2 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:9
Enzyme 10 Locus 9q22.3
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 152
Enzyme 11 Name Activin receptor type-2B
Enzyme 11 Synonyms
  1. Activin receptor type IIB
  2. ACTR-IIB
Enzyme 11 Gene Name ACVR2B
Enzyme 11 Protein Sequence >Activin receptor type-2B
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGERDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPVGGLSLIALLAFWMYRHRKPPYGHADIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSSLEAELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPAIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
Enzyme 11 Number of Residues 512
Enzyme 11 Molecular Weight 57568.2
Enzyme 11 Theoretical pI 5.60
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in activin receptor activity
Enzyme 11 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • 1-18
Enzyme 11 Transmembrane Regions
  • 138-158
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 1621097 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q95126 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name AVR2B_BOVIN Link Image
Enzyme 11 PDB ID 1NYU Link Image
Enzyme 11 PDB File Show
Enzyme 11 3D Structure
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >1539 bp
ATGACGGCGCCCTGGGCGGCCCTCGCCCTCCTTTGGGGATCGCTGTGCGCCGGTTCGGGG
CGCGGGGAGGCCGAGACACGGGAGTGCATCTACTACAACGCCAACTGGGAGCTGGAGCGC
ACCAACCAGAGCGGCCTGGAGCGCTGCGAGGGCGAGCGGGACAAGCGGCTGCACTGCTAC
GCCTCCTGGCGCAACAGCTCGGGCACCATCGAGCTCGTCAAGAAAGGCTGCTGGCTGGAC
GACTTCAACTGCTACGACAGGCAGGAGTGCGTGGCCACCGAGGAGAACCCCCAGGTGTAC
TTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACCTGCCCGAGGCGGGC
GGCCCAGAAGTCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACTGTGCTGGCC
TACTCGCTGCTGCCCGTCGGGGGCCTCTCCCTCATCGCCCTGCTGGCCTTCTGGATGTAC
CGACATCGCAAGCCCCCCTACGGCCACGCGGACATCCACGAGGACCCTGGACCTCCACCC
CCGTCCCCTCTGGTGGGCCTGAAGCCTCTGCAACTGCTGGAGATCAAGGCTCGGGGGCGC
TTTGGTTGTGTCTGGAAGGCGCAGCTCATGAACGACTTCGTGGCTGTCAAGATCTTCCCA
CTCCAGGACAAGCAGTCGTGGCAGAGTGAGCGGGAGATCTTCAGCACGCCTGGCATGAAG
CACGAGAACCTGCTGCAGTTCATTGCCGCTGAGAAGCGAGGCTCCAGCCTGGAGGCAGAG
CTGTGGCTCATCACGGCCTTCCACGACAAGGGCTCCCTCACGGATTACCTCAAGGGGAAC
ATCATCACATGGAACGAACTGTGTCACGTGGCAGAGACGATGTCTAGAGGCCTCTCATAC
CTACACGAGGATGTGCCCTGGTGCCGGGGCGAGGGCCACAAGCCATCTATTGCCCACAGG
GACTTTAAGAGCAAGAATGTATTGCTGAAGAGTGACCTCACTGCTGTGCTGGCTGACTTT
GGCCTGGCTGTTCGGTTTGAGCCAGGGAAACCTCCGGGGGACACTCACGGGCAGGTGGGC
ACGCGGCGGTACATGGCCCCCGAGGTGCTCGAGGGAGCCATCAACTTCCAGAGAGACGCC
TTTCTGCGCATCGACATGTACGCCATGGGGCTGGTGCTGTGGGAGCTCGTGTCCCGCTGC
AAAGCTGCCGATGGACCTGTGGATGAGTACATGCTGCCTTTTGAGGAGGAGATCGGCCAG
CACCCGTCACTGGAGGAGCTGCAGGAGGTGGTGGTGCACAAGAAGATGCGGCCCGCCATC
AAGGATCACTGGCTGAAACACCCGGGCCTGGCCCAGCTCTGCGTGACCATCGAGGAGTGC
TGGGACCACGATGCAGAGGCTCGCCTGTCTGCGGGCTGTGTGGAGGAGCGAGTGTCCCTG
ATCCGGAGGTCGGTCAACGGCACTACCTCGGACTGTCTTGTCTCCCTGGTGACCTCCGTC
ACCAATGTGGACCTGCCCCCGAAGGAGTCGAGCATCTAA
Enzyme 11 GenBank Gene ID U57707 Link Image
Enzyme 11 GeneCard ID ACVR2B Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:3
Enzyme 11 Locus 3p22
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 153
Enzyme 12 Name Calcium-transporting ATPase type 2C member 1
Enzyme 12 Synonyms
  1. ATPase 2C1
  2. Secretory pathway Ca(2+)-transporting ATPase
Enzyme 12 Gene Name ATP2C1
Enzyme 12 Protein Sequence >Calcium-transporting ATPase type 2C member 1
MDNLLPQSRFSYFKKYPIHAIRKYLSMLRNQKEEEQVARFQKIPNAENETMIPVLTSKKA
SELPVSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIML
LLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLMPPECHCVREGK
LEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETTPCSKVTAPQPAAT
NGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLG
KQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMV
KKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLRAEVTGVGYNPFGEV
IVDGDVVHGFYNPSVSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDY
IRKAEYPFSSEQKWMAVKCVHRTQQDRPEICFMKGAYEQVIKYCTTYHSKGQTLTLTQQQ
RDLYQQEKAQMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSI
KMITGDSQETAVAIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKM
KIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIM
SAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPA
QSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPR
DTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQK
VFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSREKIQKPVSSTSSSFLEV
Enzyme 12 Number of Residues 953
Enzyme 12 Molecular Weight 104779.3
Enzyme 12 Theoretical pI 7.01
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Inorganic ion transport and metabolism
Enzyme 12 Specific Function This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • 105-125 139-157 297-316 329-346 734-753 764-784 805-824 843-862 876-894 910-930
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 7595749 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID P57709 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name AT2C1_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >2862 bp
ATGGATAATCTGTTGCCTCAGTCAAGATTCTCTTATTTCAAAAAATATCCTATCCATGCA
ATTAGAAAATATTTATCGATGCTGAGAAACCAAAAAGAAGAAGAACAGGTTGCACGTTTT
CAAAAAATTCCTAATGCTGAAAATGAGACAATGATTCCGGTATTGACATCAAAAAAAGCA
AGTGAATTACCAGTCAGTGAAGTTGCAAGCATTCTCCAAGCTGATCTTCAGAATGGTCTA
AACAAATGTGAAGTAAGTCATAGGAGAGCCTTCCATGGCTGGAATGAGTTTGATATCAGT
GAAGATGAGCCACTATGGAAGAAGTATATTTCTCAGTTTAAAAATCCCCTTATTATGCTG
CTTCTGGCTTCTGCAGTCATCAGTGTTTTAATGCATCAGTTTGATGATGCTGTCAGTATC
ACTGTGGCAATACTTATTGTTGTTACGGTCGCCTTCGTTCAGGAATATCGTTCAGAAAAA
TCTCTTGAAGAACTAAGTAAACTTATGCCACCAGAATGCCATTGTGTGCGTGAAGGAAAA
TTGGAGCATACACTTGCACGAGACTTAGTTCCAGGTGATACAGTTTGCCTTTCAGTTGGG
GACAGGGTTCCTGCTGACTTGCGCTTGTTTGAGGCTGTGGATCTTTCTGTTGATGAGTCC
AGCTTGACAGGAGAGACAACACCTTGTTCTAAGGTGACAGCTCCTCAGCCGGCTGCTACT
AATGGAGATCTTGCATCAAGAAGTAACATTGCCTTCATGGGAACACTGGTCAGATGTGGC
AAAGCAAAGGGTATTGTCATTGGAACAGGAGAAAATTCTGAATTCGGAGAAGTTTTTAAA
ATGATGCAAGCAGAAGAAGCACCAAAAACCCCTCTGCAGAAGAGCATGGACCTCTTAGGA
AAACAACTTTCCTTTTACTCCTTTGGTATAATAGGTATCATCATGTTGGTTGGCTGGTTG
CTAGGAAAAGACATATTGGAAATGTTTACTATTAGTGTAAGTTTGGCTGTAGCAGCAATT
CCTGAAGGTCTTCCCATTGTGGTCACAGTGACTCTAGCCCTTGGTGTTATGAGAATGGTG
AAGAAGAGGGCGATTGTGAAAAAACTACCTATTGTTGAAACTCTGGGTTGCTGTAATGTG
ATTTGTTCAGATAAGACTGGAACCCTGACCAAGAATGAAATGACTGTTACCCACATATTT
ACTTCGGATGGCCTGCGTGCTGAGGTTACTGGAGTTGGCTACAATCCATTTGGGGAAGTG
ATTGTTGATGGTGATGTTGTTCATGGATTCTATAACCCATCTGTTAGTAGAATTGTTGAG
GCTGGCTGTGTGTGCAATGATGCTGTAATTAGAAATAACACTCTAATGGGGAAACCAACG
GAAGGAGCCTTAATTGCTCTTGCAATGAAGATGGGTCTTGATGGACTTCAACAGGATTAT
ATCAGAAAAGCTGAATACCCTTTTAGCTCTGAGCAGAAGTGGATGGCTGTTAAGTGTGTG
CACCGAACACAGCAGGACAGACCAGAGATTTGTTTTATGAAGGGTGCTTATGAACAGGTG
ATTAAGTATTGTACTACATATCACAGCAAAGGACAGACCTTGACACTCACCCAGCAGCAG
AGAGATCTGTACCAGCAAGAGAAGGCCCAGATGGGCTCTGCAGGGCTCAGAGTTCTTGCT
TTGGCTTCTGGTCCTGAATTGGGACAACTGACGTTCCTTGGCCTGGTGGGAATCATTGAT
CCTCCTAGAACTGGTGTGAAAGAAGCCGTTACAACACTCATTGCCTCAGGAGTATCAATA
AAAATGATTACTGGAGACTCACAGGAGACTGCAGTTGCCATCGCTAGTCGTCTGGGATTA
TATTCCAAAACCTCCCAGTCAGTCTCAGGAGAAGAAATAGATGCAATGGATGTCCAGCAG
CTTTCACAAATAGTGCCAAAGGTTGCAGTATTTTACAGAGCTAGCCCAAGGCATAAGATG
AAAATTATCAAGTCTCTGCAGAAGAATGGGTCAGTTGTGGCCATGACAGGAGATGGAGTA
AATGATGCAGTTGCTCTGAAGGCTGCAGACATTGGAGTTGCGATGGGTCAGACTGGCACA
GATGTTTGCAAAGAGGCAGCTGACATGATCCTGGTGGATGATGATTTCCAAACCATCATG
TCTGCAATTGAAGAGGGTAAAGGGATTTATAATAACATTAAAAATTTTGTTAGATTCCAG
CTGAGCACGAGTATAGCAGCATTAACTTTAATCTCACTGGCTACATTAATGAACTTTCCC
AATCCTCTCAATGCCATGCAGATTTTGTGGATCAATATTATTATGGATGGACCTCCAGCT
CAGAGCCTTGGAGTAGAACCAGTGGATAAAGATGTCATTCGTAAACCTCCACGCAACTGG
AAAGACAGCATTTTGACCAAAAACCTGATACTTAAAATACTTGTTTCCTCAATAATCATT
GTTTGTGGGACTTTGTTTGTCTTCTGGCGGGAGCTGCGAGACAATGTGATAACACCTCGG
GACACAACAATGACTTTCACGTGCTTTGTGTTTTTTGACATGTTCAATGCACTGAGTTCC
AGATCTCAGACCAAATCTGTGTTTGAGATTGGACTCTGCAGTAATAAAATGTTTTGCTAT
GCAGTTCTTGGATCCATCATGGGACAGTTATTAGTTATTTACTTTCCTCCACTTCAGAAA
GTTTTTCAGACTGAGAGCCTAAGTATACTGGATTTACTGTTTCTTCTGGGTCTCACCTCG
TCAGTGTGCATAGTGGCAGAAATTATCAAGAAGGTTGAAAGGAGCAGAGAGAAGATCCAG
AAGCCTGTTAGCTCGACATCATCGTCTTTTCTTGAAGTATGA
Enzyme 12 GenBank Gene ID AF230532 Link Image
Enzyme 12 GeneCard ID ATP2C1 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:3
Enzyme 12 Locus 3q22.1
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 157
Enzyme 13 Name Probable phospholipid-transporting ATPase IIB
Enzyme 13 Synonyms
  1. ATPase class II type 9B
Enzyme 13 Gene Name ATP9B
Enzyme 13 Protein Sequence >Probable phospholipid-transporting ATPase IIB
MADQIPLYPVRSAAAVAAANRKRAAYFSSAGPGPGADRPSRYQLEDESAHLDEMPLMMSE
EGFENDESDYHTLPRARITRRKRGLEWFVCGGWKFLCTSCCDWLINICQRKRELKARTVW
LGCPEKCEEKHPRNSIKNQKYNIFTFIPGVLYEQFKFFLNLYFLIVSCSQFVPALKIGYL
YTYWAPLGFVLAVTIMREAVDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLII
VEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSINAY
VYAQKPQLDIHSFEGTFTREDSDPPVHESLSIENTLWASTVVASGTVIGVVIYTGKETRS
VMNTSNPKNKVGLLDLELNQLTKALFLALVALSVVMVTLQGFAGPWYRSLFRFLLLFSYI
IPISLRVNLDMGKAAYGWMIMRDEHIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMV
FKRLHLGTVSYGTDTMDEIQNHLVNAYTQTQCQAGGSSAASTPPRKAPSSAPKVRRSVSS
RVHEAVKAVALCHNVTPVYEARGAAGETEVAEADQDFSDDNRTYQASSPDEVALVQWTES
VGLTLVSRDLTSMQLRTPGGQILTYCILQTFPFTSESKRMGVIVRDESTAEITFYMKGAD
VAMASIVQYNDWLEEECGNMAREGLRTLVVAKRALTEEQYQDFESRYNQAKLSLHDRTLK
VAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSS
HLVSRTQDTHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQ
CPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGRQAS
LAADFSITRFKHVGRLLMVHGRSSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPL
YQGFLMVGYATVYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLVWVLIS
IYQGGILMFGALVLFESEFVHVVAISFTALVLTELLMVALTVRTWHWLMVVAQLLSLGCY
VASLAFLNEYFDVAFITTVTFVWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKLSS
Enzyme 13 Number of Residues 1136
Enzyme 13 Molecular Weight 127456.0
Enzyme 13 Theoretical pI 7.73
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Inorganic ion transport and metabolism
Enzyme 13 Specific Function ATP + H(2)O + phospholipid(In) = ADP + phosphate + phospholipid(Out)
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • 146-166 175-195 384-404 409-429 940-960 963-983 1013-1033 1042-1062 1067-1087 1099-1119
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 119224098 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID A1A4J6 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name ATP9B_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >3411 bp
ATGGCGGACCAGATCCCTCTGTACCCGGTGCGCAGCGCGGCGGCCGTGGCCGCGGCCAAC
CGTAAACGCGCGGCCTACTTCAGCTCAGCGGGGCCCGGGCCGGGGGCCGACAGGCCCAGC
AGGTACCAGCTGGAGGATGAGTCTGCCCACTTGGATGAAATGCCACTGATGATGTCTGAA
GAGGGCTTTGAGAACGACGAAAGTGATTACCACACTTTACCACGAGCTAGGATCACCCGA
AGAAAGAGAGGCCTGGAGTGGTTTGTCTGTGGGGGATGGAAGTTCCTCTGTACCAGTTGC
TGTGACTGGCTGATAAATATTTGTCAAAGAAAGAGAGAATTGAAAGCTCGTACGGTGTGG
CTTGGATGTCCGGAAAAGTGTGAAGAAAAACATCCCAGAAATTCTATAAAAAATCAGAAA
TATAATATATTTACCTTTATACCTGGGGTTTTATATGAACAATTCAAATTTTTCCTGAAT
CTCTATTTCCTGATAGTATCCTGCTCACAGTTTGTACCAGCACTGAAAATAGGGTATCTC
TACACCTACTGGGCTCCTCTGGGGTTTGTCTTGGCTGTTACTATCATGAGAGAAGCAGTT
GATGAATTTCGGCGTTTCCAGCGAGACAAGGAAGTGAACTCACAACTGTACAGCAAGCTT
ACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATA
GTGGAAAAGAATCAAAGAATTCCATCGGACATGGTATTTCTTAGGACGTCAGAAAAAGCA
GGTTCGTGTTTTATTCGAACTGATCAACTCGATGGTGAAACTGACTGGAAGCTGAAAGTG
GCGGTGAGCTGCACACAGAGGCTGCCCGCTCTGGGGGACCTTTTTTCTATCAATGCTTAT
GTTTATGCTCAGAAGCCACAACTGGATATTCATAGTTTTGAAGGCACATTTACGAGGGAA
GACAGTGATCCACCTGTTCATGAAAGTCTCAGCATAGAAAATACATTGTGGGCAAGCACT
GTGGTTGCATCAGGTACTGTAATAGGTGTGGTCATCTATACTGGAAAAGAGACTAGAAGT
GTCATGAACACATCAAATCCAAAAAACAAGGTTGGTCTGTTGGATCTTGAACTCAACCAG
CTGACCAAAGCACTATTTCTGGCCTTGGTTGCCCTCTCGGTTGTCATGGTGACCTTGCAG
GGATTTGCAGGCCCCTGGTACCGCAGTCTCTTCCGCTTTCTCCTCCTCTTCTCCTACATC
ATTCCCATAAGTTTGCGTGTGAACCTGGACATGGGCAAGGCTGCCTACGGGTGGATGATC
ATGAGAGACGAGCACATTCCCGGCACCGTGGTCCGGACCAGCACCATCCCGGAGGAGCTG
GGGCGCCTGGTGTACCTGCTGACCGACAAGACAGGAACCCTCACCCAAAACGAGATGGTG
TTTAAGCGGCTGCACCTGGGCACCGTGTCTTACGGGACGGACACGATGGATGAGATCCAG
AACCACCTCGTGAACGCCTACACACAGACGCAGTGTCAGGCTGGCGGAAGCAGCGCTGCT
TCAACTCCTCCAAGGAAAGCCCCGTCGTCAGCGCCCAAGGTGAGGAGGAGCGTGAGCAGC
CGGGTCCATGAGGCCGTGAAGGCTGTCGCCCTGTGTCACAATGTGACGCCCGTGTACGAG
GCCCGCGGTGCAGCTGGCGAGACCGAGGTCGCCGAGGCGGACCAGGATTTCAGTGATGAC
AACCGCACCTACCAGGCCTCCAGCCCTGACGAGGTGGCCCTGGTGCAGTGGACAGAGAGC
GTCGGCCTCACGCTGGTCAGCAGAGACCTCACGTCCATGCAGCTGCGGACCCCCGGCGGC
CAGATCCTCACCTACTGCATCCTTCAGACCTTCCCCTTCACGTCGGAGAGCAAGCGCATG
GGGGTCATCGTCAGGGACGAGTCCACAGCAGAGATCACGTTCTACATGAAGGGCGCCGAC
GTGGCCATGGCCTCCATCGTGCAATACAACGATTGGCTGGAGGAGGAGTGTGGGAACATG
GCCCGCGAAGGCCTGCGCACGCTCGTGGTGGCCAAGAGGGCACTCACGGAGGAGCAGTAC
CAGGACTTCGAGAGCCGCTACAACCAGGCCAAGCTGAGCCTCCACGACCGGACGCTCAAG
GTGGCCGCTGTGGTGGAGAGCCTGGAGCGGGAGATGGAGCTGCTGTGCCTGACGGGCGTG
GAGGACCAGCTGCAGGCAGACGTGAGGCCCACCCTGGAGATGCTGCGCAACGCTGGCATC
AAGATCTGGATGCTGACAGGCGACAAGCTGGAGACCGCCACGTGCATCGCCAAGAGTTCC
CACCTGGTGTCACGAACGCAGGACACGCATGTTTTCAGGCCGGTGACCAGCCGCGGAGAA
GCCCACCTGGAGCTGAATGCCTTTCGAAGGAAACATGACTGCGCACTGGTCATTTCCGGG
GACTCCCTGGAGGTCTGCTTGAAGTACTACGAGCACGAGTTTGTGGAGCTGGCCTGCCAG
TGCCCGGCCGTGGTCTGCTGCCGCTGCTCGCCCACCCAGAAGGCCCACATCGTCAAGCTG
CTGCAGCAACACACAGGCCGCCGCACCTGCGCCATCGGTGACGGAGGGAACGACGTGAGC
ATGATCCAGGCGGCGGACTGCGGGATCGGCATCGAGGGGAAGGAGGGGCGGCAGGCCTCA
CTGGCAGCTGACTTCTCCATCACGCGGTTCAAGCACGTTGGCCGTCTGCTCATGGTGCAC
GGGCGCAGCAGCTACAAGCGCTCGGCGGCACTCGGCCAGTTCGTCATGCACCGGGGCCTC
ATCATCTCCACGATGCAGGCTGTGTTCTCCTCCGTCTTCTACTTTGCATCGGTCCCTCTG
TACCAGGGTTTCCTCATGGTGGGGTACGCAACCGTCTACACCATGTTCCCCGTGTTCTCG
CTGGTGCTGGACCAGGATGTGAAGCCGGAGATGGCCATGCTGTACCCAGAGCTGTACAAG
GACCTCACCAAGGGGCGATCCTTATCCTTCAAGACCTTCCTCGTCTGGGTTCTGATCAGC
ATTTACCAAGGTGGCATCCTCATGTTCGGGGCGCTGGTGCTGTTTGAGTCTGAGTTCGTG
CACGTGGTGGCCATCTCCTTCACGGCGCTGGTGCTCACGGAGCTGCTGATGGTGGCGCTG
ACCGTCAGGACCTGGCACTGGCTCATGGTCGTGGCCCAGCTGCTCAGCCTCGGCTGCTAC
GTGGCCTCGCTGGCTTTCCTCAATGAATATTTTGACGTTGCCTTTATCACGACTGTGACC
TTCGTGTGGAAAGTGTCAGCCATCACAGTGGTCAGCTGCCTCCCTCTCTATGTCCTGAAG
TACTTGAAGCGGAAGCTGTCCCCGCCCAGCTACTCCAAGCTCTCCTCCTAG
Enzyme 13 GenBank Gene ID BC126606 Link Image
Enzyme 13 GeneCard ID ATP9B Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 18q23
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 158
Enzyme 14 Name Sodium/potassium-transporting ATPase subunit alpha-2
Enzyme 14 Synonyms
  1. Sodium pump subunit alpha-2
  2. Na(+)/K(+) ATPase alpha-2 subunit
Enzyme 14 Gene Name ATP1A2
Enzyme 14 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-2
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAFGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYL
ELGGLGERVLGFCQLNLPSAKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
Enzyme 14 Number of Residues 1020
Enzyme 14 Molecular Weight 112178.3
Enzyme 14 Theoretical pI 5.33
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Inorganic ion transport and metabolism
Enzyme 14 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium, providing the energy for active transport of various nutrients
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 770-789 800-820 841-863 916-935 949-967 983-1003
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 124829106 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID A2VDL6 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name AT1A2_BOVIN Link Image
Enzyme 14 PDB ID 1Q3I Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >3063 bp
ATGGGCCGTGGGGCTGGCCGCGAGTACTCGCCTGCAGCCACCACTGCGGAAAATGGGGGC
GGCAAGAAGAAACAGAAAGAGAAGGAGCTGGATGAGCTGAAGAAGGAAGTGGCCATGGAT
GACCACAAGCTGTCCTTGGATGAGCTGGGCCGCAAGTACCAAGTGGATCTGTCCAAGGGC
CTCACCAACCAGCGGGCCCAGGACATTCTGGCTCGGGATGGACCCAATGCCCTCACCCCA
CCCCCAACCACCCCTGAGTGGGTCAAGTTCTGTCGTCAGCTTTTCGGGGGCTTCTCCATC
CTACTGTGGATTGGGGCCATCCTCTGCTTCCTGGCCTTTGGCATCCAGGCTGCCATGGAG
GATGAACCGTCCAACGACAATCTTTATCTGGGCGTGGTGCTGGCAGCTGTGGTCATCGTC
ACTGGCTGCTTCTCCTACTACCAGGAGGCCAAGAGCTCCAAGATCATGGATTCCTTCAAG
AACATGGTGCCTCAGCAAGCCCTTGTGGTGCGAGAAGGAGAGAAGATGCAGATCAACGCG
GAGGAGGTGGTGGTGGGCGACCTGGTGGAGGTGAAGGGTGGGGACCGCGTGCCCGCTGAC
CTCCGGATCATCTCTTCTCACGGCTGCAAGGTGGACAACTCCTCCCTGACAGGCGAGTCA
GAACCCCAGACCCGCTCCCCTGAGTTCACCCACGAGAATCCCCTGGAGACCCGCAATATC
TGTTTCTTCTCTACCAACTGTGTGGAAGGCACTGCCAGGGGCATCGTGATTGCCACAGGT
GACCGGACGGTGATGGGCCGTATAGCCACTCTGGCCTCAGGCCTGGAGGTCGGGCGGACG
CCCATAGCCATGGAGATTGAGCACTTCATTCAGCTGATCACAGGGGTGGCCGTCTTCCTG
GGGGTCTCCTTCTTCGTGCTGTCCCTCATCCTGGGCTACAGCTGGCTGGAGGCGGTCATC
TTCCTTATCGGCATCATTGTGGCCAACGTGCCTGAGGGTCTGCTGGCCACTGTCACCGTG
TGTCTGACCCTGACAGCCAAGCGCATGGCTCGGAAGAACTGCCTGGTGAAGAACCTGGAG
GCGGTGGAGACTCTGGGCTCCACCTCCACCATCTGCTCCGACAAGACCGGAACCCTCACC
CAGAACCGCATGACCGTCGCCCACATGTGGTTCGACAATCAGATCCATGAGGCCGACACC
ACGGAAGATCAGTCTGGGGCCACTTTTGACAAACGATCCCCGACATGGACTGCCCTATCC
CGGATTGCTGGTCTCTGCAACCGTGCTGTGTTCAAGGCAGGGCAGGAAAACATCTCTGTG
TCTAAGCGGGACACAGCAGGTGATGCCTCCGAGTCAGCTCTCCTCAAGTGCATTGAGCTG
TCCTGCGGCTCCGTGAGGAAGATGAGGGATAGAAACCCCAAGGTGGCAGAGATCCCTTTC
AACTCAACCAATAAGTACCAGCTGTCCATCCACGAGCGAGAAGACAGCCCCCAGAGCCAC
GTGCTGGTGATGAAGGGGGCCCCTGAGCGCATCCTGGACCGTTGCTCCTCCATCCTGGTG
CAGGGCAAGGAGATCCCTCTGGACAAGGAGATGCAAGATGCCTTCCAGAATGCCTACCTG
GAGCTGGGAGGGCTCGGGGAGCGCGTCCTGGGCTTCTGTCAACTGAATCTGCCTTCTGCA
AAGTTTCCTCGGGGCTTCAAATTTGACACGGATGAGCTGAACTTTCCCACAGAGAAGCTC
TGCTTCGTGGGGCTCATGTCCATGATTGACCCTCCACGGGCTGCCGTTCCCGATGCTGTG
GGCAAGTGCCGGAGTGCAGGCATCAAGGTGATCATGGTGACCGGTGACCACCCCATCACA
GCCAAGGCCATTGCCAAAGGCGTGGGCATCATCTCAGAAGGCAACGAGACAGTGGAGGAC
ATTGCCGCCCGGCTCAACATTCCTGTTAGCCAAGTCAACCCCAGAGAAGCCAAGGCGTGT
GTGGTGCACGGCTCTGACCTGAAAGATATGACGTCGGAGCAGCTGGACGAGATCCTCAAG
AATCACACGGAGATCGTCTTTGCCCGGACGTCTCCTCAGCAGAAGCTCATCATCGTGGAG
GGCTGCCAGAGGCAGGGAGCCATTGTGGCGGTGACGGGGGATGGGGTGAATGACTCCCCG
GCGCTAAAGAAGGCGGACATTGGCATCGCCATGGGCATCGCTGGCTCCGACGTTTCTAAG
CAGGCCGCCGACATGATCCTGCTGGATGACAACTTTGCCTCCATCGTCACTGGCGTGGAG
GAGGGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCGCCTACACCCTGACCAGTAAC
ATCCCCGAGATCACCCCTTTCCTGCTGTTCATCATCGCCAACATCCCCCTGCCTCTGGGC
ACCGTGACCATCCTCTGCATTGACCTGGGCACTGATATGGTCCCTGCCATCTCCTTGGCC
TATGAGGCAGCTGAGAGTGACATCATGAAGCGGCAGCCACGCAACCCGCAGACGGACAAG
CTGGTGAACGAGAGGCTCATCAGCATGGCCTATGGACAGATCGGGATGATCCAGGCTCTG
GGTGGCTTCTTCACCTACTTTGTGATCCTGGCAGAGAATGGTTTTCTACCTTCGCGGCTT
CTGGGAATCCGCCTGGACTGGGATGACCGGTCCATGAATGACTTGGAGGACAGCTACGGA
CAGGAGTGGACCTATGAACAGCGGAAGGTGGTGGAGTTCACATGCCACACGGCTTTCTTT
GCCAGCATTGTGGTCGTGCAATGGGCTGACCTCATCATCTGCAAGACCCGCCGCAACTCA
GTTTTCCAGCAGGGAATGAAAAACAAGATTCTGATTTTTGGGCTCCTGGAGGAGACAGCA
CTGGCGGCCTTTCTGTCTTACTGCCCGGGCATGGGCGTGGCTCTCCGAATGTACCCGCTC
AAGGTCACCTGGTGGTTCTGCGCCTTCCCCTACAGTCTCCTTATCTTCATCTACGATGAG
GTCCGAAAGCTGATCCTGCGGCGATATCCGGGTGGCTGGGTGGAGAAGGAGACCTACTAC
TGA
Enzyme 14 GenBank Gene ID BC133297 Link Image
Enzyme 14 GeneCard ID ATP1A2 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 1q21-q23
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 163
Enzyme 15 Name Ectonucleoside triphosphate diphosphohydrolase 1
Enzyme 15 Synonyms
  1. NTPDase 1
  2. Ecto-ATP diphosphohydrolase
  3. ATPDase
  4. Lymphoid cell activation antigen
  5. Ecto-apyrase
  6. CD39 antigen
Enzyme 15 Gene Name ENTPD1
Enzyme 15 Protein Sequence >Ectonucleoside triphosphate diphosphohydrolase 1
MEDRRESELKVFCSKNILSILGFSCIIAVIALLALGLTQNKALPENVKFGIVLDAGSSHT
SLYIYRWPAEKENDTGVVTQIEESNVKGPGISGFAKKVNEINVYLTACMERAQKVIPSIQ
HMETPVYLGATAGMRLLRMENKQMADKILAAVASSISEYPFDFQGARIISGQEEGAYGWI
TVNYLLGKFTQKLSWFNLKPSKDDTQETYGALDLGGASTQITFVPQNETTESPNNNLYFR
LYGKNYSVYTHSFLCYGKDQALLQKLALGLQGTNGIIHEPCFHSRYMRKIKMSVLNEGFC
TKRHELNSSFYPLVDIEIRGAGNFQRCRQSIIQLFNTSYCPYSSCSFNGVFLPPLHGQFG
AFSAFYYVMEFLNLTSEESVSVEQLTEKLEEFCAQRWEEVQKNFGEVKEKYLSEYCFSGT
YILVLLLNGYHFTAESWKNIHFMNKVRSTDVGWTLGYMLNLTNKIPAEEPMSPPLPHSTY
VFLMVLFSLILLAVIIVGIVVFHKPSYFWKDMV
Enzyme 15 Number of Residues 513
Enzyme 15 Molecular Weight 58113.4
Enzyme 15 Theoretical pI 6.88
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Involved in ATP binding
Enzyme 15 Specific Function In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Could also be implicated in the prevention of platelet aggregation. Hydrolyzes ATP and ADP equally well
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • 17-37 482-502
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 2240205 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID O18956 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name ENTP1_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1542 bp
ATGGAAGATAGAAGGGAATCTGAACTGAAGGTATTTTGCTCTAAAAACATACTGAGCATA
CTTGGTTTCTCCTGCATCATCGCTGTGATAGCATTGCTCGCTCTGGGGCTGACCCAGAAC
AAAGCACTGCCAGAAAATGTTAAGTTTGGGATTGTGCTGGATGCGGGCTCCTCTCATACG
AGTTTGTACATCTATAGATGGCCGGCAGAGAAGGAGAATGACACGGGGGTGGTGACTCAG
ATAGAAGAATCGAACGTTAAAGGTCCCGGAATCTCAGGCTTTGCTAAAAAAGTAAATGAA
ATCAATGTTTATCTGACGGCATGCATGGAAAGAGCCCAGAAAGTGATTCCGTCAATCCAG
CACATGGAAACACCTGTGTACCTGGGAGCCACGGCCGGCATGCGGTTGCTCCGGATGGAA
AATAAACAGATGGCAGACAAGATCCTGGCTGCAGTTGCAAGCAGCATCAGCGAGTACCCC
TTTGACTTCCAAGGTGCCAGAATCATCAGTGGCCAGGAGGAAGGTGCCTATGGCTGGATT
ACTGTCAACTATTTGCTGGGCAAATTCACTCAGAAATTGAGTTGGTTTAACCTGAAGCCA
AGCAAAGACGACACTCAGGAAACCTATGGAGCTTTAGACCTTGGGGGAGCCTCTACACAA
ATCACTTTTGTGCCCCAAAATGAAACGACCGAGTCTCCAAACAACAACCTGTACTTCCGC
CTCTATGGCAAGAACTACAGTGTATACACACACAGCTTCCTGTGCTATGGGAAGGACCAA
GCACTTTTGCAGAAACTGGCCCTGGGACTTCAGGGTACAAATGGAATCATCCATGAGCCA
TGCTTTCACTCAAGATACATGAGGAAAATAAAGATGAGCGTCTTAAACGAAGGTTTCTGT
ACCAAGAGACATGAGTTGAATTCTTCATTTTATCCACTCGTTGACATTGAAATCCGTGGC
GCTGGAAACTTCCAACGATGTCGGCAAAGCATCATTCAACTCTTTAACACCAGTTACTGC
CCTTACTCCAGTTGCTCCTTCAATGGGGTTTTCTTGCCGCCACTCCATGGGCAGTTTGGG
GCATTTTCAGCTTTTTACTATGTGATGGAGTTTTTAAACCTTACATCAGAGGAATCAGTA
TCTGTGGAACAGTTGACTGAGAAGTTGGAAGAGTTCTGCGCACAGCGTTGGGAAGAGGTG
CAGAAGAATTTTGGTGAAGTGAAGGAGAAATACCTGAGTGAATACTGCTTTTCTGGCACC
TACATCCTGGTTCTCCTCCTGAATGGCTACCATTTTACAGCTGAGTCCTGGAAAAATATT
CACTTCATGAACAAGGTCCGGAGCACCGACGTTGGGTGGACTTTGGGCTACATGCTGAAC
CTGACCAACAAGATTCCAGCTGAAGAGCCAATGTCCCCACCCCTCCCCCACTCCACCTAT
GTCTTCCTCATGGTCCTCTTCTCCCTGATCCTGCTCGCAGTGATCATCGTAGGCATAGTT
GTCTTTCACAAGCCTTCGTATTTCTGGAAAGACATGGTATAG
Enzyme 15 GenBank Gene ID AF005940 Link Image
Enzyme 15 GeneCard ID ENTPD1 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:1
Enzyme 15 Locus 10q24
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 174
Enzyme 16 Name S-adenosylmethionine synthetase
Enzyme 16 Synonyms Not Available
Enzyme 16 Gene Name MAT2A
Enzyme 16 Protein Sequence >S-adenosylmethionine synthetase
MNGQLNGFHDAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVA
KTGMILLAGEITSRAAVDYQKVVRETIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQG
VHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDS
KTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDT
IYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPGVI
VRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY
Enzyme 16 Number of Residues 395
Enzyme 16 Molecular Weight 43690.4
Enzyme 16 Theoretical pI 6.45
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Coenzyme transport and metabolism
Enzyme 16 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 16 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 152941174 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID A7E3T7 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name A7E3T7_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >1188 bp
ATGAACGGGCAGCTCAACGGCTTCCACGACGCGTTCATCGAGGAGGGCACGTTCCTCTTT
ACCTCCGAGTCCGTGGGGGAAGGCCACCCAGATAAGATCTGTGACCAGATCAGTGATGCT
GTCCTTGATGCCCACCTTCAGCAGGACCCTGATGCCAAAGTGGCTTGTGAAACTGTTGCT
AAGACTGGAATGATCCTTCTTGCTGGGGAAATTACATCCAGAGCTGCTGTTGACTACCAG
AAAGTGGTTCGTGAAACCATTAAACACATTGGATATGACGATTCTTCCAAAGGGTTTGAC
TACAAGACATGTAATGTGCTAGTGGCCTTGGAGCAACAGTCACCAGATATTGCCCAAGGT
GTTCATCTTGACCGAAACGAGGAAGACATTGGTGCAGGAGACCAGGGTTTGATGTTTGGT
TATGCCACTGATGAAACTGAGGAATGTATGCCTTTAACCATTGTCTTAGCACACAAGCTC
AATGCCAAACTGGCTGAACTGCGCCGGAATGGCACTTTGCCTTGGTTACGCCCTGATTCT
AAAACTCAAGTGACTGTGCAGTATATGCAGGATCGAGGTGCCGTACTTCCCATCAGAGTC
CACACAATTGTTATATCTGTTCAGCATGATGAAGAAGTTTGTCTTGATGAGATGAGAGAT
GCTCTGAAGGAGAAAGTCATCAAAGCTGTTGTACCTGCAAAGTACCTTGATGAGGACACA
ATCTATCATCTACAGCCAAGTGGCAGATTTGTTATTGGTGGGCCTCAGGGTGATGCTGGT
TTGACTGGCCGGAAAATCATTGTGGACACTTACGGTGGTTGGGGAGCTCATGGAGGAGGT
GCCTTTTCAGGAAAGGATTATACCAAGGTGGACCGTTCAGCTGCTTATGCTGCTCGTTGG
GTGGCAAAATCCCTTGTTAAAGGAGGTCTGTGCAGAAGGGTTCTTGTTCAGGTCTCTTAT
GCTATTGGAGTATCTCATCCATTGTCTATCTCCATTTTCCATTATGGCACCTCTCAGAAG
AGTGAGAGAGAGCTATTAGAGATTGTGAAGAAGAATTTTGACCTCCGCCCTGGGGTCATT
GTCAGGGATCTGGATCTGAAGAAGCCAATTTATCAGAGGACTGCAGCCTATGGCCACTTT
GGTAGGGACAGCTTCCCATGGGAAGTGCCCAAAAAGCTTAAATATTGA
Enzyme 16 GenBank Gene ID BT030708 Link Image
Enzyme 16 GeneCard ID MAT2A Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:2
Enzyme 16 Locus 2p11.2
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 175
Enzyme 17 Name ATP-citrate synthase
Enzyme 17 Synonyms
  1. ATP-citrate (pro-S-)-lyase
  2. Citrate cleavage enzyme
Enzyme 17 Gene Name ACLY
Enzyme 17 Protein Sequence >ATP-citrate synthase
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLIGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHTQEEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRTDEVAPAKKAKPAMLQGKSA
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILI
PVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLI
KKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNEL
NNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTAGVKMIVVLGEIGGTEEYKICRG
VTEGRITKPVVCWCIGTCAAMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSF
DELGEIIQSVYEDLVARGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQ
ELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNT
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLI
MGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIG
VAFVDMLRHCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDD
ISYVLPEHMSM
Enzyme 17 Number of Residues 1091
Enzyme 17 Molecular Weight 119788.1
Enzyme 17 Theoretical pI 7.25
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Energy production and conversion
Enzyme 17 Specific Function ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 79158721 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q32PF2 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name ACLY_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >3276 bp
ATGTCGGCCAAGGCGATTTCTGAGCAGACAGGCAAAGAGCTCCTCTACAAGTACATCTGC
ACCACCTCGGCCATCCAGAACCGCTTCAAGTATGCCCGGGTCACCCCTGACACAGACTGG
GCCCGCCTGTTGCAGGACCACCCGTGGCTGCTCAGCCAGAGCTTGGTGGTCAAGCCAGAC
CAGCTGATCAAACGGCGTGGAAAGCTGGGCCTAATTGGGGTCAACCTCACTCTGGATGGA
GTCAAGTCCTGGCTGAAGCCACGCCTGGGACAGGAAGCTACAGTTGGCAAGGCCACAGGC
TTCCTCAAGAACTTCCTGATCGAACCCTTCGTCCCCCACACTCAGGAGGAAGAGTTCTAC
GTCTGCATCTATGCTACCCGAGAAGGGGACTATGTCCTGTTCCACCACGAGGGTGGGGTG
GACGTGGGCGACGTGGATGCTAAAGCCCAGAAACTACTTGTCGGCGTCGATGAGAAGCTG
AATCCTGAGGACATCAAGAAACACCTGCTGGTCCACGCCCCCGAAGACAAGAAAGAAATT
CTGGCCAGCTTTATCTCCGGCCTCTTCAATTTCTATGAGGATCTGTACTTCACCTACCTC
GAGATCAACCCCCTTGTCGTGACCAAAGATGGCGTCTACGTCCTTGACTTGGCCGCCAAG
GTGGATGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATAGAGTTCCCACCC
CCCTTCGGACGGGAGGCTTACCCAGAGGAAGCCTACATCGCAGATCTGGACGCCAAAAGT
GGGGCAAGCTTGAAGCTGACTTTACTGAATCCCAAGGGGAGAATCTGGACCATGGTGGCC
GGAGGGGGTGCCTCTGTCGTGTACAGTGACACCATCTGCGACCTGGGGGGTGTCAACGAG
CTGGCAAACTACGGGGAGTACTCGGGCGCCCCCAGCGAGCAGCAGACCTATGACTACGCC
AAGACGATCCTCTCCCTTATGACCCGCGAGAAGCACCCAGATGGCAAGATCCTCATCATC
GGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACATTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGTCCCCTGAAGGAGCACGAGGTCACGATCTTTGTCCGAAGAGGT
GGCCCCAACTATCAGGAGGGCTTACGGGTCATGGGAGAAGTCGGGAAGACCACTGGGATC
CCCATCCATGTCTTCGGCACTGAGACTCACATGACGGCCATCGTGGGCATGGCCCTGGGC
CATCGGCCCATCCCCAATCAGCCGCCCACAGCGGCCCACACCGCAAACTTCCTCCTCAAC
GCCAGCGGGAGTACTTCAACTCCAGCCCCCAGCAGGACGGCATCTTTTTCTGAGTCCAGA
ACTGATGAGGTGGCCCCTGCCAAGAAGGCCAAGCCTGCCATGCTCCAAGGAAAGAGCGCC
ACCCTCTTCAGCCGCCACACCAAGGCCATCGTGTGGGGCATGCAGACCCGGGCTGTGCAG
GGCATGCTGGACTTCGACTACGTCTGCTCCCGCGACGAGCCCTCAGTGGCTGCCATGGTC
TACCCGTTCACTGGGGACCACAAACAGAAGTTTTACTGGGGTCACAAGGAGATCCTGATC
CCCGTCTTTAAGAACATGGCTGATGCCATGAAGAAGCACCCAGAGGTAGACGTGCTAATC
AACTTTGCCTCCCTGCGCTCAGCCTACGACAGCACCATGGAGACCATGAATTACGCTCAG
ATCCGGACCATCGCCATCATAGCCGAAGGCATCCCTGAGGCGCTCACGAGGAAGCTGATC
AAGAAGGCAGACCAGAAGGGAGTGACCATCATTGGACCTGCCACCGTTGGTGGCATCAAG
CCCGGGTGCTTTAAGATCGGGAACACCGGCGGGATGCTGGACAACATCCTGGCCTCTAAG
CTGTACCGCCCAGGCAGTGTGGCCTATGTCTCGCGTTCGGGTGGCATGTCCAACGAGCTC
AACAATATCATCTCTCGAACCACAGATGGCGTCTACGAGGGCGTGGCCATTGGTGGGGAC
AGGTACCCCGGCTCAACGTTTATGGATCACGTGTTACGTTATCAGGACACTGCAGGAGTC
AAAATGATTGTGGTTCTTGGAGAGATAGGGGGCACAGAGGAGTATAAGATCTGCCGGGGC
GTCACGGAGGGCCGCATCACCAAGCCCGTGGTCTGCTGGTGCATCGGGACCTGTGCGGCC
ATGTTCTCCTCCGAGGTCCAGTTCGGCCACGCTGGAGCTTGTGCCAACCAGGCTTCTGAA
ACCGCAGTTGCCAAGAACCAGGCCTTGAAGGAGGCTGGAGTGTTTGTGCCCCGGAGCTTC
GATGAGCTTGGAGAAATCATCCAGTCCGTGTACGAGGATCTCGTGGCCAGAGGAGTCATT
GTGCCTGCTCAGGAGGTTCCGCCCCCCACAGTACCCATGGACTACTCTTGGGCCCGGGAA
TTGGGCTTGATCCGCAAACCTGCCTCGTTCATGACCAGCATCTGTGACGAGCGAGGACAG
GAGCTCATCTACGCGGGCATGCCCATCACTGAGGTCTTCAAGGAGGAGATGGGCATTGGC
GGGGTCCTCGGCCTCCTCTGGTTCCAGAAAAGGTTGCCCAAATACTCCTGCCAGTTCATT
GAGATGTGCCTGATGGTGACGGCTGATCACGGGCCTGCCGTCTCTGGGGCTCATAACACC
ATCATCTGCGCTCGAGCCGGCAAGGACCTCGTCTCCAGCCTCACCTCGGGACTGCTTACC
ATTGGCGACCGGTTTGGGGGTGCCCTGGATGCAGCAGCCAAGATGTTCAGCAAGGCCTTT
GACAGTGGTATCATCCCCATGGAGTTTGTGAACAAGATGAAGAAGGAAGGAAAGCTTATC
ATGGGCATTGGTCACCGAGTGAAGTCGATCAACAACCCAGACATGCGCGTGCAGATTCTC
AAAGATTATGTCAGACAACACTTCCCTGCCACCCCACTGCTCGACTACGCACTGGAAGTA
GAGAAGATTACCACTTCCAAGAAACCAAACCTTATCCTGAATGTGGACGGTTTAATCGGA
GTTGCATTTGTAGACATGCTTAGACACTGCGGGTCCTTCACTCGGGAGGAAGCTGATGAA
TATATTGACATTGGAGCCCTCAACGGCATCTTTGTGCTGGGAAGGAGCATGGGCTTCATT
GGACACTATCTTGATCAGAAGAGGCTGAAGCAGGGGCTCTACCGTCACCCATGGGATGAT
ATTTCATATGTTCTTCCGGAACACATGAGCATGTAA
Enzyme 17 GenBank Gene ID BC108138 Link Image
Enzyme 17 GeneCard ID ACLY Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 17q12-q21
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 176
Enzyme 18 Name Fructose-1,6-bisphosphatase 1
Enzyme 18 Synonyms
  1. FBPase 1
  2. D-fructose-1,6-bisphosphate 1-phosphohydrolase 1
Enzyme 18 Gene Name FBP1
Enzyme 18 Protein Sequence >Fructose-1,6-bisphosphatase 1
MTDQAAFDTNIVTVTRFVMEEGRKARGTGEMTQLLNSLCTAVKAISTAVRKAGIAHLYGI
AGTTNVTGDQVKKLDVLSNDLVVNVLKSSFATCVLVSEEDEHAIIVEPEKRGKYVVCFDP
LDGSSNIDCLVSIGTIFGIYKKISKDDPSEKDALQPGRNLVAAGYALYGSATMLVLAMAN
GVNCFMLDPAIGEFILVDRDVKIKKKGSIYSLNEGYAKDFDPALTEYVQRKKFPPDNSAP
YGARYVGSMVADVHRTLVYGGIFMYPANKKSPSGKLRLLYECNPMAYVIEKAGGMATTGK
ETVLDIVPTDIHQKSPIILGSPEDVTEFLEIYKKHAAK
Enzyme 18 Number of Residues 338
Enzyme 18 Molecular Weight 36728.0
Enzyme 18 Theoretical pI 7.01
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Carbohydrate transport and metabolism
Enzyme 18 Specific Function D-fructose 1,6-bisphosphate + H(2)O = D- fructose 6-phosphate + phosphate
Enzyme 18 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 74354240 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q3SZB7 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name F16P1_BOVIN Link Image
Enzyme 18 PDB ID 1NV7 Link Image
Enzyme 18 PDB File Show
Enzyme 18 3D Structure
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >1017 bp
ATGACGGACCAGGCAGCCTTCGACACCAATATCGTCACCGTGACCCGCTTCGTCATGGAA
GAGGGCAGGAAGGCCCGTGGCACGGGCGAGATGACCCAACTGCTCAACTCGCTTTGCACC
GCGGTCAAAGCCATCTCCACGGCCGTGCGCAAGGCGGGCATCGCGCACCTCTATGGAATT
GCTGGCACTACCAATGTGACGGGAGATCAAGTGAAGAAGCTGGATGTCCTCTCCAATGAC
CTGGTTGTTAATGTGTTAAAGTCATCTTTTGCTACCTGTGTTCTTGTGTCAGAAGAAGAT
GAACATGCCATAATAGTAGAACCTGAGAAAAGGGGTAAATATGTGGTCTGTTTTGATCCC
CTTGATGGATCATCCAACATCGACTGCCTTGTGTCCATTGGAACCATCTTTGGCATCTAC
AAAAAGATTTCGAAAGATGACCCTTCTGAGAAGGACGCTCTGCAGCCAGGCCGGAACCTG
GTGGCTGCTGGCTATGCGCTCTATGGCAGTGCCACTATGTTGGTCCTGGCCATGGCGAAT
GGAGTCAACTGCTTCATGCTGGACCCGGCCATTGGAGAGTTCATTTTGGTGGACAGGGAT
GTGAAGATCAAAAAGAAAGGGAGCATCTATAGCCTCAATGAAGGCTATGCGAAGGACTTT
GATCCTGCCCTCACCGAGTATGTCCAGAGGAAGAAGTTCCCCCCAGACAACTCAGCCCCC
TATGGCGCCAGGTACGTGGGCTCCATGGTAGCCGATGTACACCGCACCCTAGTCTATGGA
GGGATCTTTATGTATCCAGCTAACAAGAAAAGCCCCAGTGGAAAGCTGAGACTACTGTAT
GAATGTAACCCCATGGCCTATGTCATAGAGAAGGCAGGAGGAATGGCTACCACCGGGAAG
GAAACTGTGCTGGACATTGTTCCCACTGACATCCATCAGAAGTCGCCCATCATCTTGGGG
TCTCCTGAAGATGTGACTGAGTTCCTGGAGATATACAAGAAGCATGCTGCCAAATGA
Enzyme 18 GenBank Gene ID BC102974 Link Image
Enzyme 18 GeneCard ID FBP1 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:9
Enzyme 18 Locus 9q22.3
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References Not Available
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 185
Enzyme 19 Name Activated CDC42 kinase 1
Enzyme 19 Synonyms
  1. ACK-1
  2. Tyrosine kinase non-receptor protein 2
  3. Activated CDC42 kinase 2
Enzyme 19 Gene Name TNK2
Enzyme 19 Protein Sequence >Activated CDC42 kinase 1
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPTPGGSAGEGSLQSLTCL
IGEKDLHLFEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKTVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLEAKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
KIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKKPTYDPVSEDQDPLSSDFKRLGLRKP
GLPRGLWLAKPSARVPGTKAGRGGGEVTLIDFGEEPVVPAPRPCAPSLAQLAMDACSLLD
KTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDDFEVCSINSTLVGAGVSA
EPSQGETNYAFVPEPARLLPPLEDNLFLPPQSGGKPPNSAQTAEIFQALQQECMRQLQVP
PGSLVPSPSPGGDDKPQVPPRVPIPPRPTRSRGELSPVPPGEEEMGRWPGPASPPRVPPR
EPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAG
PCILPIVRDGKKVSSTHYYLLPERPPYLERYQRFLHEAQSPRGPDPTPIPLLLPPPSTPA
PAAPTATVRPMPQAAPDPKANFSSNNSNPGARPSSLRATARLPQRGYPGDGPEAGRPADK
IQMLQAMVHGVTTEECQAALQSHSWSVQRAAQYLKVEQLFGLGLRPRGECHNVLEMFDWN
LEQAGCHLLGSCGPAHHKR
Enzyme 19 Number of Residues 1039
Enzyme 19 Molecular Weight 114866.9
Enzyme 19 Theoretical pI 7.38
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Involved in ATP binding
Enzyme 19 Specific Function Downstream effector of CDC42 which mediates CDC42- dependent cell migration via phosphorylation of BCAR1. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR. Participates in clathrin-mediated endocytosis. May be involved both in adult synaptic function and plasticity and in brain development
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 2078388 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q17R13 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name ACK1_BOVIN Link Image
Enzyme 19 PDB ID 1U54 Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >2244 bp
ATGCAGCCAGAGGAGGGCACAGGCTGGCTGCTAGAGCTGCTGTCCGAGGTGCAGCTCCAG
CAGTATTTCCTGCGCCTCCGCGACGACCTCAACGTCACCCGCCTGTCCCACTTTGAGTAT
GTCAAGAACGAGGACCTGGAGAAGATCGGCATGGGCCGGCCCGGCCAGCGGCGGCTATGG
GAGGCCGTGAAGAGGAGGAAGGCCATGTGCAAACGCAAGTCCTGGATGAGCAAGGTGTTC
AGTGGAAAGCGGCTGGAGGCTGAGTTCCCCCCTCATCACTCTCAGAGCACCTTCCGGAAG
ACCTCGCCCACCCCAGGGGGCTCTGCTGGGGAGGGGTCCCTGCAGAGCCTCACCTGCCTC
ATTGGGGAGAAGGACCTGCATCTCTTCGAGAAGCTGGGAGATGGCTCCTTTGGCGTGGTG
CGCAGGGGCGAGTGGGACGCCCCCTCGGGGAAGACGGTGAGCGTGGCTGTGAAGTGCCTG
AAGCCCGACGTGCTGAGCCAGCCGGAGGCCATGGACGACTTCATCCGGGAGGTCAACGCC
ATGCACTCGCTTGACCACCGAAACCTCATTCGCCTCTACGGGGTGGTGCTCACACCGCCC
ATGAAGATGGTGACAGAGCTGGCACCTCTGGGATCATTGTTGGACCGGCTGCGCAAGCAC
CAGGGCCACTTCCTGCTGGGCACCCTGAGCCGCTACGCTGTGCAGGTGGCTGAGGGCATG
GGCTACCTGGAGGCCAAGCGCTTCATCCACCGGGACCTGGCCGCCCGAAATCTGCTGTTG
GCCACCCGCGACCTGGTCAAGATAGGGGACTTCGGGCTGATGCGAGCACTGCCCCAGAAC
GACGACCACTACGTCATGCAGGAACATCGCAAGGTGCCCTTTGCCTGGTGTGCCCCAGAG
AGCCTGAAGACACGCACCTTCTCCCACGCCAGCGACACCTGGATGTTTGGGGTCACGCTG
TGGGAGATGTTCACCTATGGCCAGGAGCCCTGGATTGGCCTCAATGGCAGTCAGATCCTG
CATAAGATTGACAAGGAGGGGGAGCGTCTACCCCGGCCGGAGGACTGCCCCCAGGACATC
TACAATGTCATGGTCCAGTGCTGGGCTCACAAGCCCGAGGACAGACCCACGTTTGTGGCC
CTGCGGGACTTCCTGCTGGAGGCTCAGCCCACCGACATGCGGGCCCTTCAGGACTTCGAA
GAACCTGACAAGCTGCACATCCAGATGAATGATGTCATCACCGTCATCGAGGGGAGGGCT
GAGAATTACTGGTGGCGTGGGCAGAACACGCGGACGCTGTGCGTGGGGCCCTTCCCTCGC
AACGTGGTGACCTCCGTGGCTGGTCTGTCAGCCCAGGACATCAGCCAGCCACTGCAGAAT
AGCTTCATCCACACGGGGCATGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCTGAC
AAGATTGATGAACTGTATCTGGGAAACCCCATGGACCCTCCTGACCTGCTGAGCGTGGAA
CTGAGCACATCCAGGCCCACCCAGCATCTGGGCAGGGTGAAAAGGGAGCCTCCACCTCGC
CCTCCTCAGCCTGCCATCTTCACTCAGAAACCAACCTACGACCCCGTGAGTGAGGACCAA
GACCCCCTGTCCAGCGACTTCAAGAAGCTGGGCCTGCGAAAGCCAGGACTGCCCCGTGGG
CTGTGGCTCGCGAAGCCCTCAGCCCGGGTGCCAGGCACCAAGGCCGGCCGCGGTGGTGGC
GAGGTCACGCTCATCGATTTCGGCGAGGAGCCTGTTGTGCCGGCCCCACGGCCCTGTGCC
CCATCACTGGCGCAGCTGGCCATGGACGCCTGTTCCTTGCTGGACAAGACCCCGCCACAG
AGCCCTACACGGGCCCTGCCCCGGCCCCTGCATCCCACGCCTGTGGTGGACTGGGATGCA
CGCCCACTGCCCCCGCCTCCCGCCTACGATGACGTGGCCCAGGATGAGGATGACTTCGAG
GTCTGCTCCATCAACAGCACCCTCGTGGGCGCCGGGGTCTCTGCTGAGCCCAGCCAGGGC
GAGACCAACTATGCCTTTGTGCCTGAGCCGGCGAGGCTCCTCCCCCCCGCTGGAGGACAA
CCTGTTCCTCCCACCCCAGAGTGGGGGCAAGCCACCCAACTCGGCCCAAACCGCAGAGAT
CTTCCAGGCGCTGCAGCAGGAATGCATGCGGCAGCTACAGGTCCCGCCTGGCTCTCTGGT
CCCCTCACCCAGCCCTGGGGGTGA
Enzyme 19 GenBank Gene ID U96722 Link Image
Enzyme 19 GeneCard ID TNK2 Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:3
Enzyme 19 Locus 3q29
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References
  1. [PubMed Link Image]
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 194
Enzyme 20 Name Eyes absent homolog 2
Enzyme 20 Synonyms Not Available
Enzyme 20 Gene Name EYA2
Enzyme 20 Protein Sequence >Eyes absent homolog 2
MLELLVSASLTVNSDRPGKLKPSRADADVWTLSDREGITTSARSVSQLFARPCPRVPPGQ
PPSAMAAYSQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGS
SFSTPASGQSPYTYQMHGTAGIYQGANGLTNAAGFGTVHQDYPSYPGFPQSQYSQYYSSS
YNPPYVPASSICPSPLSTSTYVLQEASHNIPSQSSESLGGEYNTHNGPSTPAKEGDTDRP
PRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTAS
VRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPG
ANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGAPKRETWLQLRAELEALT
DLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKE
SCFERIMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Enzyme 20 Number of Residues 537
Enzyme 20 Molecular Weight 58806.0
Enzyme 20 Theoretical pI 6.15
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Involved in magnesium ion binding
Enzyme 20 Specific Function Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Coactivates SIX1. Seems to coactivate SIX2, SIX4 and SIX5. Together with SIX1 and DACH2 seem to be involved in myogenesis. May be involved in development of the eye. Interaction with GNAZ and GNAI2 prevents nuclear translocation and transcriptional activity
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 61554261 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q58DB6 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name EYA2_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >1614 bp
ATGCTAGAACTACTGGTCTCAGCCAGCCTTACTGTAAACAGTGATCGTCCGGGTAAACTG
AAGCCTAGCCGTGCTGATGCTGATGTCTGGACTCTGAGTGACAGAGAAGGCATCACCACA
TCGGCTCGGAGTGTGTCCCAGCTCTTTGCAAGACCTTGCCCGCGTGTCCCACCTGGTCAG
CCTCCCTCGGCCATGGCAGCCTACAGCCAGACACAGTACAGTGCAGGGATCCAGCAAGCT
ACCCCCTACACGGCTTACCCGCCTCCAGCACAAGCCTATGGAATCCCTTCTTACAGCATC
AAGACAGAAGACAGCTTGAACCATTCCCCCGGCCAGAGTGGCTTCCTCAGCTATGGCTCC
AGCTTCAGCACCCCAGCCTCTGGACAGAGCCCGTACACCTACCAGATGCATGGCACGGCC
GGGATCTATCAAGGAGCAAATGGACTGACCAACGCGGCCGGATTCGGAACTGTGCACCAG
GACTATCCTTCCTACCCCGGCTTCCCGCAGAGCCAGTACTCCCAGTATTACAGCTCGTCC
TACAACCCTCCTTACGTCCCAGCCAGCAGCATCTGCCCTTCTCCTCTCTCCACGTCCACC
TACGTCCTCCAAGAGGCATCTCACAACATCCCCAGCCAGAGTTCCGAGTCGCTTGGCGGT
GAATATAACACACACAATGGACCTTCCACACCGGCAAAGGAGGGAGACACAGACAGGCCA
CCCCGGGCCTCCGACGGGAAGCTCCGAGGCCGGTCTAAGCGGAGCAGCGACCCCTCCCCA
GCAGGGGACAATGAGATCGAGCGTGTGTTCGTGTGGGACCTGGATGAGACGATAATTATT
TTCCACTCCTTACTCACGGGGACTTTCGCCTCCAGGTACGGGAAGGACACCACGGCGTCC
GTGCGCATCGGCCTCATGATGGAGGAAATGATCTTCAACCTCGCAGACACACATCTGTTC
TTCAATGACCTGGAGGATTGTGACCAGATCCACGTGGACGATGTCTCATCTGATGACAAT
GGGCAAGATTTAAGCACCTACAACTTCTCCGCCGATGGCTTCCACAGTTCGGCCCCGGGA
GCCAACCTGTGCCTGGGCTCCGGCGTGCACGGCGGCGTGGACTGGATGAGGAAGCTGGCC
TTCCGCTACCGGCGGGTGAAGGAGATGTACAACACCTACAAGAACAACGTCGGCGGCTTG
ATAGGAGCTCCCAAAAGAGAGACCTGGCTACAGCTCAGAGCCGAGCTGGAAGCTCTGACT
GACCTCTGGCTGACCCACTCTCTGAAGGCACTAAACCTCATCAATTCCCGGCCCAATTGT
GTCAACGTGCTGGTCACCACCACTCAACTAATTCCTGCCCTGGCCAAAGTCCTGCTGTAC
GGATTGGGTTCTGTGTTTCCTATTGAGAACATCTACAGTGCAACCAAGACAGGGAAGGAG
AGCTGCTTCGAGAGGATAATGCAGAGGTTTGGCAGAAAGGCCGTCTACATCGTGATCGGC
GATGGAGTGGAAGAGGAGCAGGGAGCCAAAAAGCACAACATGCCTTTCTGGAGGATATCC
TGCCACGCAGACCTGGAGGCGCTGAGGCACGCCCTGGAGCTGGAGTATTTATAG
Enzyme 20 GenBank Gene ID BT021681 Link Image
Enzyme 20 GeneCard ID EYA2 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:2
Enzyme 20 Locus 20q13.1
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 195
Enzyme 21 Name 3'(2'),5'-bisphosphate nucleotidase 1
Enzyme 21 Synonyms
  1. Bisphosphate 3'-nucleotidase 1
Enzyme 21 Gene Name BPNT1
Enzyme 21 Protein Sequence >3'(2'),5'-bisphosphate nucleotidase 1
MASSPTVLMRLVASAYSIAQKAGTIVRRVIAEGDLGIIEKTCATDLQTKADRLVQVSICS
SLARKFPKLTIIGEEDLPPEDVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEAPAGKHIITTTRSHNSQLVTDCITAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPQ
SVKNALVP
Enzyme 21 Number of Residues 308
Enzyme 21 Molecular Weight 33327.9
Enzyme 21 Theoretical pI 5.19
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Carbohydrate transport and metabolism
Enzyme 21 Specific Function Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 152941250 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID Q3ZCK3 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name BPNT1_BOVIN Link Image
Enzyme 21 PDB ID 1JP4 Link Image
Enzyme 21 PDB File Show
Enzyme 21 3D Structure
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >927 bp
ATGGCATCCAGTCCCACTGTGTTGATGCGGTTGGTGGCTTCAGCATATTCTATTGCTCAA
AAGGCAGGAACGATAGTCAGGCGTGTTATCGCCGAAGGAGACCTGGGTATCATTGAGAAG
ACCTGTGCAACAGACCTGCAGACCAAGGCTGACCGATTAGTTCAAGTGAGCATATGTTCT
TCATTGGCACGGAAGTTCCCCAAACTAACAATTATAGGGGAAGAGGATCTGCCTCCTGAA
GACGTGGATCAAGAGCTGATTGAAGATGGTCAGTGGGAGGAGATACTGAAGCAGCCGTGC
CCATCACAGTACAGTGCTATCAAGGAGGAAGATCTTGTGGTCTGGGTTGATCCTCTGGAT
GGGACCAAGGAATATACTGAAGGTCTTCTTGACAATGTAACAGTACTTATTGGAATTGCT
TATGAAGGAAAAGCCATAGCAGGAGTTATTAACCAGCCATATTACAACTACCAGGCAGGA
CCAGATGCTGTGCTGGGGAGAACTATCTGGGGAGTTTTGGGTTTAGGTGCCTTCGGGTTT
CAGCTGAAAGAAGCGCCCGCCGGCAAACACATCATCACAACAACCCGGTCCCATAACAGC
CAGTTGGTTACGGACTGCATCACTGCTATGAACCCTGATGATGTGCTGAGAGTGGGAGGA
GCAGGAAATAAGATAATTCAGCTGATTGAAGGCAAAGCCTCTGCTTATGTATTTGCAAGT
CCAGGATGCAAGAAGTGGGACACCTGTGCTCCAGAAGTCATTTTACATGCTGTCGGAGGC
AAGTTAACCGATATCCATGGAAATGCTCTTCAGTATAACAAGGAAGTGAAGCACATGAAC
TCGGCCGGAGTCCTGGCCACACTGAGGAATTATGACTATTATGCAAGTCGAGTCCCCCAG
TCTGTTAAAAATGCCCTTGTTCCTTGA
Enzyme 21 GenBank Gene ID BT030746 Link Image
Enzyme 21 GeneCard ID BPNT1 Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:1
Enzyme 21 Locus 1q41
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References
  1. [PubMed Link Image]
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 196
Enzyme 22 Name Probable phospholipid-transporting ATPase IA
Enzyme 22 Synonyms
  1. Chromaffin granule ATPase II
  2. ATPase class I type 8A member 1
Enzyme 22 Gene Name ATP8A1
Enzyme 22 Protein Sequence >Probable phospholipid-transporting ATPase IA
MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEIRTIFINQPQLTKFCNNHVSTAKYN
IITFLPRFLYSQFRRAANSFFLFIALLQQIPDVSPTGRYTTLVPLLFILAVAAIKEIIED
IKRHKADNAVNKKQTQVLRNGAWEIVHWEKVNVGDIVIIKGKEYIPADTVLLSSSEPQAM
CYIETSNLDGETNLKIRQGLPATSDIKDIDSLMRLSGRIECESPNRHLYDFVGNIRLDGR
STVPLGADQILLRGAQLRNTQWVHGIVVYTGHDTKLMQNSTSPPLKLSNVERITNVQILI
LFCILIAMSLVCSVGSAIWNRRHSGRDWYLNLNYGGANNFGLNFLTFIILFNNLIPISLL
VTLEVVKFTQAYFINWDLDMHYEPTDTAAMARTSNLNVELGQVKYIFSDKTGTLTCNVMQ
FKKCTIAGVAYGQNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPERE
GDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLNVLEFTSARKR
MSVIVRTPSGKLRLYCKGADTVIYDRLAETSKYKEITLKHLEQFATEGLRTLCFAVAEIS
ESDFQEWRAVYHRASTSVQNRLLKLEESYELIEKNLQLLGATAIEDKLQDQVPETIETLM
KADIKIWILTGDKQETAINIGHSCKLRRKNMGMIVINEGSLDGTRETLSRHCTTLGDALR
KENDFALIIDGKTLKYALTFGVRQYFLDLALSCKAVICCRVSPLQKSEVVEMVKKQVKVI
TLAIGDGANDVSMIQTAHVGVGISGNEGLQAANSSDYSIAQFKYLKNLLMVHGAWNYNRG
SKCILYCFYKNIVLYIIEIWFAFVNGFSGQILFERWCIGLYNVMFTAMPPLTLGIFERSC
RKEYMLKYPELYKTSQNALDFNTKVFWVHCLNGLFHSVILFWFPLKALQYGTVFENGRTS
DYLLLGNFVYTFVVITVCLKAGLETSYWTWFSHIAIWGSIALWVVFFGIYSSLWPAVPMA
PDMSGEAAMLFSSGVFWMGLLFIPVASLLLDVVYKVIKRTAFKTLVDEVQELEAKSQDPG
AVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVIRAYD
TTKQRPDEW
Enzyme 22 Number of Residues 1149
Enzyme 22 Molecular Weight 130024.9
Enzyme 22 Theoretical pI 7.58
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Inorganic ion transport and metabolism
Enzyme 22 Specific Function May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids, mainly in secretory vesicles
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • 66-86 93-115 298-319 345-366 843-863 876-895 926-947 962-984 991-1011 1030-1055
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 4115341 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID Q29449 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name AT8A1_BOVIN Link Image
Enzyme 22 PDB ID Not Available
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >3450 bp
ATGCCCACCATGCGGAGGACCGTGTCGGAGATCCGGTCCCGAGCCGAGGGTTATGAGAAG
ACTGATGATGTTTCAGAGAAGACGTCACTGGCTGACCAGGAAGAAATAAGGACTATATTC
ATCAACCAGCCTCAGCTGACAAAATTCTGCAATAACCATGTCAGCACTGCAAAATACAAC
ATAATCACATTCCTTCCAAGATTTCTCTACTCTCAGTTCAGAAGAGCCGCTAATTCATTT
TTTCTCTTTATTGCACTGCTCCAGCAAATACCTGATGTATCACCAACAGGTCGCTATACA
ACACTGGTTCCTCTCTTATTTATTTTGGCTGTGGCAGCTATCAAAGAGATAATAGAAGAT
ATTAAACGACATAAAGCTGATAATGCAGTAAACAAGAAGCAGACACAAGTTTTAAGAAAT
GGTGCTTGGGAAATTGTGCACTGGGAAAAGGTAAATGTTGGAGATATAGTTATAATAAAA
GGCAAAGAGTATATACCTGCTGACACTGTACTTCTCTCATCAAGTGAGCCCCAGGCCATG
TGTTACATTGAAACATCCAACTTAGATGGTGAAACAAACCTGAAAATTAGACAGGGCTTA
CCAGCAACATCAGATATAAAAGACATTGACAGTTTGATGAGACTGTCTGGCAGAATTGAG
TGTGAAAGTCCAAACAGACATCTCTATGATTTTGTTGGAAACATACGGCTTGATGGACGC
AGCACTGTTCCCCTGGGAGCAGACCAGATTCTTCTGCGAGGTGCTCAATTGAGAAATACA
CAGTGGGTTCATGGAATAGTTGTCTACACTGGACATGACACCAAGCTAATGCAGAACTCA
ACAAGTCCACCACTTAAACTCTCAAATGTCGAAAGGATTACAAATGTACAAATTTTGATT
TTATTTTGTATCTTGATTGCCATGTCTCTTGTCTGTTCTGTGGGCTCAGCCATTTGGAAT
CGAAGGCATTCTGGAAGGGACTGGTATCTCAATCTAAACTATGGTGGTGCTAATAATTTT
GGACTGAATTTCTTGACGTTCATCATCCTTTTCAATAACCTCATTCCTATCAGCTTGCTG
GTGACATTAGAAGTGGTGAAATTTACCCAGGCATACTTCATAAATTGGGATCTTGACATG
CACTATGAACCAACTGACACTGCTGCTATGGCTCGAACATCTAATCTGAATGTGGAACTT
GGCCAGGTGAAATATATATTTTCTGACAAAACTGGTACTTTGACATGCAATGTAATGCAG
TTTAAGAAGTGCACCATAGCCGGAGTGGCTTACGGGCAGAACTCACAGTTTGGAGATGAA
AAAACATTTAGTGATTCATCATTGCTGGAAAACCTCCAAAATAATCATCCCACTGCACCA
ATAATATGTGAATTTCTTACAATGATGGCCGTGTGTCACACGGCAGTACCAGAGCGGGAA
GGTGATAAGATAATTTACCAGGCAGCATCTCCAGATGAGGGAGCCTTGGTCAGAGCAGCC
AAGCAGTTGAATTTTGTTTTCACTGGAAGAACGCCTGACTCAGTGATTATAGATTCACTG
GGGCAGGAAGAAAGATATGAATTGCTCAATGTCTTGGAGTTCACCAGCGCTAGAAAAAGA
ATGTCAGTGATCGTTCGCACTCCATCCGGGAAGTTACGACTTTACTGCAAAGGAGCCGAC
ACTGTAATTTATGACCGACTGGCAGAAACTTCAAAATACAAAGAAATTACCCTAAAACAT
TTGGAGCAGTTTGCTACAGAAGGGTTAAGAACCTTGTGTTTTGCCGTGGCTGAGATTTCA
GAGAGCGACTTTCAGGAGTGGCGAGCCGTCTATCACCGTGCCTCCACATCTGTGCAGAAC
AGGCTGCTCAAACTCGAAGAGAGCTACGAGTTAATCGAAAAGAATCTTCAACTACTGGGA
GCCACAGCCATTGAGGATAAATTACAAGATCAAGTGCCTGAAACCATAGAAACTCTAATG
AAAGCAGACATCAAAATCTGGATCCTTACAGGAGACAAGCAGGAAACTGCCATTAACATT
GGGCACTCCTGCAAACTTCGGAGGAAGAACATGGGAATGATTGTTATAAATGAAGGCTCT
CTTGATGGAACACGGGAAACTCTCAGTCGTCACTGCACTACTCTGGGTGATGCTCTTCGG
AAGGAGAATGACTTTGCTCTTATAATTGATGGGAAAACCCTCAAATATGCCTTAACTTTT
GGAGTGAGGCAGTATTTCCTGGACTTAGCTTTGTCGTGCAAAGCTGTTATTTGCTGCAGG
GTTTCTCCTCTTCAAAAATCTGAAGTTGTGGAGATGGTTAAGAAACAAGTTAAAGTCATA
ACACTCGCCATTGGTGATGGAGCAAATGACGTCAGTATGATACAGACGGCACATGTTGGA
GTAGGAATAAGTGGCAATGAAGGCCTTCAGGCAGCTAATTCTTCTGACTACTCTATAGCT
CAGTTCAAATATTTGAAGAATTTGTTGATGGTTCATGGTGCCTGGAACTATAACAGAGGC
TCCAAGTGTATCTTATACTGCTTCTACAAGAATATAGTCCTCTATATTATCGAGATCTGG
TTTGCCTTCGTGAATGGCTTTTCTGGACAGATCCTCTTTGAGAGATGGTGCATAGGTCTT
TATAATGTGATGTTTACAGCAATGCCACCCTTAACTCTGGGAATATTTGAGAGATCATGC
AGAAAGGAGTATATGTTGAAGTATCCTGAATTATACAAAACATCTCAGAATGCCCTGGAC
TTCAACACCAAGGTTTTCTGGGTTCATTGTTTAAATGGCCTCTTCCACTCAGTTATTCTG
TTTTGGTTTCCACTAAAAGCCCTTCAATATGGCACTGTATTTGAAAATGGGAGAACTTCT
GATTACCTGCTGTTGGGAAACTTCGTTTACACATTTGTGGTGATAACTGTGTGCTTGAAA
GCTGGATTGGAGACATCATATTGGACCTGGTTCAGCCACATAGCCATCTGGGGCAGCATC
GCACTCTGGGTGGTGTTTTTTGGAATCTACTCATCTCTGTGGCCTGCTGTTCCAATGGCC
CCTGATATGTCAGGAGAGGCAGCCATGTTGTTCAGTTCTGGAGTCTTTTGGATGGGCCTG
TTATTTATCCCTGTGGCCTCCTTGCTCCTTGATGTGGTGTATAAAGTTATCAAGAGGACT
GCTTTTAAAACATTAGTAGATGAAGTTCAGGAGCTGGAGGCAAAATCTCAAGACCCAGGA
GCAGTTGTGCTTGGAAAAAGCCTCACAGAGAGGGCGCAACTGCTCAAGAACGTCTTTAAG
AAGAACCACGTGAACTTGTACCGGTCAGAATCACTGCAACAAAACCTGCTCCATGGGTAT
GCTTTCTCTCAAGATGAAAATGGAATCGTCTCACAGTCTGAAGTGATTAGAGCATATGAT
ACCACAAAGCAGAGACCTGATGAGTGGTGA
Enzyme 22 GenBank Gene ID U51100 Link Image
Enzyme 22 GeneCard ID ATP8A1 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:4
Enzyme 22 Locus 4p14-p12
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References
  1. [PubMed Link Image]
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 198
Enzyme 23 Name Alkaline phosphatase
Enzyme 23 Synonyms Not Available
Enzyme 23 Gene Name LOC100125266
Enzyme 23 Protein Sequence >Alkaline phosphatase
MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDA
SVNGVRKDKQNLVQAWQAKQQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD
PTKDPTLQEMTEVALRVLSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAVMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYAL
GGGSRPDVNDSTSEDPSYQQQAAVPLASETHGGEDVAVFARGPQAHLVHGVQEETFVAHI
MAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY
Enzyme 23 Number of Residues 533
Enzyme 23 Molecular Weight 57049.1
Enzyme 23 Theoretical pI 5.71
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Inorganic ion transport and metabolism
Enzyme 23 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 151556049 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID A6QQR9 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name A6QQR9_BOVIN Link Image
Enzyme 23 PDB ID Not Available
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >1602 bp
ATGCAGGGGGCCTGCGTGCTGCTGCTGCTGGGCCTGCATCTACAGCTCTCCCTAGGCCTC
GTCCCAGTTGAGGAGGAAGACCCCGCCTTCTGGAACCGCCAGGCAGCCCAGGCCCTCGAT
GTGGCTAAGAAGCTGCAGCCCATCCAGACAGCCGCCAAGAATGTCATCCTCTTCTTGGGG
GATGGGATGGGGGTGCCTACGGTGACAGCCACTCGGATCCTAAAGGGGCAGATGAATGGC
AAACTGGGACCTGAGACACCCCTGGCCATGGACCAGTTCCCATACGTGGCTCTGTCCAAG
ACATACAACGTGGACAGACAGGTGCCAGACAGCGCAGGCACTGCCACTGCCTACCTGTGT
GGGGTCAAGGGCAACTACAGAACCATTGGTGTAAGTGCAGCCGCCCGCTACAACCAGTGC
AAAACGACACGTGGGAATGAGGTCACGTCTGTGATGAACCGGGCCAAGAAAGCAGGGAAG
TCCGTGGGAGTGGTGACCACCACCAGGGTGCAGCATGCCTCCCCAGCCGGGGCCTACGCG
CACACGGTGAACCGAAACTGGTACTCAGACGCCGACCTGCCTGCTGATGCACAGATGAAT
GGCTGCCAGGACATCGCCGCACAGCTGGTCAACAACATGGATATTGACGTGATCCTGGGT
GGAGGCCGAAAATACATGTTTCCTGTGGGGACCCCAGACCCTGAATACCCAGATGATGCC
AGTGTGAATGGAGTCCGGAAGGACAAGCAGAACCTGGTGCAGGCATGGCAGGCCAAGCAG
CAGGGAGCCCAGTATGTGTGGAACCGCACTGCGCTCCTTCAGGCGGCCGATGACTCCAGT
GTAACACACCTCATGGGCCTCTTTGAGCCGGCAGACATGAAGTATAATGTTCAGCAAGAC
CCCACCAAGGACCCGACCCTGCAGGAAATGACAGAGGTGGCCCTGCGAGTGCTAAGCAGG
AACCCCAGGGGCTTCTACCTCTTTGTGGAGGGAGGCCGCATTGACCACGGTCACCATGAT
GACAAAGCTTATATGGCACTGACCGAGGCGGTCATGTTTGACAATGCCATCGCCAAGGCT
AATGAGCTCACTAGCGAACTGGACACGCTGATCCTTGTCACTGCAGACCACTCTCATGTC
TTCTCTTTTGGTGGCTATACACTGCGTGGGACCTCCATTTTTGGTCTGGCCCCCAGCAAG
GCCTTAGACAGCAAGTCCTACACCTCCATCCTCTATGGCAATGGCCCTGGCTATGCGCTT
GGCGGGGGCTCGAGGCCCGATGTTAATGACAGCACAAGCGAGGACCCCTCGTACCAGCAG
CAGGCGGCCGTGCCCCTGGCTAGCGAGACCCACGGGGGCGAGGACGTGGCGGTGTTCGCG
CGCGGCCCGCAGGCGCACCTGGTGCACGGCGTGCAGGAGGAGACCTTCGTGGCGCACATC
ATGGCCTTTGCGGGCTGCGTGGAGCCCTACACCGACTGCAATCTGCCAGCCCCCACCACC
GCCACCAGCATCCCCGACGCCGCGCACCTGGCGGCCAGCCCGCCTCCACTGGCGCTGCTG
GCTGGGGCGATGCTGCTGCTGCTGGCGCCCACCTTGTACTAA
Enzyme 23 GenBank Gene ID BC149968 Link Image
Enzyme 23 GeneCard ID LOC100125266 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Not Available
Enzyme 23 Locus Not Available
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References Not Available
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 205
Enzyme 24 Name Activin receptor type-1
Enzyme 24 Synonyms
  1. Activin receptor type I
  2. ACTR-I
  3. Serine/threonine-protein kinase receptor R1
  4. SKR1
Enzyme 24 Gene Name ACVR1
Enzyme 24 Protein Sequence >Activin receptor type-1
MVDGVMILPVLVMIAFPFPSMEDEKPKVNPKLYMCVCEGLSCGDEAHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Enzyme 24 Number of Residues 509
Enzyme 24 Molecular Weight 57189.5
Enzyme 24 Theoretical pI 7.36
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Involved in activin receptor activity, type I
Enzyme 24 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May also bind activin
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • 1-20
Enzyme 24 Transmembrane Regions
  • 124-146
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 1381584 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID Q28041 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name ACVR1_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence >1530 bp
ATGGTGGATGGAGTGATGATTCTTCCTGTGCTCGTGATGATTGCTTTCCCTTTCCCTAGT
ATGGAAGATGAGAAGCCCAAGGTAAACCCCAAGCTTTACATGTGTGTGTGTGAAGGCCTC
TCCTGTGGGGATGAGGCCCACTGTGAAGGCCAGCAGTGCTTTTCCTCGCTGAGCATAAAT
GATGGCTTCCACGTCTACCAGAAAGGCTGCTTCCAGGTCTACGAGCAGGGGAAGATGACC
TGTAAGACCCCGCCGTCACCTGGCCAGGCTGTGGAGTGCTGCCAAGGGGACTGGTGTAAC
AGGAACATCACGGCCCAGCTGCCTACTAAAGGGAAATCTTTTCCTGGAACACAGAATTTC
CACTTGGAGGTTGGCCTCATCATTTTGTCTGTAGTGTTCGCAGTATGCCTTCTAGCCTGC
CTATTGGGAGTTGCTCTCCGAAAATTTAAAAGGCGCAATCAAGAACGCCTCAACCCCAGA
GATGTGGAATATGGCACCATTGAAGGACTCATCACCACCAACGTTGGAGACAGCACTTTA
GCAGATTTATTGGATCATTCATGTACATCGGGAAGCGGCTCTGGCCTTCCTTTTCTGGTA
CAGAGAACAGTGGCCCGTCAGATCACACTGCTGGAGTGTGTTGGGAAGGGCAGGTATGGC
GAGGTGTGGAGGGGCAGCTGGCAAGGGGAGAACGTCGCTGTGAAGATCTTTTCCTCCCGG
GATGAGAAGTCGTGGTTTAGGGAAACAGAATTGTACAACACTGTGATGCTGAGGCATGAA
AATATCTTAGGTTTCATTGCTTCAGACATGACATCAAGACACTCCAGTACACAGTTGTGG
TTGATCACACATTATCATGAAATGGGATCGCTGTACGACTACCTTCAGCTTACTACTCTG
GATACAGTGAGCTGCCTGAGAATAGTGCTGTCCATAGCGAGCGGTCTCGCACATTTGCAC
ATAGAGATCTTTGGGACCCAAGGGAAACCGGCCATTGCTCACCGAGATCTAAAAAGCAAA
AACATCCTGGTTAAGAAGAATGGACAGTGTTGCATAGCAGATTTGGGCCTGGCAGTCATG
CATTCCCAGAGCACCAATCAGCTCGATGTGGGGAACAACCCCCGTGTGGGCACCAAACGC
TACATGGCCCCCGAAGTTCTTGATGAAACTATCCAGGTGGATTGTTTCGATTCTTACAAG
AGAGTCGATATTTGGGCCTTTGGACTTGTCTTGTGGGAGGTGGCCAGGCGGATGGTGAGC
AATGGTATTGTGGAGGATTACAAGCCACCATTCTATGATGTGGTTCCCAATGACCCAAGT
TTTGAAGATATGAGGAAGGTAGTCTGTGTGGATCAACAGAGGCCTAACATACCCAACAGA
TGGTTCTCAGACCCGACATTAACCTCCCTGGCCAAGCTGATGAAAGAATGCTGGTATCAA
AATCCATCTGCCAGACTCACAGCCCTGCGTATCAAAAAGACTTTGACCAAAATTGATAAT
TCCCTAGACAAATTGAAAACTGACTGTTGA
Enzyme 24 GenBank Gene ID U58095 Link Image
Enzyme 24 GeneCard ID ACVR1 Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Chromosome:2
Enzyme 24 Locus 2q23-q24
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 207
Enzyme 25 Name Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
Enzyme 25 Synonyms
  1. SERCA1
  2. Calcium pump 1
  3. Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform
  4. SR Ca(2+)-ATPase 1
  5. Endoplasmic reticulum class 1/2 Ca(2+) ATPase
Enzyme 25 Gene Name ATP2A1
Enzyme 25 Protein Sequence >Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
MEAAHSKTTEECLAYFGVSETTGLTPDQVKRHLEKYGHNELPAEEGKSLWELVLEQFEDL
LVRILLLAACISFVLAWFEEGEETVTAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILTIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKAIGIVATTGVGTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDRIDGDLCLLNEFSVTGSTYAPEGEVLKNDKPVRSGQYDGLVELATICALC
NDSSLDFNETKGIYEKVGEATETALTTLVEKMNVFNTEVRNLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPMTGPV
KEKILSVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSTKFMEYETDLTFVGVVGMLD
PPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEDVADRAYTGREFDDL
PLAEQREACRRACCFARVEPTHKSKIVEYLQSFDEITAMTGDGVNDAPALKKAEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRTPKEPLISGWLFFRYMAIG
GYVGAATVGAAAWWFLYAEDGPHVTYSQLTHFMKCSEHSPDFEGVDCEVFEAPQPMTMAL
SVLVTIEMCNALNSLSENQSLVRMPPWVNIWLVGSIGLSMSLHFLILYVDPLPMIFKLQA
LDLYHWLMVLKISLPVIGLDEILKFVARNYLEG
Enzyme 25 Number of Residues 993
Enzyme 25 Molecular Weight 109289.4
Enzyme 25 Theoretical pI 4.93
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Inorganic ion transport and metabolism
Enzyme 25 Specific Function This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • 49-69 90-110 254-273 296-313 757-776 787-807 828-850 897-916 930-948 964-984
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 111304645 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID Q0VCY0 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name AT2A1_BOVIN Link Image
Enzyme 25 PDB ID 1XP5 Link Image
Enzyme 25 PDB File Show
Enzyme 25 3D Structure
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence >2982 bp
ATGGAGGCTGCGCACTCCAAGACCACAGAAGAATGTTTGGCCTATTTTGGGGTGAGCGAA
ACTACAGGCCTCACCCCGGACCAAGTTAAGCGGCATCTGGAGAAATATGGCCATAATGAG
CTCCCTGCTGAGGAGGGGAAGTCCCTGTGGGAGCTGGTGTTAGAGCAGTTTGAAGACCTC
CTGGTGCGGATCCTTCTCCTGGCCGCCTGCATTTCCTTTGTGCTGGCCTGGTTTGAGGAA
GGCGAAGAGACTGTCACCGCCTTTGTTGAACCCTTTGTCATCCTCTTGATCCTCATTGCC
AATGCCATCGTGGGGGTTTGGCAGGAGCGGAATGCAGAGAATGCCATCGAGGCTCTGAAG
GAATATGAACCCGAGATGGGGAAGGTCTACCGGGCTGACCGCAAGTCAGTACAAAGGATC
AAAGCTCGGGATATTGTTCCTGGAGACATCGTGGAGGTGGCTGTGGGGGACAAGGTCCCG
GCAGATATCCGCATCCTCACCATCAAGTCTACCACCCTCCGGGTCGACCAGTCCATCCTG
ACAGGCGAGTCTGTCTCTGTCATCAAGCACACAGAACCTGTTCCCGACCCCCGAGCTGTC
AACCAGGATAAGAAGAACATGCTTTTCTCGGGCACCAACATCGCAGCCGGCAAGGCCATC
GGCATTGTGGCCACCACCGGTGTGGGCACCGAGATTGGGAAGATCCGTGACCAAATGGCC
GCCACAGAGCAGGACAAGACCCCTCTGCAGCAAAAGCTGGATGAGTTTGGGGAGCAGCTC
TCCAAGGTCATCTCCCTCATCTGCGTGGCCGTCTGGCTCATCAACATTGGCCACTTCAAC
GACCCCGTGCATGGGGGCTCCTGGATCCGTGGTGCCATCTACTACTTTAAGATCGCCGTG
GCCCTGGCTGTGGCTGCCATCCCCGAGGGCCTTCCTGCAGTCATCACCACCTGCCTGGCC
TTGGGCACCCGCCGGATGGCAAAGAAGAACGCGATCGTGAGGAGCCTGCCCTCCGTGGAG
ACTCTGGGCTGCACCTCTGTCATCTGTTCCGACAAGACGGGCACCCTCACCACCAACCAG
ATGTCTGTCTGCAAGATGTTCATCATCGACAGGATAGATGGGGACCTCTGCCTGCTGAAC
GAGTTCTCTGTCACTGGCTCCACTTACGCTCCTGAAGGAGAGGTCTTGAAGAATGATAAG
CCAGTCCGCTCAGGGCAGTATGACGGGCTGGTGGAGCTGGCCACCATTTGTGCCCTCTGC
AATGACTCCTCCTTGGACTTCAATGAGACCAAAGGTATTTATGAGAAGGTGGGAGAGGCC
ACCGAGACAGCCCTCACCACCCTGGTGGAGAAGATGAATGTATTCAACACTGAAGTGAGA
AACCTCTCGAAGGTAGAGAGGGCCAACGCCTGCAACTCGGTGATCCGCCAGCTAATGAAG
AAGGAATTCACCCTGGAGTTCTCCCGGGACCGAAAGTCCATGTCTGTCTATTGCTCTCCA
GCAAAATCCCGGGCTGCTGTGGGCAATAAGATGTTTGTCAAGGGTGCCCCTGAGGGGGTC
ATCGATCGCTGTAACTACGTGCGAGTGGGCACCACCCGGGTGCCCATGACAGGGCCGGTG
AAGGAGAAGATTCTGTCGGTGATCAAAGAGTGGGGTACTGGCCGGGACACCCTGCGCTGC
CTGGCGCTGGCCACTCGGGACACCCCCCCCAAGCGAGAGGAGATGGTCCTGGATGACTCT
ACCAAGTTCATGGAGTACGAGACGGACTTGACATTCGTTGGCGTCGTGGGCATGCTGGAC
CCGCCCCGCAAGGAGGTCATGGGCTCCATCCAACTATGCCGAGACGCTGGAATCCGAGTA
ATCATGATCACCGGAGACAACAAGGGCACGGCCATTGCCATCTGCCGACGGATTGGCATC
TTCGGGGAGAACGAGGATGTGGCTGACCGGGCCTACACTGGCCGGGAGTTCGATGACCTG
CCCCTGGCCGAGCAGCGGGAGGCCTGCCGACGCGCCTGCTGCTTCGCCCGCGTGGAGCCC
ACCCACAAGTCGAAGATCGTGGAGTATCTGCAGTCCTTCGATGAGATCACGGCGATGACA
GGTGATGGCGTCAATGACGCCCCTGCGCTGAAGAAGGCGGAAATCGGCATTGCCATGGGA
TCCGGCACTGCCGTGGCCAAGACAGCCTCTGAGATGGTGCTGGCCGACGACAACTTCTCC
ACCATTGTGGCTGCCGTGGAGGAGGGCCGGGCCATCTACAACAACATGAAGCAGTTTATC
CGCTACCTCATCTCCTCCAACGTGGGCGAGGTGGTCTGCATCTTCCTGACAGCTGCCCTG
GGGCTGCCCGAGGCCCTGATCCCTGTGCAGCTGCTGTGGGTGAACCTGGTGACCGATGGG
CTCCCAGCCACAGCCCTGGGCTTCAACCCCCCAGACCTGGACATCATGGACCGGCCCCCC
CGGACCCCCAAGGAGCCCCTCATCAGTGGCTGGCTCTTCTTCCGCTACATGGCAATTGGG
GGCTATGTGGGTGCAGCCACCGTGGGAGCAGCGGCCTGGTGGTTCCTGTATGCTGAGGAC
GGGCCTCACGTCACCTACAGCCAGCTGACTCACTTCATGAAGTGCTCGGAGCACAGCCCA
GACTTCGAGGGTGTGGACTGTGAGGTCTTCGAGGCCCCGCAGCCCATGACCATGGCCTTG
TCTGTGCTGGTCACCATCGAGATGTGCAATGCTCTCAACAGCCTGTCTGAGAATCAGTCC
CTCGTGCGGATGCCACCCTGGGTGAACATCTGGCTGGTGGGCTCCATCGGCCTCTCCATG
TCCCTCCACTTCCTCATCCTCTACGTGGACCCTCTGCCGATGATCTTCAAGCTCCAAGCC
CTGGACCTGTACCATTGGCTCATGGTCCTCAAGATCTCATTACCAGTCATTGGGCTCGAC
GAAATCCTCAAGTTCGTTGCTCGAAACTACCTGGAGGGATAA
Enzyme 25 GenBank Gene ID BC119938 Link Image
Enzyme 25 GeneCard ID ATP2A1 Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:1
Enzyme 25 Locus 16p12.1
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References Not Available
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 210
Enzyme 26 Name Enolase-phosphatase E1
Enzyme 26 Synonyms
  1. 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  2. MASA homolog
Enzyme 26 Gene Name ENOPH1
Enzyme 26 Protein Sequence >Enolase-phosphatase E1
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYVKENVEEYLQAHWEEEECQQDVRLLR
KQAEEDSHLDGAVPIPAASGNGADDPQWMIQAVVDNVYWQMSLDRKTTALKQLQGHMWRA
AFKAGHMKAEFFEDVVPAVRKWREAGMKVYVYSSGSVEAQKLLFGHSTEGDILELVDGHF
DTKIGHKVESESYQKIASSIGCSTNNILFLTDVSREASAAEEAGVHVAVVVRPGNAGLTD
DEKTHFSLITSFSELYLPSST
Enzyme 26 Number of Residues 261
Enzyme 26 Molecular Weight 28929.4
Enzyme 26 Theoretical pI 4.56
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Energy production and conversion
Enzyme 26 Specific Function Bifunctional enzyme that enolizes the substrate to form the intermediate 2-hydroxy-5-(methylthio)-3-oxopent-1-enyl phosphate, which is then dephosphorylated to form the acireductone 1,2-dihydroxy-5-(methylthio)pent-1-en-3-one
Enzyme 26 Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via salvage pathway
  • L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate:step 4/6
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 111308442 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID Q0VD27 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name ENOPH_BOVIN Link Image
Enzyme 26 PDB ID Not Available
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence >786 bp
ATGGTCGTGCTTTCGGTGCCCGCCGAAGTCACTGTGATCCTGTTAGATATCGAAGGTACC
ACAACCCCGATTGCTTTCGTGAAGGACATTTTATTTCCTTACGTCAAAGAAAATGTTGAA
GAGTATCTGCAGGCACATTGGGAAGAAGAGGAGTGCCAACAGGATGTCAGGCTTTTGAGG
AAACAGGCTGAAGAGGACTCCCACCTGGATGGGGCTGTTCCAATCCCAGCAGCCTCCGGT
AATGGGGCGGACGACCCGCAGTGGATGATCCAGGCCGTGGTGGATAACGTGTACTGGCAG
ATGTCCCTGGACCGGAAGACCACGGCACTGAAGCAGCTGCAGGGCCACATGTGGAGGGCG
GCGTTCAAGGCTGGGCACATGAAAGCGGAGTTCTTTGAAGACGTGGTTCCGGCCGTCCGG
AAGTGGCGAGAGGCTGGGATGAAGGTGTATGTCTATTCTTCAGGGAGTGTGGAGGCGCAG
AAACTATTATTTGGGCATTCTACAGAGGGGGACATTCTTGAGCTTGTGGATGGTCACTTT
GATACCAAGATTGGACACAAAGTGGAGAGTGAGAGTTACCAAAAGATCGCCAGCAGCATT
GGCTGTTCAACCAACAACATCTTGTTTCTGACGGATGTTTCCCGAGAGGCCAGCGCTGCT
GAGGAGGCGGGCGTGCATGTCGCTGTGGTGGTGAGACCGGGCAACGCAGGGCTGACTGAT
GATGAGAAGACCCACTTCAGCCTCATCACGTCCTTCAGTGAACTGTACCTGCCTTCCTCA
ACCTAG
Enzyme 26 GenBank Gene ID BC119871 Link Image
Enzyme 26 GeneCard ID ENOPH1 Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Chromosome:4
Enzyme 26 Locus 4q21.22
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References Not Available
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 216
Enzyme 27 Name Pyridoxal phosphate phosphatase
Enzyme 27 Synonyms
  1. PLP phosphatase
Enzyme 27 Gene Name PDXP
Enzyme 27 Protein Sequence >Pyridoxal phosphate phosphatase
MARCERLRGAALRDVVGRAQGVLFDCNGVLWNGERAVPGAPELLERLAQAGKATLFVSNN
SRRARPELALRFARLGFGGLRSEQLFSSALCAARLLRQRLLGPPDTQGAVFVLGGEGLRA
ELRAAGLRLAGDPSEDPGAAPRVRAVLVGYDEHFSFAKLSEACAHLRDPDCLLVATDRDP
WHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITEHFSVDPGRTLMVGDRL
ETDILFGHRCGMTTVLTLTGVSSLEEAQAYLAAGQHDLVPHYYVESIADLMEGLED
Enzyme 27 Number of Residues 296
Enzyme 27 Molecular Weight 31748.7
Enzyme 27 Theoretical pI 5.91
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Carbohydrate transport and metabolism
Enzyme 27 Specific Function Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and Pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 73586511 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID Q3ZBF9 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name PLPP_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence >891 bp
ATGGCGCGCTGCGAGCGGCTGCGCGGCGCGGCCCTGCGCGACGTGGTGGGCCGGGCGCAG
GGGGTCCTGTTCGACTGCAACGGGGTGCTGTGGAACGGCGAGCGCGCAGTGCCGGGCGCC
CCCGAGCTCCTGGAGAGACTGGCTCAGGCTGGCAAGGCGACGCTCTTCGTGAGCAACAAC
AGCCGGCGCGCGCGGCCCGAGCTGGCCCTCCGCTTCGCGCGACTTGGCTTCGGGGGGCTG
CGCTCCGAGCAGCTCTTCAGCTCCGCGCTGTGCGCCGCGCGCTTGCTGCGCCAGCGCCTG
CTCGGACCTCCGGACACTCAGGGCGCGGTGTTCGTGCTGGGCGGTGAAGGGCTGCGGGCC
GAGCTGCGCGCCGCCGGGCTGCGCCTGGCGGGGGACCCCAGCGAGGACCCGGGCGCGGCC
CCGCGCGTGCGCGCCGTGCTTGTGGGCTACGACGAGCACTTCTCCTTCGCCAAGCTGAGC
GAGGCCTGCGCGCACTTGCGCGACCCCGACTGCCTGCTGGTAGCCACCGACCGCGACCCG
TGGCACCCTCTCAGCGACGGCAGCCGGACCCCCGGCACCGGGAGCTTGGCTGCTGCTGTG
GAGACAGCCTCGGGCCGCCAGGCCCTGGTGGTGGGCAAGCCCAGCCCCTACATGTTCGAG
TGCATCACAGAGCACTTCAGCGTGGACCCCGGCCGCACGCTGATGGTGGGCGACCGCCTG
GAGACTGACATCCTCTTCGGCCACCGCTGTGGTATGACCACCGTGCTCACGCTCACGGGC
GTCTCCAGCCTGGAGGAGGCCCAGGCCTACCTGGCGGCCGGCCAGCACGACCTCGTGCCC
CATTACTACGTGGAGAGCATCGCGGACTTGATGGAGGGGTTGGAGGACTGA
Enzyme 27 GenBank Gene ID BC103329 Link Image
Enzyme 27 GeneCard ID PDXP Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:2
Enzyme 27 Locus 22cen-q12.3
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References Not Available
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 223
Enzyme 28 Name Pyridoxal phosphate phosphatase PHOSPHO2
Enzyme 28 Synonyms Not Available
Enzyme 28 Gene Name PHOSPHO2
Enzyme 28 Protein Sequence >Pyridoxal phosphate phosphatase PHOSPHO2
MKILLVFDFDNTIIDDNSDTWIVQCAPEKKLPLELKDSYKKGFWTEFMGRVFKYLGDEGV
REDEMKRAMISMPFTPGMVELLNFIRKNKNKFDCIIISDSNSVFIDWVLEATNFHDVFDK
VFTNPAAFDSNGHLTVEKHHTHSCTRCPQNLCKNVVLVEFVGEQLQQGVNYTRIVYIGDG
GNDVCPVTFLKKNDIAMPRKGYALQKTLYRMCQNLEPMESSVVSWSSGVEIISYLQFLIK
E
Enzyme 28 Number of Residues 241
Enzyme 28 Molecular Weight 27750.8
Enzyme 28 Theoretical pI 5.68
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Involved in magnesium ion binding
Enzyme 28 Specific Function Phosphatase that has high activity toward pyridoxal 5'- phosphate (PLP). Also active at much lower level toward pyrophosphate, phosphoethanolamine (PEA), phosphocholine (PCho), phospho-l-tyrosine, fructose-6-phosphate, p-nitrophenyl phosphate, and h-glycerophosphate
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 86438528 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID Q2KI06 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name PHOP2_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >726 bp
ATGAAAATTTTGTTGGTTTTTGACTTTGACAATACAATCATAGATGATAATAGTGACACC
TGGATTGTACAATGTGCTCCAGAGAAAAAGCTTCCCCTTGAACTGAAAGATTCTTACAAA
AAGGGATTTTGGACAGAATTTATGGGCAGAGTCTTTAAGTATTTGGGAGATGAAGGTGTA
AGAGAAGATGAAATGAAGAGAGCAATGATATCAATGCCTTTCACTCCAGGGATGGTGGAA
CTTTTAAACTTTATAAGAAAGAACAAGAATAAATTTGACTGCATCATTATTTCAGATTCA
AATTCAGTCTTCATAGATTGGGTTTTAGAAGCTACCAATTTTCATGATGTGTTTGATAAA
GTGTTTACAAATCCAGCAGCATTTGATAGCAATGGTCATCTCACTGTGGAAAAACATCAC
ACTCATTCTTGCACTCGGTGCCCCCAAAATCTTTGCAAAAATGTAGTTTTGGTAGAATTT
GTAGGTGAGCAGTTACAACAAGGAGTGAATTATACACGAATTGTTTATATAGGTGACGGA
GGAAATGATGTCTGTCCAGTAACTTTTTTAAAGAAGAACGATATTGCCATGCCACGGAAG
GGATATGCTTTACAGAAAACTCTTTATAGGATGTGTCAAAACCTTGAGCCTATGGAATCT
TCTGTTGTATCTTGGTCTTCAGGTGTTGAAATAATTTCTTATTTACAATTTCTAATAAAG
GAATAA
Enzyme 28 GenBank Gene ID BC112815 Link Image
Enzyme 28 GeneCard ID PHOSPHO2 Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:2
Enzyme 28 Locus 2q31.1
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References Not Available
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 261
Enzyme 29 Name Squalene synthetase
Enzyme 29 Synonyms
  1. SQS
  2. SS
  3. Farnesyl-diphosphate farnesyltransferase
  4. FPP:FPP farnesyltransferase
Enzyme 29 Gene Name FDFT1
Enzyme 29 Protein Sequence >Squalene synthetase
MEFVKCLGHPEEFYNLLRFQMGGRRKVIPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRHAVCIFYLVLRALDTLEDDMTISIERKVPLLHNFHSYLYEPDWRFTESKEKDRQ
VLEDFPTISLEFRNLAEKYQTVIVDVCQKMGFGMAEFLDKRVTSEREWDKYCHYVAGLVG
IGLSRLFPASELEDPLIGEDTERANSMGLFLQKTNIIRDYLEDQREGREFWPQETWSKYV
KKLGDFAKPENIDLAVQCLNELITNTLHHIPDVITYLSRLRNQSIFNFCAIPQVMAIATL
AACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIHQYMEEIYHRIPNSDPCSTKTQ
QIISTIRTQNLPNCQLVSRSHYSPIYLSFVMLLAALSWQYLSTLSQVTEDYVQTGEH
Enzyme 29 Number of Residues 417
Enzyme 29 Molecular Weight 48303.1
Enzyme 29 Theoretical pI 6.44
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Lipid transport and metabolism
Enzyme 29 Specific Function Critical branch point enzyme of isoprenoid biosynthesis that is thought to regulate the flux of isoprene intermediates through the sterol pathway
Enzyme 29 Pathways
  • Terpene metabolism
  • lanosterol biosynthesis
  • lanosterol from farnesyl diphosphate:step 1/3
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • None
Enzyme 29 Transmembrane Regions
  • 284-304 384-404
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 81674847 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q32KR6 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name FDFT_BOVIN Link Image
Enzyme 29 PDB ID 1EZF Link Image
Enzyme 29 PDB File Show
Enzyme 29 3D Structure
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >1254 bp
ATGGAGTTCGTGAAGTGCTTGGGGCACCCTGAGGAGTTCTACAACCTTCTGCGCTTCCAG
ATGGGGGGCCGACGGAAGGTGATACCCAAAATGGACCAGGACTCGCTCAGCAGCAGCTTG
AAAACATGCTACAAGTACCTGAATCAGACCAGTCGCAGTTTCGCAGCTGTTATCCAGGCG
CTGGATGGGGAAATGCGCCATGCAGTATGCATATTTTATCTGGTTCTCCGAGCTTTGGAC
ACACTGGAAGATGACATGACTATCAGTATAGAAAGAAAAGTGCCACTGCTACACAACTTC
CACTCATACCTTTATGAGCCTGACTGGCGGTTCACGGAGAGCAAGGAAAAGGACCGACAA
GTCCTGGAGGACTTCCCAACGATCTCCCTGGAGTTTCGAAATCTGGCTGAGAAATATCAG
ACAGTGATTGTTGACGTTTGCCAGAAGATGGGCTTTGGGATGGCGGAGTTTCTGGATAAG
CGCGTGACGTCTGAACGGGAGTGGGACAAGTACTGTCACTATGTTGCTGGTCTAGTGGGA
ATTGGCCTCTCCCGTCTCTTCCCGGCCTCAGAGTTAGAAGACCCCTTAATTGGCGAAGAC
ACAGAGCGAGCCAACTCTATGGGCCTTTTTCTGCAGAAAACAAACATCATCCGTGATTAT
CTGGAAGACCAGCGAGAAGGGAGAGAGTTTTGGCCTCAAGAGACTTGGAGCAAGTATGTG
AAGAAGCTGGGTGACTTTGCTAAGCCAGAGAACATTGACTTGGCTGTGCAGTGTCTGAAT
GAACTCATCACCAACACACTGCACCACATCCCCGACGTCATCACCTACCTGTCACGACTT
AGAAACCAGAGTATTTTTAACTTCTGTGCTATTCCACAGGTCATGGCCATTGCTACTTTG
GCTGCCTGTTACAATAATCAGCAGGTGTTCAAGGGGGTGGTGAAGATTCGAAAAGGGCAA
GCGGTCACCCTGATGATGGATGCCACCAACATGCCAGCTGTAAAAGCCATAATACACCAG
TACATGGAAGAGATTTATCACAGAATTCCCAACTCTGACCCCTGTTCCACTAAAACACAG
CAGATCATCTCCACCATCAGGACACAGAATCTCCCCAACTGTCAGCTGGTCTCGCGGAGC
CACTACTCGCCCATCTACCTGTCGTTCGTCATGCTCCTGGCGGCCCTGAGCTGGCAGTAC
CTGAGCACCCTGTCCCAGGTCACAGAGGACTATGTTCAGACCGGGGAGCACTGA
Enzyme 29 GenBank Gene ID BC109959 Link Image
Enzyme 29 GeneCard ID FDFT1 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Chromosome:8
Enzyme 29 Locus 8p23.1-p22
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References Not Available
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 374
Enzyme 30 Name Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
Enzyme 30 Synonyms
  1. NAD-dependent methylenetetrahydrofolate dehydrogenase
  2. Methenyltetrahydrofolate cyclohydrolase
Enzyme 30 Gene Name MTHFD2
Enzyme 30 Protein Sequence >Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
MAAASFITSLVTRLLRSAQSGRLHQRPFHLSAVRNEAVVISGRKLAEQIKQEVRQEVEEW
VASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKL
NNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGV
WEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEEL
KKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKK
KAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN
Enzyme 30 Number of Residues 350
Enzyme 30 Molecular Weight 37766.5
Enzyme 30 Theoretical pI 8.81
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Coenzyme transport and metabolism
Enzyme 30 Specific Function 5,10-methylenetetrahydrofolate + NAD(+) = 5,10-methenyltetrahydrofolate + NADH
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • None
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 112362122 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID Q0P5C2 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name MTDC_BOVIN Link Image
Enzyme 30 PDB ID Not Available
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >1053 bp
ATGGCCGCAGCCTCCTTTATAACCTCTTTGGTCACCCGACTGCTCCGGTCCGCGCAGAGT
GGCCGCCTCCATCAACGCCCTTTCCACCTCTCGGCAGTGCGAAATGAAGCTGTTGTCATT
TCTGGAAGGAAACTTGCTGAGCAGATCAAGCAGGAAGTGCGGCAGGAGGTGGAAGAGTGG
GTGGCGTCAGGCAACAAGCGGCCACACCTGAGCGTGGTTCTGGTTGGAGAGAATCCTGCG
AGTCAGTCCTACGTCCTCAACAAAACCAGAGCAGCTGCCAGCGTGGGAATCAACAGTGAG
ACCATTCTGAAACCAGCTTCAATTTCAGAGGAAGAACTGTTGAATTTGATCAATAAACTA
AATAATGATGATAATGTAGACGGCCTCCTTGTTCAGCTGCCTCTTCCAGAGCACATCGAT
GAGAGAAAGGTCTGCAATGCTGTTTCTCCAGACAAAGATGTCGATGGCTTTCATGTAATT
AATGTAGGGCGAATGTGTTTGGACCAGTGTTCCATGTTACCAGCTACTCCATGGGGTGTG
TGGGAAATAATTAAGCGAACTGGCATTCCAACCCTAGGGAAGAATGTGGTTGTGGCCGGA
AGGTCAAAAAATGTTGGAATGCCCATTGCAATGTTGCTGCACACAGATGGGGCACATGAA
CGGCCCGGAGGCGATGCCACTGTCACAATATCTCATCGATACACTCCTAAGGAGGAGCTA
AAGAAACATACAGCTCTTGCAGATATTGTGATCTCCGCTGCAGGTATTCCAAATCTGATC
ACAGCAGATATGATCAAGGAAGGAGCAGCTGTCATTGATGTGGGAATAAATAGAATTCAA
GATCCCATAACTGCTAAACCCAAGTTGGTTGGAGATGTGGATTTTGAAGGAGTCAAGAAG
AAAGCAGGTTACATCACTCCAGTCCCTGGGGGTGTTGGTCCCATGACTGTGGCAATGCTG
ATGAAGAATACCATTATTGCTGCAAAAAAAGTGCTGAGGCTCGAAGAGCAGGAAGTACTG
AAGTCTAAGGAACTTGGAGTAGCAAGTAATTGA
Enzyme 30 GenBank Gene ID BC120249 Link Image
Enzyme 30 GeneCard ID MTHFD2 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:2
Enzyme 30 Locus 2p13.1
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References Not Available
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 387
Enzyme 31 Name Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
Enzyme 31 Synonyms
  1. ATP-dependent dihydroxyacetone kinase
  2. DHA kinase
  3. Glycerone kinase
  4. FAD-AMP lyase (cyclizing)
  5. FAD-AMP lyase (cyclic FMN forming)
  6. FMN cyclase
Enzyme 31 Gene Name DAK
Enzyme 31 Protein Sequence >Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
MTSKKLVNSVAGCADDALAGLVACNPSLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVVGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEITDR
VSVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATANEIVAL
MLDHMTSSSNASHVPVPPGSSVVLMVNNLGGLSFLELGIIADAAVCSLEGHGVKIARALV
GTFMSALEMPGVSLTLLLVDEPLLKLIDAETTASAWPNVAKVWVTGRKRSRAAPTEPLAA
PDSTTAAGEASKQMVLVLEWVCTTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIXGWLK
EGPPPASPAQLLSKLSFLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGANMLQILTKAVKSAEAAAEATKNMEAG
AGRASYISSARLDQPDPGAVAAAAILRAILEVLQSQGA
Enzyme 31 Number of Residues 578
Enzyme 31 Molecular Weight 59068.6
Enzyme 31 Theoretical pI 6.85
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Carbohydrate transport and metabolism
Enzyme 31 Specific Function Catalyzes both the phosphorylation of dihydroxyacetone and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function
Enzyme 31 Signals
  • None
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 61553673 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID Q58DK4 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name DHAK_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence >1737 bp
ATGACCTCCAAGAAGCTAGTGAACTCAGTGGCAGGCTGTGCTGACGACGCTCTTGCCGGC
CTGGTGGCCTGCAACCCCAGCCTACAGCTCCTGCAGGGCCACCGCGTGGCCCTCCGTTCT
GACCTGGACAGTCTCAAGGGCCGGGTGGCCCTACTGTCGGGTGGGGGCTCCGGCCATGAG
CCTGCCCATGCTGGTTTCATAGGGAAGGGGATGCTGACGGGGGTCATCGCGGGAGCCGTG
TTCACCTCCCCGGCAGTGGGCAGCATCCTGGCGGCTATCAGGGCCGTGGCCCAGGCAGGC
ACAGTGGGGACCCTCCTCATCGTGAAGAACTACACTGGGGACCGACTCAACTTCGGCCTG
GCCCGGGAGCAGGCCCGGGCGGAGGGCATCCCTGTGGAGATGGTGGTTGTCGGGGACGAC
AGTGCCTTCACCGTCCTGAAGAAGGCGGGCCGGCGCGGGCTCTGTGGCACAGTGCTCATA
CACAAGGTGGCGGGTGCTCTGGCCGAGGCAGGTGTGGGACTCGAGGAGATCACAGATCGG
GTGAGCGTCGTCGCCAAGGCCATGGGAACCCTGGGAGTGAGCTTGTCCTCTTGCAGCGTC
CCTGGTTCTAAACCCACTTTTGAGCTCTCAGCTGATGAGGTGGAGCTGGGGCTGGGGATC
CATGGGGAGGCTGGCGTGCGCCGGATAAAGATGGCGACTGCCAACGAGATTGTGGCGCTC
ATGCTGGACCACATGACGAGCTCCTCCAACGCATCCCACGTGCCTGTGCCACCCGGCTCC
TCAGTAGTGCTGATGGTCAACAACCTGGGTGGCCTGTCGTTCCTGGAACTGGGCATCATA
GCCGACGCCGCCGTCTGCTCTCTGGAGGGCCACGGGGTGAAGATCGCCCGTGCCCTAGTG
GGCACCTTCATGTCAGCCCTGGAGATGCCTGGCGTTTCTCTCACCCTCCTGCTGGTGGAT
GAGCCCCTCCTGAAACTGATAGATGCTGAAACCACTGCCTCGGCCTGGCCTAACGTGGCC
AAGGTCTGGGTGACTGGGCGGAAGCGGAGCCGGGCCGCCCCCACGGAGCCCCTGGCGGCC
CCTGACTCCACTACTGCAGCAGGTGAAGCCTCAAAGCAGATGGTACTTGTGCTGGAGTGG
GTGTGCACCACCCTCCTGGGCCTGGAGGAACATCTGAACGCCCTGGACCGTGCTGCCGGT
GATGGAGACTGTGGCACCACCCACAGCCGTGCAGCCAGAGCGATTCANGGGTGGCTAAAG
GAGGGCCCACCCCCAGCCAGCCCTGCCCAGCTACTCTCCAAATTGTCCTTCCTGCTACTG
GAGAAGATGGGAGGCTCCTCAGGGGCACTCTACGGCCTGTTCCTGACTGCGGCGGCCCAG
CCACTCAAGGCCAAGACTGACCTCCCGGCCTGGTCTGCTGCCATGGATGCCGGCCTGGAG
GCCATGCAGAAGTATGGAAAGGCTGCCCCAGGTGACAGGACTATGCTGGATTCTCTGTGG
GCAGCAGGACAGGAGCTCCAAGCCTGGAAGAGCCCAGGGGCCAATATGCTCCAGATTCTG
ACCAAGGCTGTCAAGAGTGCAGAAGCTGCAGCCGAGGCCACCAAGAACATGGAAGCTGGA
GCTGGAAGAGCCAGTTACATCAGCTCTGCGCGCCTGGATCAGCCAGACCCCGGGGCGGTG
GCAGCCGCGGCCATTCTGCGTGCCATCCTGGAGGTCTTGCAGAGTCAGGGTGCGTGA
Enzyme 31 GenBank Gene ID BT021593 Link Image
Enzyme 31 GeneCard ID DAK Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:1
Enzyme 31 Locus 11q12.2
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References
  1. [PubMed Link Image]
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 390
Enzyme 32 Name Cholinephosphotransferase 1
Enzyme 32 Synonyms
  1. Diacylglycerol cholinephosphotransferase 1
Enzyme 32 Gene Name CHPT1
Enzyme 32 Protein Sequence >Cholinephosphotransferase 1
MAAGAGARPAPRWLKALTEPLSAAQLRRLEEHRYTAAGVSLLEPPLQLYWTWLLQWIPLW
MAPNSITLLGLAINMLTTLVLISYCPTVTEEAPYWTYLLCALGLFIYQSLDAIDGKQARR
TNSCSPLGELFDHGCDSLSTVFMAVGASIAVRLGTHPDWLFFCSFIGMFMFYCAHWQTYV
SGVLRFGKVDVTEIQIALVIVFVLSTFGGATMWDYTIPILEIKLKILPVLGVVGGAIFSC
SNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGIIIILAIMIYKKSATNLFEKHPCLYTLM
FGCVFAKVSQKLVIAHMTKSELYLQDTVFIGPGLLFLDQYFNNFVDEYIVLWIAMVISSL
DMMRYFSALCLQISRHLHLSIFKTSCHQAPEQVQVLPPKSHQNNMD
Enzyme 32 Number of Residues 406
Enzyme 32 Molecular Weight 45248.9
Enzyme 32 Theoretical pI 7.51
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Lipid transport and metabolism
Enzyme 32 Specific Function Catalyzes phosphatidylcholine biosynthesis from CDP- choline. It thereby plays a central role in the formation and maintenance of vesicular membranes
Enzyme 32 Pathways
  • Phospholipid metabolism
  • phosphatidylcholine biosynthesis
  • phosphatidylcholine from phosphocholine:step 2/2
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • None
Enzyme 32 Transmembrane Regions
  • 66-86 93-113 160-180 193-213 226-248 261-281 295-315 349-369
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 94534811 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID Q1LZE6 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name CHPT1_BOVIN Link Image
Enzyme 32 PDB ID Not Available
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >1221 bp
ATGGCGGCGGGCGCCGGGGCCAGGCCGGCGCCGCGCTGGCTGAAGGCGCTGACCGAGCCG
CTGAGCGCGGCGCAGCTGCGGCGGCTGGAGGAGCACCGCTACACCGCGGCGGGCGTCTCG
CTGCTCGAGCCGCCGCTGCAGCTCTACTGGACCTGGCTGCTCCAGTGGATCCCGCTGTGG
ATGGCCCCCAACTCCATCACCCTCCTGGGCCTCGCCATCAACATGCTCACCACGCTCGTG
CTCATCTCCTATTGCCCCACGGTCACCGAGGAGGCACCATACTGGACATACCTTTTATGT
GCATTAGGACTCTTCATCTACCAGTCACTGGATGCTATTGATGGGAAACAAGCCAGAAGG
ACAAATTCTTGTTCTCCTTTAGGGGAACTTTTTGACCATGGTTGCGACTCTCTTTCCACA
GTTTTTATGGCAGTTGGAGCTTCAATTGCTGTTCGCTTAGGAACTCACCCCGACTGGTTG
TTTTTCTGCTCTTTTATTGGGATGTTCATGTTTTATTGTGCTCACTGGCAGACTTATGTT
TCAGGCGTGTTGAGGTTTGGAAAAGTGGATGTAACTGAAATTCAGATAGCTTTAGTGATC
GTCTTCGTGTTATCTACATTTGGAGGAGCAACAATGTGGGACTACACGATACCCATCCTA
GAAATAAAATTGAAGATCTTACCAGTTCTTGGAGTAGTAGGTGGAGCAATATTTTCCTGT
TCAAATTATTTCCATGTTATCCTCCATGGTGGTGTTGGCAAGAATGGATCCACTATAGCA
GGTACCAGTGTCTTATCACCTGGACTCCACATAGGAATAATTATTATACTGGCAATAATG
ATTTATAAAAAGTCAGCAACTAATTTGTTTGAAAAGCATCCTTGTCTTTATACCCTAATG
TTTGGATGTGTCTTTGCTAAAGTCTCACAGAAATTGGTGATAGCTCACATGACCAAAAGT
GAACTGTATCTTCAAGACACTGTCTTTATTGGCCCAGGTCTTTTATTTTTAGACCAGTAC
TTTAATAATTTTGTAGACGAATATATTGTTCTATGGATAGCAATGGTCATTTCTTCACTT
GATATGATGAGGTACTTTAGTGCTTTGTGCCTGCAAATTTCAAGACACCTTCATCTAAGT
ATCTTCAAGACTTCATGTCATCAAGCACCTGAACAGGTTCAAGTTCTTCCTCCAAAGAGT
CATCAGAATAACATGGATTGA
Enzyme 32 GenBank Gene ID BC116046 Link Image
Enzyme 32 GeneCard ID CHPT1 Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:1
Enzyme 32 Locus 12q
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References Not Available
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 391
Enzyme 33 Name Ethanolaminephosphotransferase 1
Enzyme 33 Synonyms
  1. Selenoprotein I
  2. SelI
Enzyme 33 Gene Name SELI
Enzyme 33 Protein Sequence >Ethanolaminephosphotransferase 1
MASYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTVVKVFPTWLAPNLITFSGFLL
VVFNFLLLAYFDPDFYASAPGHKHVPDWVWIVVGILNFMAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGSSGVSVFVLYLLLWVVLFSFILSHWEKYNTGIL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIFGCALCVTLPMSLL
NFFRSYKNNTLKHNSVYEAVVPFFSPCLLFILSTAWILLSPSDILELHPRVFYLMVGTAF
ANSTCQLIVCQMSSTRCPTLNWLLLPLFVIVMVVNVGVTPYVESILLFTLTAAFTLAHIH
YGVRVVKQLSNHFHIYPFSLRKPNSDULGVEEKNIGL
Enzyme 33 Number of Residues 397
Enzyme 33 Molecular Weight 45213.4
Enzyme 33 Theoretical pI 6.73
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Involved in ethanolaminephosphotransferase activity
Enzyme 33 Specific Function Catalyzes phosphatidylethanolamine biosynthesis from CDP-ethanolamine. It thereby plays a central role in the formation and maintenance of vesicular membranes. Involved in the foramtion of phosphatidylethanolamine via 'Kennedy' pathway
Enzyme 33 Pathways
  • Phospholipid metabolism
  • phosphatidylethanolamine biosynthesis
  • phosphatidylethanolamine from ethanolamine:step 3/3
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • None
Enzyme 33 Transmembrane Regions
  • 47-69 84-103 123-145 150-172 179-201 221-243 256-278 291-310 317-339 344-366
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 109659351 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID Q17QM4 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name SELI_BOVIN Link Image
Enzyme 33 PDB ID Not Available
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence >1161 bp
ATGGCAAGTTACGAATACGTGAGCCCGGAGCAGCTGGCTGGCTTTGATAAGTACAAGTAC
AGTGCTGTGGATACCAATCCACTCTCTCTGTATGTCATGCACCCATTTTGGAACACTGTA
GTAAAGGTATTTCCTACTTGGCTGGCTCCAAATCTGATAACCTTCTCTGGCTTTCTGCTG
GTTGTGTTCAATTTTCTACTTTTGGCATACTTTGATCCTGACTTTTATGCTTCAGCACCA
GGTCACAAGCATGTACCCGACTGGGTCTGGATTGTAGTGGGCATCCTCAACTTCATGGCC
TACACTCTAGATGGTGTGGACGGAAAGCAAGCCCGCAGAACCAATTCCAGCACCCCGCTG
GGGGAGCTTTTTGACCACGGCCTGGATAGTTGGTCGTGTGTTTACTTTGTTGTCACCGTG
TATTCCATTTTTGGACGAGGATCATCTGGTGTCAGTGTTTTCGTTCTTTATCTCCTGCTA
TGGGTAGTTTTGTTTTCTTTCATCCTGTCTCACTGGGAAAAGTATAACACAGGGATTCTT
TTCCTGCCATGGGGATATGACATTAGCCAGGTGACTATTTCTTTTGTCTACATAGTGACT
GCGGTTGTGGGAGTTGAGGCCTGGTATGAACCTTTCCTGTTTAATTTCTTATATAGAGAC
CTATTCACTGCAATGATCTTTGGTTGTGCACTGTGCGTGACTCTTCCAATGAGTTTGTTA
AATTTTTTCAGAAGCTATAAAAATAACACGTTGAAACACAATTCAGTCTATGAAGCTGTG
GTTCCCTTCTTTTCTCCATGTTTGCTATTCATTTTGTCTACAGCGTGGATCCTCCTGTCA
CCTTCAGATATTTTAGAGTTACACCCTAGAGTGTTCTACTTAATGGTTGGAACAGCCTTT
GCCAACAGCACATGTCAGCTGATTGTTTGTCAAATGAGCAGTACCCGGTGCCCGACTTTG
AACTGGTTGCTGCTTCCTCTTTTTGTGATTGTCATGGTGGTGAATGTAGGAGTAACCCCT
TACGTTGAGAGCATTCTCCTGTTTACGCTAACGGCTGCTTTCACTTTGGCCCACATCCAC
TATGGAGTACGAGTGGTAAAGCAGCTGAGCAACCATTTTCACATTTACCCCTTCTCCTTG
AGAAAACCAAACTCGGATTGA
Enzyme 33 GenBank Gene ID BC118273 Link Image
Enzyme 33 GeneCard ID SELI Link Image
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Chromosome:2
Enzyme 33 Locus 2p23.3
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References Not Available
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 403
Enzyme 34 Name S-adenosylmethionine synthetase isoform type-1
Enzyme 34 Synonyms
  1. AdoMet synthetase 1
  2. Methionine adenosyltransferase 1
  3. MAT 1
Enzyme 34 Gene Name MAT1A
Enzyme 34 Protein Sequence >S-adenosylmethionine synthetase isoform type-1
MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETV
CKTGMVLLCGEITSMAMVDYQRVVRETIQHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQ
CVHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIMLAHRLNARMAELRRSGQLPWLQPD
SKTQVTVQYTQDNGAVIPMRVHTVVISVQHNEDITLEDMRRALKEQVIRAVVPARYLDED
TIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
WVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVNKNFDLRPGV
IVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
Enzyme 34 Number of Residues 396
Enzyme 34 Molecular Weight 43760.5
Enzyme 34 Theoretical pI 5.61
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Coenzyme transport and metabolism
Enzyme 34 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 34 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • None
Enzyme 34 Transmembrane Regions
  • None
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 86821449 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID Q2KJC6 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name METK1_BOVIN Link Image
Enzyme 34 PDB ID 1O9T Link Image
Enzyme 34 PDB File Show
Enzyme 34 3D Structure
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >1191 bp
ATGAATGGACCAGTGGATGGCTTGTGTGATCATTCTCTAAGTGAGGAAGGAGCATTCATG
TTCACATCGGAATCTGTAGGAGAGGGGCACCCGGATAAGATCTGTGACCAGATCAGTGAT
GCAGTGCTGGATGCCCATCTCAAGCAGGACCCCAATGCCAAGGTGGCCTGTGAGACGGTG
TGTAAGACGGGCATGGTGCTTCTGTGCGGGGAGATCACCTCCATGGCCATGGTGGATTAC
CAGCGTGTGGTGCGGGAGACCATCCAGCACATCGGCTACGACGACTCCGCCAAGGGCTTT
GACTTTAAGACCTGCAACGTGCTGGTGGCTTTGGAGCAGCAGTCCCCGGATATCGCCCAG
TGTGTCCACCTGGACAGAAATGAAGAGGATGTCGGTGCCGGAGATCAGGGGCTGATGTTT
GGCTATGCCACGGATGAGACGGAAGAGTGCATGCCCCTCACCATCATGCTGGCGCACAGA
CTCAACGCCCGCATGGCAGAGCTGCGACGCTCAGGGCAGCTCCCCTGGCTGCAACCTGAC
TCCAAGACACAGGTGACAGTGCAGTACACGCAGGACAACGGTGCGGTCATCCCTATGCGC
GTCCATACCGTCGTCATCTCCGTGCAGCACAACGAAGACATAACGCTGGAGGACATGCGC
AGAGCCCTGAAGGAGCAGGTGATCAGGGCTGTTGTGCCAGCACGGTACCTGGACGAGGAC
ACCATCTACCACCTGCAGCCCAGTGGGCGCTTTGTCATCGGAGGCCCCCAGGGGGATGCC
GGTGTCACTGGCCGAAAGATCATCGTGGACACCTATGGCGGCTGGGGGGCACACGGCGGA
GGCGCCTTCTCTGGGAAGGACTACACCAAGGTGGACCGCTCGGCAGCGTACGCTGCCCGC
TGGGTGGCCAAGTCCCTGGTGAAAGCAGGGCTCTGCCGGAGGGTGCTTGTGCAGGTGTCC
TATGCCATTGGTGTGGCTGAGCCACTGTCTATTTCCATCTTTACCTATGGAACCTCCCAG
AAGACAGAGAGAGAGCTGCTGGATGTGGTCAATAAGAACTTTGACCTTCGGCCTGGTGTT
ATCGTCAGGGACTTGGACTTGAAGAAGCCCATCTACCAGAAGACAGCATGCTACGGCCAC
TTCGGGAGGAGCGAGTTCCCTTGGGAAGTTCCCAAAAAGCTTGTGTTTTAG
Enzyme 34 GenBank Gene ID BC105410 Link Image
Enzyme 34 GeneCard ID MAT1A Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Chromosome:1
Enzyme 34 Locus 10q22
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References Not Available
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 421
Enzyme 35 Name Catechol O-methyltransferase
Enzyme 35 Synonyms Not Available
Enzyme 35 Gene Name COMT
Enzyme 35 Protein Sequence >Catechol O-methyltransferase
MLEAPPLLLVAGGVGLALLALRWLATTDLQFFGRAFIVWNEFIMKPIRNLLMGSSKEQRI
LQHVLQHAVAGDPQSVVAAIDSYSLEKEWAMHVGEKKGQIVDRVLREQQPSVLLELGAYC
GYSAVRMARLLLPGARLLTIEFNPDYAAITQRMVEFAGLQDKVTVVLGASQDIIPQLKKK
YDVDTLDMVFLDHWKDRYLPDMLLLEECGLLREGTVLLADNVIYPGAPDFLEYVRGNSRF
ECSHFSSYLEYSKVVDGLEKVVYKGLSGPARP
Enzyme 35 Number of Residues 272
Enzyme 35 Molecular Weight 30484.2
Enzyme 35 Theoretical pI 5.69
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Involved in catechol O-methyltransferase activity
Enzyme 35 Specific Function Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • None
Enzyme 35 Transmembrane Regions
  • 7-27
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 154425507 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID A7MBI7 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name COMT_BOVIN Link Image
Enzyme 35 PDB ID Not Available
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence >819 bp
ATGCTGGAGGCCCCGCCCCTGCTGCTGGTCGCTGGTGGCGTAGGCCTGGCCCTGCTCGCG
CTGCGGTGGCTGGCCACAACGGACCTGCAGTTCTTCGGCCGGGCCTTTATCGTCTGGAAC
GAGTTCATCATGAAGCCCATCCGCAACCTCCTCATGGGCAGCAGCAAGGAGCAGCGCATC
CTGCAGCACGTGCTGCAGCACGCGGTGGCCGGGGACCCGCAGAGCGTGGTGGCCGCCATC
GACAGCTACAGCTTGGAGAAGGAGTGGGCCATGCACGTGGGCGAGAAGAAAGGCCAGATC
GTGGACAGGGTGCTGAGGGAACAGCAGCCGTCCGTACTGCTGGAGCTGGGCGCCTACTGC
GGCTACTCGGCAGTGCGAATGGCCCGCCTGCTGCTGCCCGGCGCCCGGCTGCTCACCATC
GAGTTCAATCCCGACTATGCCGCCATCACCCAGCGGATGGTGGAGTTTGCAGGCCTGCAG
GACAAGGTCACCGTTGTTCTTGGAGCATCCCAGGACATCATCCCCCAGCTGAAGAAGAAA
TACGATGTGGACACCCTGGACATGGTCTTTCTCGACCACTGGAAGGACCGCTACCTGCCG
GACATGCTTCTCCTGGAGGAGTGCGGCCTGCTGCGGGAGGGGACAGTGTTGCTGGCTGAC
AACGTCATCTACCCTGGGGCGCCCGACTTTCTGGAGTACGTGCGCGGGAACAGCCGCTTC
GAATGTTCGCACTTCAGCTCGTACCTGGAGTACTCCAAGGTGGTGGACGGCTTGGAGAAG
GTCGTCTACAAGGGCCTGAGCGGCCCTGCTCGGCCCTGA
Enzyme 35 GenBank Gene ID BC151585 Link Image
Enzyme 35 GeneCard ID COMT Link Image
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Chromosome:2
Enzyme 35 Locus 22q11.21-q11.23|22q11.21
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References Not Available
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 427
Enzyme 36 Name Fumarylacetoacetase
Enzyme 36 Synonyms
  1. FAA
  2. Fumarylacetoacetate hydrolase
  3. Beta-diketonase
Enzyme 36 Gene Name FAH
Enzyme 36 Protein Sequence >Fumarylacetoacetase
MSFVPVAEDSDFPIHNLPYGVFSTRGNPRPRIGVAIGDQILDLSVIKHLFTGPILSGHQD
VFNKPTLNSFMGLGQAAWKEARAFLQNLLSASQARLRDDVELRQRAFTSQASATMYLPAT
IGDYTDFYSSRHHATNVGVMFRGKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPLGQM
RPDDSKPPVYGACKLLDFELEMAFFVGPGNKLGEPIPISKAHEHIFGMVLMNDWSARDIQ
KWEYVPLGPFLGKSFGTTISPWVVPMDALMPFAVSNPEQDPKPLPYLCHDQPYTFDINLS
VALKGEGMSQAATICRSNFKYMYWTMLQQLTHHSVNGCNLQPGDLLASGTISGPEPESFG
CMLELSWKGTRAVELGNGQTRKFLLDGDEVIMTGHCQGDGYRIGFGQCAGKVLPALSFA
Enzyme 36 Number of Residues 419
Enzyme 36 Molecular Weight 46155.6
Enzyme 36 Theoretical pI 6.99
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 36 Specific Function 4-fumarylacetoacetate + H(2)O = acetoacetate + fumarate
Enzyme 36 Pathways
  • Amino-acid degradation
  • L-phenylalanine degradation
  • acetoacetate and fumarate from L-phenylalanine:step 6/6
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein 148745316 Link Image
Enzyme 36 UniProtKB/Swiss-Prot ID A5PKH3 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name FAAA_BOVIN Link Image
Enzyme 36 PDB ID 1QQJ Link Image
Enzyme 36 PDB File Show
Enzyme 36 3D Structure
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence >1260 bp
ATGTCCTTCGTCCCGGTGGCCGAGGATTCTGACTTCCCCATCCACAACCTGCCCTACGGC
GTCTTCTCCACCCGAGGCAACCCAAGACCGAGGATTGGCGTGGCCATTGGGGACCAGATC
CTGGACCTCAGTGTCATCAAGCACCTCTTCACTGGGCCGATCCTCTCCGGACACCAGGAT
GTCTTCAATAAGCCAACTCTCAACAGCTTCATGGGCCTGGGTCAGGCTGCCTGGAAGGAG
GCTAGAGCATTCTTGCAGAACCTGCTGTCTGCCAGCCAAGCCAGGCTCAGAGATGACGTG
GAGCTTCGGCAGCGTGCCTTCACATCCCAGGCTTCCGCTACGATGTATCTTCCGGCCACC
ATAGGTGACTACACGGACTTCTATTCCTCTCGGCATCATGCCACCAATGTCGGGGTTATG
TTCAGGGGCAAGGAGAATGCACTGATGCCAAACTGGCTGCACCTGCCCGTGGGCTACCAC
GGGCGCGCTTCCTCCGTGGTGGTGTCTGGCACCCCGATCCGCAGGCCCCTGGGGCAGATG
CGACCCGACGACTCTAAGCCTCCCGTTTATGGTGCCTGCAAACTCCTGGACTTCGAGTTG
GAGATGGCTTTCTTTGTAGGCCCTGGGAACAAACTCGGAGAGCCAATCCCCATTTCCAAG
GCCCACGAGCACATTTTTGGAATGGTCCTTATGAACGACTGGAGTGCTCGAGACATCCAG
AAATGGGAGTACGTCCCACTTGGGCCGTTCCTTGGGAAGAGTTTTGGAACCACCATCTCT
CCGTGGGTGGTGCCCATGGATGCCCTCATGCCCTTTGCTGTGTCCAACCCGGAGCAGGAC
CCCAAGCCCCTGCCGTATCTCTGCCATGACCAGCCCTACACATTCGACATCAACCTCTCT
GTTGCCCTGAAAGGAGAAGGAATGAGCCAGGCAGCTACCATATGCAGGTCTAATTTTAAG
TACATGTACTGGACAATGCTGCAGCAGCTCACCCACCACTCTGTCAATGGCTGCAACCTG
CAGCCGGGCGACCTCTTGGCTTCTGGAACCATCAGCGGGCCGGAGCCAGAGAGCTTCGGC
TGCATGCTGGAGCTGTCGTGGAAGGGCACAAGGGCCGTAGAGCTGGGGAATGGCCAGACC
AGGAAGTTCCTGCTGGATGGGGATGAAGTCATCATGACAGGGCACTGCCAGGGGGATGGG
TACCGCATTGGCTTCGGCCAGTGTGCGGGAAAAGTGCTGCCTGCCCTGTCGTTCGCCTGA
Enzyme 36 GenBank Gene ID BC142487 Link Image
Enzyme 36 GeneCard ID FAH Link Image
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Chromosome:1
Enzyme 36 Locus 15q23-q25
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References Not Available
Enzyme 36 Metabolite References Not Available
Enzyme 37 [top]
Enzyme 37 ID 434
Enzyme 37 Name cGMP-specific 3',5'-cyclic phosphodiesterase
Enzyme 37 Synonyms
  1. cGMP-binding cGMP-specific phosphodiesterase
  2. CGB-PDE
Enzyme 37 Gene Name PDE5A
Enzyme 37 Protein Sequence >cGMP-specific 3',5'-cyclic phosphodiesterase
MERAGPGSARPQQQWDQDSVEAWLDDHWDFTFSYFVRKGTREMVNAWFAERVHTIPVCKE
GIKGHTESCSCPLQPSPRAESSVPGTPTRKISASEFDRPLRPIVIKDSEGTVSFLSDSDK
KEQMPLTSPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENMGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEETTGKVKAFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCKWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQKRLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIK
RRGEFFELIMKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKTLINGESSQTKRN
Enzyme 37 Number of Residues 865
Enzyme 37 Molecular Weight 98625.7
Enzyme 37 Theoretical pI 5.80
Enzyme 37 GO Classification
Function
Process
Component
Enzyme 37 General Function Involved in 3',5'-cyclic-GMP phosphodiesterase activity
Enzyme 37 Specific Function Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'- GMP
Enzyme 37 Pathways
  • Purine metabolism
  • 3',5'-cyclic GMP degradation
  • GMP from 3',5'-cyclic GMP:step 1/1
Enzyme 37 Reactions Not Available
Enzyme 37 Pfam Domain Function
Enzyme 37 Signals
  • None
Enzyme 37 Transmembrane Regions
  • None
Enzyme 37 Essentiality Not Available
Enzyme 37 GenBank ID Protein 1262164 Link Image
Enzyme 37 UniProtKB/Swiss-Prot ID Q28156 Link Image
Enzyme 37 UniProtKB/Swiss-Prot Entry Name PDE5A_BOVIN Link Image
Enzyme 37 PDB ID 1T9R Link Image
Enzyme 37 PDB File Show
Enzyme 37 3D Structure
Enzyme 37 Cellular Location Not Available
Enzyme 37 Gene Sequence >2598 bp
ATGGAGAGGGCCGGCCCCGGCTCCGCGCGGCCGCAACAGCAATGGGACCAGGACTCGGTC
GAAGCGTGGCTGGACGATCACTGGGACTTTACCTTCTCTTACTTTGTTAGGAAAGGCACC
AGAGAAATGGTCAACGCATGGTTTGCTGAGAGAGTTCACACCATTCCTGTGTGCAAGGAA
GGAATCAAGGGCCACACGGAATCCTGCTCTTGCCCCTTGCAGCCAAGTCCCCGTGCAGAG
AGCAGTGTCCCTGGAACACCAACCAGGAAGATCTCTGCCTCTGAATTCGATCGGCCGCTT
AGACCCATCGTTATCAAGGATTCTGAGGGAACTGTGAGCTTCCTCTCTGACTCAGACAAG
AAGGAACAGATGCCTCTAACCTCCCCACGGTTTGATAATGATGAAGGGGACCAGTGCTCG
AGACTCTTGGAATTAGTGAAAGATATTTCTAGTCACTTGGATGTCACAGCCTTATGTCAC
AAAATTTTCTTGCACATCCATGGACTCATCTCCGCCGACCGCTACTCCTTATTCCTCGTC
TGTGAGGACAGCTCCAACGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCAGAAGGT
TCAACACTGGAAGAAGCTTCAAACAACTGCATCCGCTTAGAGTGGAACAAAGGCATCGTG
GGACACGTGGCCGCTTTTGGCGAGCCCTTGAACATCAAAGACGCCTATGAGGATCCTCGA
TTCAATGCAGAAGTTGACCAAATTACAGGCTACAAGACACAAAGTATTCTTTGTATGCCA
ATTAAGAATCATAGGGAAGAGGTTGTTGGTGTAGCCCAGGCCATCAACAAGAAATCAGGA
AATGGTGGGACATTCACTGAAAAAGACGAAAAGGACTTTGCTGCTTACTTGGCATTTTGT
GGAATTGTTCTTCATAATGCTCAACTCTATGAGACTTCACTGCTGGAGAACAAGAGAAAT
CAGGTGCTGCTTGACCTTGCTAGCTTAATTTTTGAAGAACAACAATCATTAGAAGTAATT
CTAAAGAAAATAGCTGCCACTATTATCTCTTTCATGCAGGTGCAGAAATGCACCATTTTC
ATAGTGGATGAAGATTGCTCCGATTCTTTTTCTAGTGTGTTTCACATGGAGTGTGAGGAA
TTAGAAAAATCGTCAGATACTTTAACACGGGAACGTGATGCAAACAGAATCAATTACATG
TATGCTCAGTATGTCAAAAATACCATGGAACCACTTAATATCCCAGACGTCAGTAAGGAC
AAAAGATTTCCCTGGACAAATGAAAACATGGGAAATATAAACCAGCAGTGCATTAGAAGT
TTGCTTTGTACACCTATAAAAAATGGAAAGAAGAACAAAGTGATAGGGGTTTGCCAACTT
GTTAATAAGATGGAGGAAACCACTGGCAAAGTTAAGGCTTTCAACCGCAACGATGAACAG
TTTCTGGAAGCTTTCGTCATCTTTTGTGGCTTGGGGATCCAGAACACACAGATGTACGAA
GCAGTGGAGAGAGCCATGGCCAAGCAAATGGTCACGTTAGAGGTTCTGTCTTATCATGCT
TCAGCTGCAGAGGAAGAAACCAGAGAGCTGCAGTCCTTAGCGGCTGCTGTGGTACCATCT
GCCCAGACCCTTAAAATCACTGACTTCAGCTTCAGCGACTTTGAGCTGTCTGACCTGGAA
ACAGCACTGTGCACAATCCGGATGTTCACTGACCTCAACCTTGTGCAGAACTTCCAGATG
AAACATGAGGTCCTTTGCAAGTGGATTTTAAGTGTGAAGAAGAACTATCGGAAGAACGTC
GCCTATCATAATTGGAGACATGCCTTTAATACAGCTCAGTGCATGTTTGCGGCACTAAAA
GCAGGCAAAATTCAGAAGAGGCTGACGGACCTGGAGATACTTGCACTGCTGATTGCTGCC
TTAAGCCATGATCTGGATCACCGTGGTGTCAATAACTCATACATACAGCGAAGTGAACAC
CCACTTGCTCAGCTCTACTGCCATTCAATCATGGAGCATCATCATTTTGATCAGTGCCTG
ATGATCCTTAATAGTCCTGGCAATCAGATTCTCAGTGGCCTCTCCATTGAAGAGTATAAG
ACCACCCTGAAGATCATCAAGCAAGCTATTTTAGCCACAGACCTAGCACTGTACATAAAG
AGACGAGGAGAATTTTTTGAACTTATAATGAAAAATCAATTCAATTTGGAAGATCCTCAT
CAAAAGGAGTTGTTTTTAGCGATGCTGATGACAGCTTGTGATCTTTCTGCAATTACAAAA
CCCTGGCCTATTCAACAACGGATAGCAGAACTTGTTGCCACTGAATTTTTTGACCAAGGA
GATAGAGAGAGGAAAGAACTCAACATAGAGCCCGCTGATCTAATGAACCGGGAGAAGAAA
AACAAAATCCCAAGTATGCAAGTTGGATTCATAGATGCCATCTGCTTGCAACTGTATGAG
GCCTTGACCCATGTGTCGGAGGACTGTTTCCCTTTGCTGGACGGCTGCAGAAAGAACAGG
CAGAAATGGCAGGCTCTTGCAGAACAGCAGGAGAAGACACTGATCAATGGTGAAAGCAGC
CAGACCAAGCGGAACTGA
Enzyme 37 GenBank Gene ID L16545 Link Image
Enzyme 37 GeneCard ID PDE5A Link Image
Enzyme 37 GenAtlas ID Not Available
Enzyme 37 HGNC ID Not Available
Enzyme 37 Chromosome Location Chromosome:4
Enzyme 37 Locus 4q25-q27
Enzyme 37 SNPs SNPJam Report Link Image
Enzyme 37 General References
  1. [PubMed Link Image]
Enzyme 37 Metabolite References Not Available
Enzyme 38 [top]
Enzyme 38 ID 440
Enzyme 38 Name Hypoxanthine-guanine phosphoribosyltransferase
Enzyme 38 Synonyms
  1. HGPRTase
  2. HGPRT
Enzyme 38 Gene Name HPRT1
Enzyme 38 Protein Sequence >Hypoxanthine-guanine phosphoribosyltransferase
MAARSPSVVISDDEPGYDLNLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLALVKKHKPKMVKVASLLMKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Enzyme 38 Number of Residues 218
Enzyme 38 Molecular Weight 24498.3
Enzyme 38 Theoretical pI 7.97
Enzyme 38 GO Classification
Function
Process
Component
Enzyme 38 General Function Nucleotide transport and metabolism
Enzyme 38 Specific Function IMP + diphosphate = hypoxanthine + 5-phospho- alpha-D-ribose 1-diphosphate
Enzyme 38 Pathways
  • Purine metabolism
  • IMP biosynthesis via salvage pathway
  • IMP from hypoxanthine:step 1/1
Enzyme 38 Reactions Not Available
Enzyme 38 Pfam Domain Function
Enzyme 38 Signals
  • None
Enzyme 38 Transmembrane Regions
  • None
Enzyme 38 Essentiality Not Available
Enzyme 38 GenBank ID Protein 74268428 Link Image
Enzyme 38 UniProtKB/Swiss-Prot ID Q3SZ18 Link Image
Enzyme 38 UniProtKB/Swiss-Prot Entry Name HPRT_BOVIN Link Image
Enzyme 38 PDB ID 1BZY Link Image
Enzyme 38 PDB File Show
Enzyme 38 3D Structure
Enzyme 38 Cellular Location Not Available
Enzyme 38 Gene Sequence >657 bp
ATGGCGGCCCGCAGCCCCAGCGTGGTGATTAGCGATGATGAACCAGGTTATGACCTAAAT
TTATTTTGTATACCCAATCATTATGCTGAGGATTTGGAGAAGGTGTTTATTCCTCATGGA
CTAATTATGGACAGGACCGAACGGCTGGCTCGAGATGTGATGAAGGAGATGGGTGGCCAT
CACATTGTGGCCCTCTGTGTGCTCAAGGGGGGCTATAAGTTCTTTGCCGACCTGTTGGAT
TACATCAAAGCACTGAACAGAAATAGTGACAAATCCATTCCTATGACTGTGGATTTTATC
AGACTGAAGAGCTACTGTAACGACCAGTCAACAGGCGACATAAAAGTAATTGGTGGAGAT
GATCTCTCAACTTTAACTGGAAAGAATGTCTTGATTGTCGAAGATATAATTGACACTGGG
AAGACAATGCAGACTTTGCTTGCCTTGGTCAAGAAGCATAAACCAAAGATGGTCAAGGTT
GCGAGCTTGCTGATGAAAAGGACCCCTCGAAGTGTTGGATATAAACCAGACTTTGTTGGA
TTTGAAATTCCAGACAAGTTTGTTGTGGGATATGCCCTTGACTATAATGAATACTTCAGG
GACTTGAATCACGTGTGTGTCATTAGCGAAACTGGAAAAGCAAAATACAAAGCCTAA
Enzyme 38 GenBank Gene ID BC103248 Link Image
Enzyme 38 GeneCard ID HPRT1 Link Image
Enzyme 38 GenAtlas ID Not Available
Enzyme 38 HGNC ID Not Available
Enzyme 38 Chromosome Location Not Available
Enzyme 38 Locus Xq26.1
Enzyme 38 SNPs SNPJam Report Link Image
Enzyme 38 General References Not Available
Enzyme 38 Metabolite References Not Available
Enzyme 39 [top]
Enzyme 39 ID 441
Enzyme 39 Name Galactose-3-O-sulfotransferase 3
Enzyme 39 Synonyms
  1. Gal3ST-3
  2. Gal-beta-1, 3-GalNAc 3'-sulfotransferase 3
  3. Beta-galactose-3-O-sulfotransferase 3
Enzyme 39 Gene Name GAL3ST3
Enzyme 39 Protein Sequence >Galactose-3-O-sulfotransferase 3
MPPIFQRLQQATKMSRRKILLLVLGCSTLSLLIHQGAQLSWYPKLFPLSCPPLQDSPPRP
KHMTVAFLKTHKTAGTTVQNILFRFAERHNLTVALPHPSCEHQFCYPRNFSAHFVHPATR
PPHVLASHLRFDRAELQRLMPPGTVYVTILREPAAMFESLFSYYNQYCPAFRRVPNASLE
AFLRAPEAYYRAGEHFAMFAHNTLAYDLGGDNERSPRDDDAYLAGLIRQVEEVFSLVMIA
EYFDESLVLLRRLLAWDLDDVLYARLNARAASSRLAAIPAALAQAARAWNALDAGLYDHF
NATFWRRVASAGRACVEREARELREARERLLRRCFGDEPVLRPAAQIRTKQLQPWQPSRK
VDIMGYDLPSGRAGPATEACLKLAMPEVQYSSYLLRKQKRRGGMRLRPEPVLDNPPPRPI
RALRPGH
Enzyme 39 Number of Residues 427
Enzyme 39 Molecular Weight 48698.7
Enzyme 39 Theoretical pI 10.12
Enzyme 39 GO Classification
Function
Process
Component
Enzyme 39 General Function Involved in galactosylceramide sulfotransferase activity
Enzyme 39 Specific Function Transfers a sulfate to position 3 of non-reducing beta- galactosyl residues in N-glycans and core2-branched O-glycans. Has high activity towards Gal-beta-1,4-GlcNAc, Gal-beta-1,4(Fuc-alpha- 1,3)GlcNAc and lower activity towards Gal-beta-1,3(Fuc-alpha- 1,4)GlcNAc
Enzyme 39 Pathways
  • Protein modification
  • carbohydrate sulfation
Enzyme 39 Reactions Not Available
Enzyme 39 Pfam Domain Function
Enzyme 39 Signals
  • None
Enzyme 39 Transmembrane Regions
  • 20-40
Enzyme 39 Essentiality Not Available
Enzyme 39 GenBank ID Protein 111305130 Link Image
Enzyme 39 UniProtKB/Swiss-Prot ID Q0VCH4 Link Image
Enzyme 39 UniProtKB/Swiss-Prot Entry Name G3ST3_BOVIN Link Image
Enzyme 39 PDB ID Not Available
Enzyme 39 Cellular Location Not Available
Enzyme 39 Gene Sequence >1284 bp
ATGCCGCCCATTTTCCAGCGCCTGCAGCAGGCCACCAAGATGAGCCGTAGGAAAATCCTG
CTGCTGGTGCTAGGATGCAGCACCTTAAGCCTCCTCATCCACCAGGGGGCGCAGCTCAGC
TGGTACCCCAAGCTGTTCCCTCTGAGCTGCCCGCCTCTGCAGGACTCTCCGCCGCGCCCC
AAGCACATGACCGTGGCCTTTCTGAAGACGCACAAGACTGCGGGCACGACGGTGCAGAAC
ATCCTGTTCCGTTTCGCCGAGCGCCACAACCTGACGGTGGCCCTGCCGCACCCGAGCTGC
GAGCATCAGTTCTGCTACCCGCGTAACTTCTCGGCGCACTTCGTGCACCCGGCCACGCGG
CCGCCGCACGTGCTGGCCAGCCACCTGCGCTTCGACCGCGCGGAGCTGCAGCGCCTCATG
CCGCCCGGCACCGTCTACGTCACCATCCTGCGCGAGCCGGCCGCCATGTTCGAGTCGCTC
TTCAGCTACTACAACCAGTACTGCCCCGCCTTCCGGCGCGTGCCCAACGCGTCGCTCGAG
GCCTTCCTGCGCGCGCCCGAGGCCTACTACCGCGCGGGCGAGCACTTCGCCATGTTCGCG
CACAACACCCTGGCCTACGACCTGGGAGGCGACAACGAGCGCAGCCCCCGCGACGACGAC
GCCTACCTGGCGGGCCTCATCCGCCAGGTGGAGGAGGTTTTCTCGCTCGTCATGATCGCC
GAGTACTTCGACGAGTCGCTCGTGCTGCTGCGGCGCCTGCTGGCCTGGGACCTGGACGAC
GTGCTCTACGCCAGGCTCAACGCGCGCGCCGCCAGCTCGCGCCTCGCCGCCATCCCCGCG
GCGCTCGCGCAGGCTGCGCGCGCCTGGAACGCGCTCGACGCCGGCCTCTACGACCACTTC
AACGCCACCTTCTGGCGCCGCGTGGCGAGTGCTGGCCGCGCCTGCGTGGAGCGCGAGGCG
CGCGAGTTGCGCGAGGCCCGAGAGCGCCTGCTGCGGCGTTGCTTTGGCGACGAGCCGGTG
TTGCGGCCCGCGGCCCAGATCCGCACCAAGCAGCTGCAGCCGTGGCAGCCCAGCCGCAAG
GTGGACATCATGGGCTACGACCTGCCCAGCGGCCGCGCCGGTCCAGCCACCGAGGCCTGC
CTCAAGCTGGCCATGCCTGAGGTGCAGTACTCAAGCTACCTGCTGCGCAAGCAGAAGCGC
CGAGGAGGCATGCGCCTCCGGCCCGAACCGGTCCTAGACAACCCCCCTCCTCGGCCCATC
CGGGCGCTGCGCCCAGGCCACTGA
Enzyme 39 GenBank Gene ID BC120166 Link Image
Enzyme 39 GeneCard ID GAL3ST3 Link Image
Enzyme 39 GenAtlas ID Not Available
Enzyme 39 HGNC ID Not Available
Enzyme 39 Chromosome Location Chromosome:1
Enzyme 39 Locus 11q13.1
Enzyme 39 SNPs SNPJam Report Link Image
Enzyme 39 General References Not Available
Enzyme 39 Metabolite References Not Available
Enzyme 40 [top]
Enzyme 40 ID 442
Enzyme 40 Name Adenylate cyclase type 1
Enzyme 40 Synonyms
  1. Adenylate cyclase type I
  2. ATP pyrophosphate-lyase 1
  3. Adenylyl cyclase 1
  4. Ca(2+)/calmodulin-activated adenylyl cyclase
Enzyme 40 Gene Name ADCY1
Enzyme 40 Protein Sequence >Adenylate cyclase type 1
MAGAPRGRGGGGGGGGAGESGGAERAAGPGGRRGLRACDEEFACPELEALFRGYTLRLEQ
AATLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQ
LQQVGQLALLFSLTFALLCCPFALGGPAGAHAGAAAVPATADQGVWQLLLVTFVSYALLP
VRSLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLGVNVYGIFVRILAERA
QRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQR
HDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVS
GLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDV
WSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKTHNIETFFIVP
SHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRA
LRTASEKLRNRSSFSTNVVQTTPGTRVNRYIGRLLEARQMELEMADLNFFTLKYKQAERE
RKYHQLQDEYFTSAVVLALILAALFGLVYLLIIPQSVAVLLLLVFCICFLVACVLYLHIT
RVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWSWSSSPNGSLVVLSSGGRDPV
LPVPPCESAPHALLCGLVGTLPLAIFLRVSSLPKMILLAVLTTSYILVLELSGYTKAMGA
GAISGRSFEPIMAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERDDMEKVKLDNKRIL
FNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLL
NEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAGTKAKKCISSHLSTLADFAIE
MFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGR
IQVTEEVHRLLRRGSYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQTRSLNSERKMYPF
GRAGLQTRLAAGHPPVPPAAGLPVGAGPGALQGSGLAPGPPGQHLPPGASGKEA
Enzyme 40 Number of Residues 1134
Enzyme 40 Molecular Weight 123977.5
Enzyme 40 Theoretical pI 8.42
Enzyme 40 GO Classification
Function
Process
Component
Enzyme 40 General Function Signal transduction mechanisms
Enzyme 40 Specific Function This is a calmodulin-sensitive adenylyl cyclase. May be involved in regulatory processes in the central nervous system. It may play a role in memory acquisition and learning
Enzyme 40 Pathways Not Available
Enzyme 40 Reactions Not Available
Enzyme 40 Pfam Domain Function
Enzyme 40 Signals
  • None
Enzyme 40 Transmembrane Regions
  • 66-86 90-110 127-147 154-174 184-204 216-236 613-633 637-657 676-696 727-747 755-775 777-797
Enzyme 40 Essentiality Not Available
Enzyme 40 GenBank ID Protein 162613 Link Image
Enzyme 40 UniProtKB/Swiss-Prot ID P19754 Link Image
Enzyme 40 UniProtKB/Swiss-Prot Entry Name ADCY1_BOVIN Link Image
Enzyme 40 PDB ID Not Available
Enzyme 40 Cellular Location Not Available
Enzyme 40 Gene Sequence >3405 bp
ATGGCGGGGGCGCCGCGCGGCCGAGGCGGCGGCGGAGGCGGAGGCGGCGCGGGCGAGTCT
GGGGGCGCCGAGCGGGCGGCGGGGCCGGGCGGCCGGCGCGGGCTGCGGGCGTGCGATGAG
GAGTTCGCGTGCCCCGAGCTGGAGGCGCTGTTCCGCGGCTACACGCTGCGGCTGGAGCAG
GCGGCGACGCTGAAGGCGCTGGCCGTGCTCAGCCTGCTGGCGGGCGCGCTGGCCCTGGCC
GAGCTGCTGGGCGCGCCGGGGCCCGCGCCCGGCCTGGCTAAGGGCTCGCACCCCGTGCAC
TGCGTGCTCTTCCTGGCGCTGCTCGTGGTCACCAACGTCCGCTCGCTGCAGGTGCCCCAG
CTGCAGCAGGTCGGCCAGCTCGCGCTGCTCTTCAGCCTCACCTTCGCTCTGCTGTGCTGT
CCCTTCGCGCTCGGCGGCCCCGCCGGTGCCCACGCCGGGGCGGCAGCGGTGCCGGCGACA
GCCGATCAGGGAGTCTGGCAGCTCCTTTTGGTCACCTTCGTGTCCTATGCCCTGCTGCCC
GTGCGCAGCCTGCTGGCCATCGGCTTCGGGCTCGTGGTGGCCGCCTCGCACTTGCTGGTC
ACGGCTACGTTGGTCCCCGCCAAGCGCCCACGTCTCTGGAGAACGCTGGGTGCCAACGCT
CTGCTCTTCCTCGGTGTGAACGTGTATGGCATCTTCGTGAGGATCCTGGCTGAGCGCGCC
CAGAGGAAGGCCTTCCTGCAGGCCCGGAACTGCATTGAGGACCGGCTGAGGCTGGAGGAT
GAGAATGAGAAGCAGGAGCGGCTGCTCATGAGCCTCCTGCCTCGGAATGTTGCCATGGAG
ATGAAGGAGGACTTCCTGAAGCCCCCTGAGAGGATTTTCCACAAGATTTACATCCAGCGG
CATGACAACGTGAGCATCCTCTTTGCAGACATCGTGGGCTTCACAGGCTTGGCGTCACAG
TGCACGGCCCAGGAGCTGGTGAAACTCCTCAATGAGCTCTTCGGGAAGTTTGACGAGCTG
GCCACAGAGAACCACTGCCGCCGCATCAAGATCCTGGGAGATTGCTACTACTGCGTGTCT
GGCCTCACTCAGCCCAAGACTGACCACGCCCACTGCTGTGTGGAGATGGGCCTGGACATG
ATCGACACCATCACGTCCGTGGCTGAGGCCACTGAGGTGGACTTGAACATGCGTGTGGGG
CTGCACACCGGCAGGGTCCTCTGCGGGGTCCTGGGCCTGCGTAAGTGGCAGTATGATGTG
TGGTCCAACGACGTGACCCTGGCCAACGTCATGGAGGCTGCCGGCCTGCCTGGGAAGGTT
CACATCACAAAGACCACCCTGGCGTGCCTGAATGGTGACTATGAGGTGGAGCCGGGACAC
GGACACGAGAGGAACAGTTTTCTGAAAACTCATAACATTGAGACCTTTTTTATTGTGCCC
TCGCATCGGCGAAAGATATTTCCAGGGCTGATTCTCTCAGACATAAAACCGGCCAAGAGG
ATGAAGTTCAAGACCGTGTGCTACCTGCTGGTGCAGCTCATGCACTGCCGGAAGATGTTC
AAGGCCGAGATCCCTTTCTCCAACGTCATGACCTGTGAGGATGACGACAAGCGGAGGGCA
CTGAGAACAGCCTCGGAAAAACTCAGAAACCGCTCGTCTTTCTCTACAAACGTTGTCCAA
ACCACCCCCGGCACACGTGTCAACAGGTACATCGGCCGCCTCCTGGAAGCCCGCCAGATG
GAGCTGGAGATGGCAGACCTGAACTTCTTCACCCTGAAGTACAAGCAAGCTGAGCGAGAG
CGAAAGTACCACCAGCTTCAGGACGAGTATTTCACCAGCGCCGTGGTTCTGGCTCTCATT
CTGGCCGCCTTATTCGGCCTTGTCTACCTTCTAATAATCCCACAGAGTGTGGCTGTCCTG
CTCCTGCTGGTGTTCTGCATCTGCTTCCTGGTGGCCTGTGTCCTGTACCTACACATCACC
CGGGTCCAGTGTTTTCCAGGGTGCCTGACCATCCAGATCCGCACCGTCTTGTGCATCTTC
ATCGTGGTCTTAATCTACTCTGTGGCCCAAGGCTGTGTGGTGGGCTGCCTGCCTTGGTCC
TGGAGCTCCAGTCCCAACGGGTCCCTGGTGGTCCTGTCTTCTGGGGGCCGGGACCCAGTG
CTGCCTGTCCCGCCCTGCGAGTCTGCGCCCCATGCCCTGCTGTGCGGCCTCGTGGGCACC
CTCCCGCTGGCCATATTCCTGCGGGTCTCCTCCTTGCCAAAAATGATCCTGCTCGCCGTG
CTCACCACCTCCTACATCCTCGTCCTGGAGCTCAGCGGGTACACGAAGGCCATGGGGGCC
GGTGCCATCTCAGGGCGCAGCTTCGAGCCGATCATGGCCATCCTGCTATTCTCGTGCACG
CTGGCCCTGCACGCCCGGCAGGTGGATGTCAAGCTGCGGCTGGACTACCTCTGGGCGGCC
CAGGCAGAGGAGGAGCGGGATGACATGGAGAAAGTGAAGCTGGACAACAAGAGGATTCTC
TTCAACCTCCTGCCAGCCCACGTTGCCCAGCACTTCCTAATGTCCAACCCTCGCAACATG
GACCTGTATTACCAGTCATACTCGCAGGTGGGGGTCATGTTTGCATCCATCCCCAACTTC
AATGACTTCTACATCGAGCTGGATGGCAACAACATGGGGGTGGAATGTCTACGCCTTCTG
AATGAGATCATCGCTGACTTTGATGAGCTCATGGACAAAGACTTTTACAAGGACCTAGAG
AAGATCAAGACCATTGGGAGCACGTACATGGCTGCTGTGGGGCTGGCGCCCACTGCTGGG
ACCAAGGCTAAGAAGTGCATCTCCTCCCACCTCAGCACGTTGGCAGATTTTGCCATCGAG
ATGTTTGATGTCCTGGATGAGATCAACTACCAGTCTTATAACGACTTTGTGCTCCGTGTT
GGCATCAATGTTGGCCCCGTGGTGGCTGGAGTGATCGGGGCTCGCAGGCCGCAGTATGAC
ATTTGGGGGAACACGGTCAATGTGGCCAGTCGGATGGACAGTACCGGCGTCCAGGGCAGG
ATCCAGGTCACAGAGGAAGTTCACCGGCTGCTGCGGCGGGGTTCCTACCGCTTCGTGTGC
CGAGGCAAAGTCAGTGTCAAGGGCAAGGGTGAGATGCTGACATACTTCCTGGAAGGCAGG
ACCGATGGAAATGGCTCCCAAACCAGGTCCCTGAACTCAGAGCGGAAAATGTATCCTTTC
GGAAGAGCTGGCCTCCAGACCAGACTGGCTGCGGGTCACCCCCCGGTACCTCCTGCAGCC
GGCCTCCCAGTTGGAGCTGGGCCAGGGGCTCTGCAGGGCTCGGGGCTTGCCCCAGGCCCC
CCAGGCCAACACCTGCCCCCTGGAGCCTCTGGGAAGGAGGCTTAG
Enzyme 40 GenBank Gene ID M25579 Link Image
Enzyme 40 GeneCard ID ADCY1 Link Image
Enzyme 40 GenAtlas ID Not Available
Enzyme 40 HGNC ID Not Available
Enzyme 40 Chromosome Location Chromosome:7
Enzyme 40 Locus 7p13-p12
Enzyme 40 SNPs SNPJam Report Link Image
Enzyme 40 General References
  1. [PubMed Link Image]
Enzyme 40 Metabolite References Not Available
Enzyme 41 [top]
Enzyme 41 ID 443
Enzyme 41 Name Poly(A)-specific ribonuclease PARN
Enzyme 41 Synonyms
  1. Polyadenylate-specific ribonuclease
  2. Deadenylating nuclease
  3. Deadenylation nuclease
Enzyme 41 Gene Name PARN
Enzyme 41 Protein Sequence >Poly(A)-specific ribonuclease PARN
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKH
SMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQG
FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQSNGAGALSYTSPNTSKCPVTIPDDQKKF
IDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIV
ISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF
YCPLPADLNEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFNPPKV
ESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKSHVSARSKLIEPFFN
KLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTS
AFVSLSQPEQVPIAVNTSKYAESYRIQTYADYVGKKREEKQMKRKWTEDSWKEVEPKRLN
TQCGSYSLQNHHYHANSLTATSTVGKRNLSPSRAEAGLEARASGEISDTELEQTDPCAEP
LSEGRKKAKKLKRMKKDLSPTGSISDSSAKLFEVPDTW
Enzyme 41 Number of Residues 638
Enzyme 41 Molecular Weight 73181.0
Enzyme 41 Theoretical pI 6.47
Enzyme 41 GO Classification
Function
Process
Component
Enzyme 41 General Function Involved in magnesium ion binding
Enzyme 41 Specific Function 3'-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization. Interacts with both the 3'-end poly(A) tail and the 5'-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails
Enzyme 41 Pathways Not Available
Enzyme 41 Reactions Not Available
Enzyme 41 Pfam Domain Function
Enzyme 41 Signals
  • None
Enzyme 41 Transmembrane Regions
  • None
Enzyme 41 Essentiality Not Available
Enzyme 41 GenBank ID Protein 151556271 Link Image
Enzyme 41 UniProtKB/Swiss-Prot ID P69341 Link Image
Enzyme 41 UniProtKB/Swiss-Prot Entry Name PARN_BOVIN Link Image
Enzyme 41 PDB ID 1WHV Link Image
Enzyme 41 PDB File Show
Enzyme 41 3D Structure
Enzyme 41 Cellular Location Not Available
Enzyme 41 Gene Sequence >1917 bp
ATGGAGATAATCAGGAGCAATTTTAAGAGTAATCTTCACAAAGTGTACCAGGCCATAGAG
GAGGCCGACTTCTTCGCCATCGATGGGGAGTTCTCAGGAATCAGCGATGGACCTTCAGTC
ACCGCATTAACAAATGGTTTTGACACTCCAGAAGAAAGGTATCAGAAGCTTAAAAAGCAT
TCCATGGACTTTTTGCTGTTTCAGTTTGGCCTTTGCACTTTTAAGTATGACTACACAGAT
TCAAAGTATATAACAAAGTCTTTTAACTTCTATGTTTTCCCGAAACCCTTCAATAGATCC
TCACCAGATGTCAAATTTGTTTGTCAGAGCTCAAGCATTGACTTTCTAGCAAGCCAAGGA
TTTGATTTTAATAAAGTTTTTCGCAACGGAATTCCGTACTTAAACCAGGAAGAAGAAAGA
CAGTTAAGAGAGCAGTATGATGAGAAGCGTTCACAGTCCAACGGTGCAGGTGCTCTGTCC
TACACGTCTCCCAACACTTCAAAGTGTCCCGTGACAATTCCTGACGATCAGAAGAAGTTT
ATTGACCAAGTGGTAGAGAAAATAGAAGATTTATTACAAAGTGAAGAAAACAAGAACTTG
GATTTAGAGCCGTGTACTGGGTTCCAAAGAAAACTGATATATCAGACTTTGAGCTGGAAG
TATCCCAAAGGCATTCATGTTGAGACTTTAGAAACCGAAAAGAAAGAGCGATATATTGTT
ATCAGCAAAGTAGATGAAGAAGAACGCAAAAGAAGAGAGCAACAGAAACATGCTAAGGAA
CAGGAAGAACTGAATGATGCTGTGGGATTTTCTAGAGTCATTCATGCCATTGCTAATTCG
GGGAAGCTTGTCATTGGACACAACATGCTCTTGGATGTCATGCACACGGTTCATCAGTTC
TACTGCCCTCTGCCTGCGGACTTAAATGAATTTAAGGAGATGACAACATGTGTTTTCCCC
AGGCTCTTGGATACAAAATTGATGGCCAGCACACAACCTTTTAAGGATATCATTAACAAC
ACATCCCTTGCAGAATTGGAAAAGCGGTTAAAAGAGACACCTTTCAACCCTCCTAAAGTT
GAAAGTGCAGAAGGCTTTCCAAGTTATGACACGGCTTCTGAACAGCTCCACGAGGCAGGC
TATGATGCTTATATCACAGGACTGTGTTTCATCTCCATGGCCAACTACCTAGGTTCTTTT
CTTAGTCCTCCAAAGAGTCATGTGTCTGCCAGATCAAAACTCATCGAACCTTTTTTTAAC
AAGTTGTTTCTTATGAGAGTCATGGATATCCCCTATCTAAACTTGGAAGGACCAGACTTG
CAGCCTAAACGTGATCACGTCCTCCACGTGACATTCCCCAAAGAATGGAAAACCAGCGAC
CTTTACCAGCTTTTCAGTGCCTTTGGTAACATTCAGATATCTTGGATTGATGACACATCA
GCATTTGTTTCTCTCAGCCAACCTGAACAAGTGCCGATTGCTGTCAATACCAGCAAGTAT
GCAGAGAGCTATCGCATCCAGACCTACGCTGACTATGTCGGGAAAAAACGAGAGGAGAAG
CAGATGAAGAGAAAGTGGACAGAAGATAGTTGGAAGGAGGTTGAGCCAAAGCGGCTAAAC
ACGCAGTGTGGCTCCTACAGTTTGCAGAATCACCATTACCACGCCAACAGTCTCACAGCC
ACCAGCACAGTAGGAAAGAGAAACCTGAGTCCCAGTCGAGCAGAAGCCGGCCTGGAGGCC
CGAGCATCGGGGGAGATTTCTGACACTGAGCTTGAGCAGACAGATCCCTGTGCAGAACCC
CTCTCAGAGGGAAGGAAAAAGGCCAAGAAACTAAAAAGGATGAAGAAGGACCTTTCTCCA
ACAGGAAGCATCTCAGACAGCTCGGCCAAGCTCTTCGAAGTCCCCGACACATGGTAA
Enzyme 41 GenBank Gene ID BC150015 Link Image
Enzyme 41 GeneCard ID PARN Link Image
Enzyme 41 GenAtlas ID Not Available
Enzyme 41 HGNC ID Not Available
Enzyme 41 Chromosome Location Chromosome:1
Enzyme 41 Locus 16p13
Enzyme 41 SNPs SNPJam Report Link Image
Enzyme 41 General References
  1. [PubMed Link Image]
Enzyme 41 Metabolite References Not Available
Enzyme 42 [top]
Enzyme 42 ID 444
Enzyme 42 Name U8 snoRNA-decapping enzyme
Enzyme 42 Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 16
  2. Nudix motif 16
Enzyme 42 Gene Name NUDT16
Enzyme 42 Protein Sequence >U8 snoRNA-decapping enzyme
MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG
FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL
TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL
LEPGSFARLKISTPP
Enzyme 42 Number of Residues 195
Enzyme 42 Molecular Weight 21398.4
Enzyme 42 Theoretical pI 7.17
Enzyme 42 GO Classification
Function
Process
Component
Enzyme 42 General Function Involved in hydrolase activity
Enzyme 42 Specific Function RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro)
Enzyme 42 Pathways Not Available
Enzyme 42 Reactions Not Available
Enzyme 42 Pfam Domain Function
Enzyme 42 Signals
  • None
Enzyme 42 Transmembrane Regions
  • None
Enzyme 42 Essentiality Not Available
Enzyme 42 GenBank ID Protein 119224036 Link Image
Enzyme 42 UniProtKB/Swiss-Prot ID A1A4Q9 Link Image
Enzyme 42 UniProtKB/Swiss-Prot Entry Name NUD16_BOVIN Link Image
Enzyme 42 PDB ID Not Available
Enzyme 42 Cellular Location Not Available
Enzyme 42 Gene Sequence >588 bp
ATGGCCGGTATGCGTAGGCTTGAGCTGTCGGAAGCCCTGCATCTGGGGCCGGGCTGGCGG
CACGCGTGCCACGCGCTGCTCTACGCACCGGACCCAGGGCTGCTCTTTGGCCGCATTCCG
CTACGCTACGCCGTGCTGATGCAGATGCGCTTTGATGGGCGCCTGGGCTTCCCTGGCGGC
TTCGTGGACTTGCGCGACGGCAGCTTGGAGGACGGGCTGAATCGCGAGTTGGGCGAGGAG
CTGGGCGAGGCTGCGGGCGCCTTTCGTGTGGAGCGCGCTGACTACCGCAGCTCCCACGCT
GGGTCCCGGCCGCGCGTGGTGGCGCACTTCTACACTAAGCTCCTGACCCTGGAGCAGCTG
ACTGCGGTGGAGATGGGCGCGCCTCGCGCCCGAGACCACGGGCTGGAGGTGCTGGGCCTG
GTGCGGGTGCCCCTGTATACCCTGCGGGATGGTGTGGGAGGCCTGCCTGCCTTCCTGGAG
AATACCTTTATTGGAAATGCACGGGAACAGCTGCTGGAAGCCGTCCAGAACCTGGGACTG
CTGGAACCTGGCTCTTTTGCACGCCTTAAGATTTCAACTCCTCCCTAG
Enzyme 42 GenBank Gene ID BC126814 Link Image
Enzyme 42 GeneCard ID NUDT16 Link Image
Enzyme 42 GenAtlas ID Not Available
Enzyme 42 HGNC ID Not Available
Enzyme 42 Chromosome Location Chromosome:3
Enzyme 42 Locus 3q22.1
Enzyme 42 SNPs SNPJam Report Link Image
Enzyme 42 General References Not Available
Enzyme 42 Metabolite References Not Available
Enzyme 43 [top]
Enzyme 43 ID 445
Enzyme 43 Name Diphosphoinositol polyphosphate phosphohydrolase 3-beta
Enzyme 43 Synonyms
  1. DIPP-3-beta
  2. DIPP3-beta
  3. Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta
  4. Nucleoside diphosphate-linked moiety X motif 11
  5. Nudix motif 11
Enzyme 43 Gene Name NUDT11
Enzyme 43 Protein Sequence >Diphosphoinositol polyphosphate phosphohydrolase 3-beta
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVFEEAGVKGKLGRLLGNFEQNQDRKHRTYVYVLTVTEILEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLQKLKLGGSPTNGNSVAPSPPEGDP
Enzyme 43 Number of Residues 164
Enzyme 43 Molecular Weight 18518.8
Enzyme 43 Theoretical pI 6.28
Enzyme 43 GO Classification
Function
Process
Component
Enzyme 43 General Function Replication, recombination and repair
Enzyme 43 Specific Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyzes the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate
Enzyme 43 Pathways Not Available
Enzyme 43 Reactions Not Available
Enzyme 43 Pfam Domain Function
Enzyme 43 Signals
  • None
Enzyme 43 Transmembrane Regions
  • None
Enzyme 43 Essentiality Not Available
Enzyme 43 GenBank ID Protein 61555249 Link Image
Enzyme 43 UniProtKB/Swiss-Prot ID Q58CW0 Link Image
Enzyme 43 UniProtKB/Swiss-Prot Entry Name NUD11_BOVIN Link Image
Enzyme 43 PDB ID Not Available
Enzyme 43 Cellular Location Not Available
Enzyme 43 Gene Sequence >804 bp
ATGAAGTGCAAGCCGAACCAGACGCGGACCTACGACCCGGAGGGGTTCAAGAAGCGGGCG
GCGTGCCTGTGCTTCCGGAGCGAGCGCGAGGACGAGGTGCTGTTAGTGAGTAGCAGTCGG
TACCCGGACCGCTGGATCGTGCCGGGCGGGGGCATGGAGCCCGAGGAGGAGCCGGGCGGT
GCGGCCGTCCGCGAGGTGTTTGAAGAAGCGGGAGTCAAGGGGAAGTTAGGCCGGCTCCTG
GGCAATTTCGAGCAGAACCAAGATCGCAAGCACAGAACGTACGTGTATGTACTGACTGTC
ACTGAGATTCTGGAGGATTGGGAAGATTCGGTTAGCATTGGGAGGAAGCGAGAGTGGTTC
AAAGTCGAAGATGCGATCAAGGTTCTCCAGTGCCACAAGCCCGTGCATGCCGAATATCTG
CAAAAACTAAAGCTGGGCGGTTCCCCAACCAATGGAAACTCCGTGGCCCCGTCCCCCGCC
GGAGGGCGATCCCTAGTGAATGGCATAGATGTTCAGATTTACTTTGAAAGAATCAAGTAT
ATGAACCCAGTGATGAATGGAATTATGAAGACAGGTGAGCTCTTTCACACTCCCAAGGAC
ACAGCTCGTCCTATCCTTTTGGACACTTCCTCCCTGTTTATTGCAATGACTATTCTCCAG
GTTGTTGCACTACTTCTGTATCTGTACAGACTTCTAATTTGGCACCTATGGCCTTCTTTG
TGCTCTTATGATTATGTGTCTGTATTTCCCACCAGGTTATGTGACCTTGAGTGCAAAGAC
CTTATTTCTTTCATCTTTTTATAA
Enzyme 43 GenBank Gene ID BT021837 Link Image
Enzyme 43 GeneCard ID NUDT11 Link Image
Enzyme 43 GenAtlas ID Not Available
Enzyme 43 HGNC ID Not Available
Enzyme 43 Chromosome Location Not Available
Enzyme 43 Locus Xp11.22
Enzyme 43 SNPs SNPJam Report Link Image
Enzyme 43 General References
  1. [PubMed Link Image]
Enzyme 43 Metabolite References Not Available
Enzyme 44 [top]
Enzyme 44 ID 446
Enzyme 44 Name Phosphoglucomutase-1
Enzyme 44 Synonyms
  1. PGM 1
  2. Glucose phosphomutase 1
Enzyme 44 Gene Name PGM1
Enzyme 44 Protein Sequence >Phosphoglucomutase-1
MVKIVTVKTKAYQDQKPGTSGLRKRVKVFQSSSNYAENFIQSIISTVEPAQRQEATLVVG
GDGRFYMKEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNP
GGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLHVDLGVLGKQQFDLENK
FKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEE
LGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKTGEHDFGAAFDGDGDRNMILGKH
GFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWK
FFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKY
GRNFFTRYDYEEVEAEGANKMMKELEALISDRSFVGKQFPVGDKVYTVEKIDNFEYSDPV
DGSISRNQGLRLLFADGSRIIFRLSGTGSAGATIRLYIDSYEKDLAKIYQDPQVMLAPLI
SIALKVSQLQEKTGRTAPTVIT
Enzyme 44 Number of Residues 562
Enzyme 44 Molecular Weight 61588.9
Enzyme 44 Theoretical pI 6.80
Enzyme 44 GO Classification
Function
Process
Component
Enzyme 44 General Function Carbohydrate transport and metabolism
Enzyme 44 Specific Function This enzyme participates in both the breakdown and synthesis of glucose
Enzyme 44 Pathways Not Available
Enzyme 44 Reactions Not Available
Enzyme 44 Pfam Domain Function
Enzyme 44 Signals
  • None
Enzyme 44 Transmembrane Regions
  • None
Enzyme 44 Essentiality Not Available
Enzyme 44 GenBank ID Protein 115305028 Link Image
Enzyme 44 UniProtKB/Swiss-Prot ID Q08DP0 Link Image
Enzyme 44 UniProtKB/Swiss-Prot Entry Name PGM1_BOVIN Link Image
Enzyme 44 PDB ID 1C47 Link Image
Enzyme 44 PDB File Show
Enzyme 44 3D Structure
Enzyme 44 Cellular Location Not Available
Enzyme 44 Gene Sequence >1689 bp
ATGGTGAAGATCGTGACCGTTAAGACCAAGGCGTACCAAGACCAGAAGCCGGGCACGAGC
GGGCTGCGGAAGCGGGTGAAGGTGTTTCAGAGCAGCTCCAACTATGCCGAGAATTTCATC
CAGAGTATCATCTCCACCGTGGAGCCGGCGCAGCGGCAGGAGGCCACCCTGGTGGTGGGC
GGGGACGGCAGGTTCTACATGAAGGAGGCCATCCAGCTCATCGTCCGCATCGCCGCCGCC
AACGGGATTGGTCGCTTGGTTATTGGACAGAATGGAATCCTCTCCACGCCTGCTGTATCA
TGCATCATTAGAAAGATCAAAGCCATCGGTGGGATCATTCTGACAGCCAGCCACAACCCA
GGAGGACCCAATGGAGATTTTGGAATCAAGTTCAATATTTCCAATGGAGGTCCTGCCCCG
GAAGCAATAACTGATAAAATTTTCCAAATCAGCAAGACCATCGAAGAATATGCAATTTGC
CCTGACCTGCATGTAGACCTTGGGGTTCTGGGAAAGCAGCAGTTTGACCTGGAAAACAAG
TTCAAACCCTTCACAGTGGAAATTGTGGATTCGGTGGAAGCTTATGCTACAATGCTGAGA
AACATCTTTGATTTTAACGCGCTGAAAGAACTGCTTTCTGGTCCAAACCGACTAAAGATC
CGTATAGACGCCATGCATGGAGTCGTGGGACCATATGTGAAAAAAATCCTCTGTGAAGAA
CTCGGCGCCCCCGCGAACTCGGCAGTGAACTGTGTTCCCCTGGAGGACTTTGGAGGCCAC
CACCCTGACCCCAACCTCACCTACGCAGCTGACCTGGTGGAGACTATGAAGACAGGAGAG
CATGATTTTGGGGCTGCCTTTGATGGAGATGGGGATCGGAACATGATTCTGGGCAAGCAC
GGGTTCTTCGTGAACCCTTCAGACTCTGTGGCTGTCATTGCTGCCAACATCTTCAGCATT
CCATACTTCCAGCAAACTGGGGTCCGTGGCTTCGCACGCAGCATGCCCACCAGTGGTGCC
CTGGACCGGGTGGCTAATGCTACAAAGATCGCTTTGTATGAGACCCCAACTGGCTGGAAG
TTTTTTGGGAATCTGATGGATGCAAGCAAACTGTCCCTTTGTGGGGAGGAGAGCTTCGGG
ACTGGTTCTGACCACATCCGTGAGAAAGATGGTCTCTGGGCTGTCCTCGCTTGGCTCTCC
ATCCTAGCCACCCGCAAACAGAGTGTGGAGGACATTCTTAAAGATCACTGGCAAAAGTAT
GGGCGGAATTTCTTCACCAGGTATGATTATGAGGAGGTGGAAGCCGAGGGCGCAAACAAA
ATGATGAAGGAGTTGGAGGCCCTGATTTCTGATCGCTCCTTCGTGGGGAAACAGTTTCCA
GTGGGTGACAAAGTTTACACCGTGGAAAAAATTGATAACTTTGAGTATAGCGATCCGGTG
GATGGAAGCATTTCAAGAAATCAGGGCTTGCGGCTCCTTTTTGCAGATGGTTCTCGCATC
ATCTTTCGACTGAGCGGCACTGGGAGCGCGGGCGCCACCATCCGACTGTACATCGACAGC
TATGAGAAGGATCTTGCCAAGATCTACCAGGACCCCCAGGTCATGTTGGCCCCCCTTATT
TCCATTGCCCTGAAGGTGTCCCAGCTCCAGGAAAAGACGGGACGCACGGCACCCACTGTC
ATCACCTAA
Enzyme 44 GenBank Gene ID BC123640 Link Image
Enzyme 44 GeneCard ID PGM1 Link Image
Enzyme 44 GenAtlas ID Not Available
Enzyme 44 HGNC ID Not Available
Enzyme 44 Chromosome Location Chromosome:1
Enzyme 44 Locus 1p31
Enzyme 44 SNPs SNPJam Report Link Image
Enzyme 44 General References Not Available
Enzyme 44 Metabolite References Not Available
Enzyme 45 [top]
Enzyme 45 ID 447
Enzyme 45 Name DNA-(apurinic or apyrimidinic site) lyase
Enzyme 45 Synonyms
  1. Apurinic-apyrimidinic endonuclease 1
  2. AP endonuclease 1
  3. APEX nuclease
  4. APEN
Enzyme 45 Gene Name APEX1
Enzyme 45 Protein Sequence >DNA-(apurinic or apyrimidinic site) lyase
MPKRGKKGAVVEDAEEPKTEPEAKKSKAGAKKNEKEAVGEGAVLYEDPPDQKTSPSGKSA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPVELQELSGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEYDAFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLTDSFRHLYPNTAYAYTFWTYMMNARSKNVGWRLDYFLLSQSVLPALCDSKI
RSKALGSDHCPITLYLAL
Enzyme 45 Number of Residues 318
Enzyme 45 Molecular Weight 35569.3
Enzyme 45 Theoretical pI 8.25
Enzyme 45 GO Classification
Function
Process
Component
Enzyme 45 General Function Replication, recombination and repair
Enzyme 45 Specific Function Repairs oxidative DNA damages in vitro. May have a role in protection against cell lethality and suppression of mutations. Removes the blocking groups from the 3'-termini of the DNA strand breaks generated by ionizing radiations and bleomycin
Enzyme 45 Pathways Not Available
Enzyme 45 Reactions Not Available
Enzyme 45 Pfam Domain Function
Enzyme 45 Signals
  • None
Enzyme 45 Transmembrane Regions
  • None
Enzyme 45 Essentiality Not Available
Enzyme 45 GenBank ID Protein 118 Link Image
Enzyme 45 UniProtKB/Swiss-Prot ID P23196 Link Image
Enzyme 45 UniProtKB/Swiss-Prot Entry Name APEX1_BOVIN Link Image
Enzyme 45 PDB ID 1HD7 Link Image
Enzyme 45 PDB File Show
Enzyme 45 3D Structure
Enzyme 45 Cellular Location Not Available
Enzyme 45 Gene Sequence >957 bp
ATGCCGAAACGTGGGAAAAAGGGAGCGGTGGTCGAAGACGCGGAAGAGCCCAAGACTGAG
CCAGAGGCGAAGAAGAGTAAGGCAGGAGCGAAAAAGAACGAAAAAGAGGCAGTAGGAGAG
GGCGCAGTTCTGTATGAAGACCCCCCAGATCAGAAAACCTCACCCAGTGGCAAATCAGCC
ACACTCAAGATCTGCTCGTGGAATGTGGATGGGCTTCGAGCCTGGATTAAGAAGAAAGGT
TTAGATTGGGTAAAGGAAGAAGCCCCAGACATCCTGTGCCTCCAAGAGACGAAATGTTCA
GAGAACAAACTACCAGTTGAACTTCAAGAACTGTCTGGATTGTCCCATCAGTACTGGTCA
GCTCCTTCAGACAAGGAAGGGTACAGTGGTGTGGGCCTCCTCTCCCGCCAGTGCCCACTC
AAAGTCTCTTATGGCATTGGTGAGGAAGAACATGATCAGGAAGGCCGAGTGATTGTGGCT
GAATATGACGCATTTGTGCTGGTGACAGCCTATGTGCCTAATGCAGGCCGAGGTCTGGTG
CGCCTGGAGTATCGCCAGCGCTGGGATGAAGCTTTTCGCAAATTCCTGAAGGGTTTGGCA
TCCCGCAAGCCCCTTGTGCTATGTGGGGACCTCAATGTGGCTCATGAAGAAATTGACCTT
CGCAACCCGAAGGGAAATAAAAAGAATGCTGGCTTCACTCCACAAGAGCGGCAGGGCTTC
GGGGAATTGCTGCAGGCTGTGCCACTCACTGACAGTTTCCGGCATCTCTACCCCAACACC
GCCTATGCCTACACCTTCTGGACCTATATGATGAATGCGCGATCCAAAAACGTTGGTTGG
CGCCTTGATTATTTTTTGTTATCTCAGTCTGTGTTGCCTGCATTGTGTGACAGTAAAATC
CGTTCCAAGGCTCTGGGCAGTGACCACTGTCCCATTACCCTATACCTAGCTCTGTGA
Enzyme 45 GenBank Gene ID X56685 Link Image
Enzyme 45 GeneCard ID APEX1 Link Image
Enzyme 45 GenAtlas ID Not Available
Enzyme 45 HGNC ID Not Available
Enzyme 45 Chromosome Location Chromosome:1
Enzyme 45 Locus 14q11.2-q12
Enzyme 45 SNPs SNPJam Report Link Image
Enzyme 45 General References
  1. [PubMed Link Image]
Enzyme 45 Metabolite References Not Available
Enzyme 46 [top]
Enzyme 46 ID 448
Enzyme 46 Name Isocitrate dehydrogenase [NADP], mitochondrial
Enzyme 46 Synonyms
  1. IDH
  2. Oxalosuccinate decarboxylase
  3. NADP(+)-specific ICDH
  4. IDP
  5. ICD-M
Enzyme 46 Gene Name IDH2
Enzyme 46 Protein Sequence >Isocitrate dehydrogenase [NADP], mitochondrial
MAGYLRVVRSLCRASGSGSAWAPAALTAPNLQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVVDRAGTFKVVFTPKDGSGPKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQAIFEKHYKTEFDKHKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTSDFLDTIKSNLDRALGQQ
Enzyme 46 Number of Residues 452
Enzyme 46 Molecular Weight 50738.7
Enzyme 46 Theoretical pI 8.95
Enzyme 46 GO Classification
Function
Process
Component
Enzyme 46 General Function Energy production and conversion
Enzyme 46 Specific Function Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex
Enzyme 46 Pathways Not Available
Enzyme 46 Reactions Not Available
Enzyme 46 Pfam Domain Function
Enzyme 46 Signals
  • None
Enzyme 46 Transmembrane Regions
  • None
Enzyme 46 Essentiality Not Available
Enzyme 46 GenBank ID Protein 430 Link Image
Enzyme 46 UniProtKB/Swiss-Prot ID Q04467 Link Image
Enzyme 46 UniProtKB/Swiss-Prot Entry Name IDHP_BOVIN Link Image
Enzyme 46 PDB ID 1LWD Link Image
Enzyme 46 PDB File Show
Enzyme 46 3D Structure
Enzyme 46 Cellular Location Not Available
Enzyme 46 Gene Sequence >1359 bp
ATGGCTGGTTACCTGCGAGTCGTACGCTCGCTCTGCAGAGCCTCTGGCTCCGGGTCGGCC
TGGGCGCCACGAGCCTTGACAGCCCCCAACTTGCAAGAGCAGCCGCGGCGCCACTATGCC
GACAAGAGGATCAAGGTGGCGAAGCCAGTGGTGGAGATGGACGGCGATGAGATGACCCGT
ATTATCTGGCAGTTCATCAAAGAGAAGCTCATCCTGCCCCACGTGGACGTCCAGCTCAAG
TATTTCGACCTGGGGCTCCCGAACCGTGACCAGACCAATGATCAGGTCACCATCGACTCC
GCGTTGGCCACCCAGAAGTACAGTGTGGCTGTGAAGTGTGCCACCATCACCCCCGACGAG
GCCCGTGTGGAAGAGTTCAAGCTGAAGAAGATGTGGAAGAGCCCCAATGGAACCATCCGG
AACATCCTCGGGGGAACGGTCTTCCGGGAGCCCATCATCTGTAAGAACATCCCGCGTCTC
GTCCCTGGCTGGACCAAGCCCATCACCATTGGCAGGCATGCCCACGGCGACCAGTACAAA
GCCACAGACTTTGTGGTTGACCGGGCTGGCACATTCAAGGTGGTCTTCACCCCGAAGGAT
GGCAGCGGCCCTAAGGAATGGGAGGTGTACAACTTTCCTGCTGGTGGCGTGGGCATGGGC
ATGTATAACACGGATGAGTCCATCTCAGGTTTTGCACACAGCTGCTTCCAGTATGCCATC
CAGAAGAAGTGGCCACTCTACATGAGCACCAAGAACACCATCCTGAAAGCTTACGACGGG
CGCTTCAAGGACATCTTCCAGGCCATCTTTGAGAAGCACTACAAGACTGAGTTCGACAAA
CATAAGATCTGGTACGAGCACCGGCTCATTGATGACATGGTGGCTCAGGTCCTCAAGTCC
TCAGGCGGCTTTGTGTGGGCCTGCAAGAACTACGATGGAGACGTGCAGTCGGACATCCTG
GCCCAGGGCTTTGGCTCCCTTGGTCTGATGACGTCCGTGCTGGTCTGCCCGGATGGGAAG
ACCATTGAGGCTGAGGCTGCTCATGGCACAGTCACCCGCCACTATCGGGAGCACCAGAAG
GGCCGGCCGACCAGCACCAACCCCATCGCCAGCATCTTTGCCTGGACGCGTGGCCTAGAA
CACCGGGGCAAGTTGGATGGGAACCAGGACCTCATCAGGTTCGCCCAGACCCTGGAGAAG
GTGTGCGTCGAGACGGTGGAGAGCGGAGCCATGACCAAGGACCTGGCGGGCTGCATCCAC
GGCCTCAGCAATGTGAAGCTGAACGAACACTTCCTGAACACCTCGGACTTCCTGGACACC
ATCAAGAGCAACCTGGACAGAGCTCTGGGCCAGCAGTAG
Enzyme 46 GenBank Gene ID X69432 Link Image
Enzyme 46 GeneCard ID IDH2 Link Image
Enzyme 46 GenAtlas ID Not Available
Enzyme 46 HGNC ID Not Available
Enzyme 46 Chromosome Location Chromosome:1
Enzyme 46 Locus 15q26.1
Enzyme 46 SNPs SNPJam Report Link Image
Enzyme 46 General References
  1. [PubMed Link Image]
Enzyme 46 Metabolite References Not Available
Enzyme 47 [top]
Enzyme 47 ID 449
Enzyme 47 Name Pyruvate kinase
Enzyme 47 Synonyms Not Available
Enzyme 47 Gene Name PKM
Enzyme 47 Protein Sequence >Pyruvate kinase
CIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARASSHSTDLMEAMAMGSV
EASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDP
VQEAWAEDVDLRVNLAMNVGKARGFFKKG
Enzyme 47 Number of Residues 149
Enzyme 47 Molecular Weight 16527.0
Enzyme 47 Theoretical pI 9.23
Enzyme 47 GO Classification
Function
Process
Component
Enzyme 47 General Function Carbohydrate transport and metabolism
Enzyme 47 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 47 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 47 Reactions Not Available
Enzyme 47 Pfam Domain Function
Enzyme 47 Signals
  • None
Enzyme 47 Transmembrane Regions
  • None
Enzyme 47 Essentiality Not Available
Enzyme 47 GenBank ID Protein 193248617 Link Image
Enzyme 47 UniProtKB/Swiss-Prot ID B3IVN4 Link Image
Enzyme 47 UniProtKB/Swiss-Prot Entry Name B3IVN4_BOVIN Link Image
Enzyme 47 PDB ID 1F3W Link Image
Enzyme 47 PDB File Show
Enzyme 47 3D Structure
Enzyme 47 Cellular Location Not Available
Enzyme 47 Gene Sequence Not Available
Enzyme 47 GenBank Gene ID AB355747 Link Image
Enzyme 47 GeneCard ID PKM Link Image
Enzyme 47 GenAtlas ID Not Available
Enzyme 47 HGNC ID Not Available
Enzyme 47 Chromosome Location Not Available
Enzyme 47 Locus Not Available
Enzyme 47 SNPs SNPJam Report Link Image
Enzyme 47 General References
  1. [PubMed Link Image]
Enzyme 47 Metabolite References Not Available
Enzyme 48 [top]
Enzyme 48 ID 450
Enzyme 48 Name Endonuclease G, mitochondrial
Enzyme 48 Synonyms
  1. Endo G
Enzyme 48 Gene Name ENDOG
Enzyme 48 Protein Sequence >Endonuclease G, mitochondrial
MQLLRAGLTLALGAGLGAAAESWWRQRADARATPGLLSRLPVLPVAAAAGLPAVPGAPAG
GGPGELAKYGLPGVAQLKSRASYVLCYDPRTRGALWVVEQLRPEGLRGDGNRSSCDFHED
DSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNN
LEKYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAA
GGQIELRSYVMPNAPVDEAIPLEHFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
Enzyme 48 Number of Residues 299
Enzyme 48 Molecular Weight 32261.4
Enzyme 48 Theoretical pI 9.42
Enzyme 48 GO Classification
Function
Process
Component
Enzyme 48 General Function Nucleotide transport and metabolism
Enzyme 48 Specific Function Cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, also has ribonuclease (RNase) and RNase H activities. Capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA
Enzyme 48 Pathways Not Available
Enzyme 48 Reactions Not Available
Enzyme 48 Pfam Domain Function
Enzyme 48 Signals
  • None
Enzyme 48 Transmembrane Regions
  • None
Enzyme 48 Essentiality Not Available
Enzyme 48 GenBank ID Protein 397486 Link Image
Enzyme 48 UniProtKB/Swiss-Prot ID P38447 Link Image
Enzyme 48 UniProtKB/Swiss-Prot Entry Name NUCG_BOVIN Link Image
Enzyme 48 PDB ID Not Available
Enzyme 48 Cellular Location Not Available
Enzyme 48 Gene Sequence >900 bp
ATGCAGTTGCTTCGGGCCGGCTTGACTCTGGCCCTGGGCGCAGGGCTGGGTGCAGCTGCC
GAGAGCTGGTGGCGACAGCGGGCGGACGCGCGGGCGACGCCGGGGCTGCTGAGCCGGCTG
CCGGTGCTGCCAGTGGCGGCGGCGGCGGGGCTTCCCGCGGTGCCAGGGGCTCCCGCGGGT
GGCGGCCCGGGCGAGTTAGCCAAGTATGGGCTGCCCGGGGTGGCGCAACTCAAGAGCCGC
GCGTCGTACGTGCTGTGTTACGACCCGCGCACCCGCGGCGCGCTCTGGGTGGTCGAGCAG
CTGCGGCCCGAGGGGCTCCGCGGCGACGGCAACCGCAGCTCCTGCGACTTCCACGAGGAC
GACTCGGTGCATGCGTACCACCGCGCCACCAACGCCGATTACCGCGGCAGCGGCTTCGAC
CGCGGCCACCTCGCTGCCGCGGCCAACCACCGCTGGAGCCAGAAGGCAATGGACGACACC
TTCTACCTGAGCAACGTCGCGCCCCAGGTGCCACACCTCAACCAAAATGCCTGGAACAAC
CTGGAAAAGTACAGCCGCAGTCTGACCCGCACCTACCAAAATGTCTATGTCTGCACCGGG
CCACTCTTCCTGCCCAGGACGGAGGCTGATGGGAAGTCCTACGTGAAGTACCAAGTCATT
GGCAAGAACCACGTGGCGGTGCCCACCCACTTCTTCAAGGTGCTGATCCTGGAGGCGGCA
GGTGGGCAGATAGAACTCCGCTCCTATGTGATGCCCAATGCGCCGGTGGATGAGGCAATC
CCGCTGGAGCACTTCCTGGTGCCCATTGAGAGCATTGAGCGGGCCTCCGGGCTGCTCTTT
GTGCCAAACATCCTGGCACGGGCGGGCAGCCTGAAGGCCATCACTGCTGGCAGCAAGTAA
Enzyme 48 GenBank Gene ID X72802 Link Image
Enzyme 48 GeneCard ID ENDOG Link Image
Enzyme 48 GenAtlas ID Not Available
Enzyme 48 HGNC ID Not Available
Enzyme 48 Chromosome Location Chromosome:9
Enzyme 48 Locus 9q34.1
Enzyme 48 SNPs SNPJam Report Link Image
Enzyme 48 General References
  1. [PubMed Link Image]
Enzyme 48 Metabolite References Not Available
Enzyme 49 [top]
Enzyme 49 ID 451
Enzyme 49 Name Isopentenyl-diphosphate Delta-isomerase 1
Enzyme 49 Synonyms
  1. Isopentenyl pyrophosphate isomerase 1
  2. IPP isomerase 1
  3. IPPI1
Enzyme 49 Gene Name IDI1
Enzyme 49 Protein Sequence >Isopentenyl-diphosphate Delta-isomerase 1
MPEVSTDDLDERQVQLMAEMCILVDENDRRIGAETKKNCHLNENIERGLLHRAFSVFLFN
TENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPSELEENDAIGVRRAAQRRLKAELGIPM
EEVPPEEINYLTRIHYKAQSDSIWGEHEIDYILLVKKNVTLNPDPNEIKSYCYVTKEELE
ELIGKAAHGEIKITPWFQIIADTFLFKWWDNLNRLNLFVDHEKIHRM
Enzyme 49 Number of Residues 227
Enzyme 49 Molecular Weight 26466.9
Enzyme 49 Theoretical pI 5.07
Enzyme 49 GO Classification
Function
Process
Component
Enzyme 49 General Function Lipid transport and metabolism
Enzyme 49 Specific Function Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP)
Enzyme 49 Pathways
  • Isoprenoid biosynthesis
  • dimethylallyl diphosphate biosynthesis
  • dimethylallyl diphosphate from isopentenyl diphosphate:step 1/1
Enzyme 49 Reactions Not Available
Enzyme 49 Pfam Domain Function
Enzyme 49 Signals
  • None
Enzyme 49 Transmembrane Regions
  • None
Enzyme 49 Essentiality Not Available
Enzyme 49 GenBank ID Protein 94534783 Link Image
Enzyme 49 UniProtKB/Swiss-Prot ID Q1LZ95 Link Image
Enzyme 49 UniProtKB/Swiss-Prot Entry Name IDI1_BOVIN Link Image
Enzyme 49 PDB ID Not Available
Enzyme 49 Cellular Location Not Available
Enzyme 49 Gene Sequence >864 bp
ATGTGGCGCGCCCTGGCCCCGGCGCGGGCAATTGGCCGCGCGGCCTCGGGGGGCGGGGCT
CGGATCGGAGGCGGGGCCCGTGCCTTGGGGCGGAGTCTGAAGGATACTCCCCCGGCGGTG
CAGCCTACAGTGGACGGCTCGTGTCTCAGGTTCCCGGGGCGGCGCGGAGGCTGGGCGGCG
ATGCCGGAGGTGAGCACGGACGACCTGGACGAGCGGCAGGTGCAGCTCATGGCGGAGATG
TGCATCCTCGTCGACGAGAACGACCGGAGGATCGGGGCAGAGACCAAGAAGAACTGCCAC
CTGAACGAGAACATCGAGAGAGGGCTGTTGCACCGAGCTTTCAGTGTCTTCTTGTTCAAC
ACCGAGAACAAGCTGCTGCTGCAGCAGAGGTCTGACGCTAAGATTACCTTCCCAGGGTGT
TTTACTAATACTTGCTGTAGTCACCCATTAAGCAACCCAAGTGAGCTGGAAGAAAATGAT
GCTATTGGAGTAAGAAGAGCAGCACAGAGGCGGTTAAAGGCCGAACTCGGAATTCCCATG
GAAGAGGTTCCTCCAGAGGAAATTAATTATCTAACACGAATTCACTACAAGGCTCAATCT
GATAGTATCTGGGGAGAACATGAAATTGACTACATTTTGTTGGTAAAGAAGAATGTGACC
TTGAATCCAGACCCCAATGAGATTAAAAGCTATTGCTACGTAACAAAGGAAGAATTAGAA
GAACTTATAGGAAAGGCGGCCCATGGTGAAATTAAGATAACCCCATGGTTTCAAATTATT
GCAGATACTTTTCTCTTTAAGTGGTGGGATAACTTAAATCGTTTGAATCTGTTTGTTGAC
CATGAGAAAATACACAGGATGTAA
Enzyme 49 GenBank Gene ID BC116133 Link Image
Enzyme 49 GeneCard ID IDI1 Link Image
Enzyme 49 GenAtlas ID Not Available
Enzyme 49 HGNC ID Not Available
Enzyme 49 Chromosome Location Chromosome:1
Enzyme 49 Locus 10p15.3
Enzyme 49 SNPs SNPJam Report Link Image
Enzyme 49 General References
  1. [PubMed Link Image]
Enzyme 49 Metabolite References Not Available
Enzyme 50 [top]
Enzyme 50 ID 452
Enzyme 50 Name Flap endonuclease 1
Enzyme 50 Synonyms
  1. FEN-1
  2. Flap structure-specific endonuclease 1
Enzyme 50 Gene Name FEN1
Enzyme 50 Protein Sequence >Flap endonuclease 1
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQEAQAAGAE
AEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAQQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVRRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGAAKKKAKTGAAGKFKRGK
Enzyme 50 Number of Residues 380
Enzyme 50 Molecular Weight 42509.5
Enzyme 50 Theoretical pI 8.74
Enzyme 50 GO Classification
Function
Process
Component
Enzyme 50 General Function Replication, recombination and repair
Enzyme 50 Specific Function Endonuclease that cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It fails to cleave other DNA structures, including 3'-flaps and single stranded DNA
Enzyme 50 Pathways Not Available
Enzyme 50 Reactions Not Available
Enzyme 50 Pfam Domain Function
Enzyme 50 Signals
  • None
Enzyme 50 Transmembrane Regions
  • None
Enzyme 50 Essentiality Not Available
Enzyme 50 GenBank ID Protein 61553249 Link Image
Enzyme 50 UniProtKB/Swiss-Prot ID Q58DH8 Link Image
Enzyme 50 UniProtKB/Swiss-Prot Entry Name FEN1_BOVIN Link Image
Enzyme 50 PDB ID 1UL1 Link Image
Enzyme 50 PDB File Show
Enzyme 50 3D Structure
Enzyme 50 Cellular Location Not Available
Enzyme 50 Gene Sequence >1143 bp
ATGGGAATTCAAGGACTGGCCAAACTGATCGCTGATGTGGCCCCCAGTGCCATCCGGGAG
AATGACATCAAGAGCTACTTTGGCCGCAAGGTGGCCATTGATGCTTCCATGAGCATTTAT
CAGTTCCTGATAGCTGTTCGCCAAGGCGGGGACGTGCTGCAGAATGAGGAGGGGGAGACC
ACCAGCCACCTGATGGGCATGTTCTACCGCACCATCCGCATGATGGAGAATGGCATCAAG
CCCGTGTACGTCTTTGATGGCAAGCCACCGCAGCTCAAGTCCGGGGAGCTGGCCAAACGC
AGCGAGCGGCGGGCCGAGGCTGAGAAGCAGCTGCAGGAGGCTCAGGCCGCCGGGGCTGAG
GCGGAGGTGGAAAAGTTTACGAAGCGGCTGGTGAAGGTCACCAAGCAACACAATGACGAG
TGCAAGCATCTCCTGAGCCTCATGGGCATCCCGTACCTCGACGCACCCAGTGAGGCGGAG
GCTAGCTGTGCGGCCCTGGTGAAGGCTGGCAAAGTCTACGCCGCGGCCACAGAGGACATG
GATTGCCTGACGTTCGGCAGCCCGGTGCTCATGCGGCACCTGACTGCCAGTGAGGCCAAG
AAGCTGCCCATCCAGGAGTTCCACCTGAGCCGGATCCTGCAGGAGCTGGGCCTCAACCAG
GAGCAGTTTGTGGATCTGTGCATCCTGCTGGGCAGTGACTACTGTGAGAGCATCCGGGGC
ATCGGGCCCAAGCGGGCCATGGACCTCATCCAGAAGCACAAGAGCATCGAGGAGATTGTG
CGGCGGCTGGACCCCAACAAGTACCCCGTGCCGGAAAACTGGCTCCACAAGGAGGCTCAG
CAGCTCTTCCTGGAGCCTGAGGTGCTGGACCCAGAGTCTGTGGAGCTGAAGTGGAGCGAG
CCCAATGAAAAAGAGCTCATCAAGTTCATGTGTGGGGAGAAGCAGTTCTCCGAGGAGCGA
ATCCGCAGTGGGGTCAGGCGGCTGAGCAAGAGCCGCCAGGGCAGCACCCAGGGCCGCCTG
GATGATTTCTTTAAGGTGACCGGCTCCCTCTCTTCCGCCAAGCGCAAGGAGCCAGAGCCC
AAGGGAGCCGCTAAGAAGAAGGCAAAGACTGGGGCAGCAGGGAAGTTCAAAAGAGGAAAA
TAA
Enzyme 50 GenBank Gene ID BT021527 Link Image
Enzyme 50 GeneCard ID FEN1 Link Image
Enzyme 50 GenAtlas ID Not Available
Enzyme 50 HGNC ID Not Available
Enzyme 50 Chromosome Location Chromosome:1
Enzyme 50 Locus 11q12
Enzyme 50 SNPs SNPJam Report Link Image
Enzyme 50 General References
  1. [PubMed Link Image]
Enzyme 50 Metabolite References Not Available
Enzyme 51 [top]
Enzyme 51 ID 453
Enzyme 51 Name Mitochondrial enolase superfamily member 1
Enzyme 51 Synonyms Not Available
Enzyme 51 Gene Name ENOSF1
Enzyme 51 Protein Sequence >Mitochondrial enolase superfamily member 1
MVHGRVSRLSVHDVRFPTSLGGHGSDAMHTDPDYSAAYVVLETDAEDGLKGYGITFTLGR
GTEVVVCAVNALAPHVLNKDLGEIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLN
AVWDLWAKQEGKPLWKLLVDMDPRTLVSCIDFRYITDVLTEEEACEILRQSQVGKKEREE
QMLAHGYPAYTTSCAWLGYPDATLKQLCSEALKDGWTRFKVKVGADLQDDIRRCRLVRNM
IGPEKTLMMDANQRWDVPEAVEWMTKLAEFKPLWIEEPTSPDDILGHAAISKALAPLGIG
VATGEQCHNRVIFKQLLQAKALKFLQIDSCRLGSVNENLSVLLMAKKFEIPVCPHAGGVG
LCELVQHLIIFDFISVSASLQDRMCEYVDHLHEHFKYPVLIREAAYMPPKDAGYSTEMKE
DSVKRHRYPDGEVWKKLLSAQGN
Enzyme 51 Number of Residues 443
Enzyme 51 Molecular Weight 49620.7
Enzyme 51 Theoretical pI 6.24
Enzyme 51 GO Classification
Function
Process
Component
Enzyme 51 General Function Cell wall/membrane/envelope biogenesis
Enzyme 51 Specific Function May regulate thymidylate synthase activity
Enzyme 51 Pathways Not Available
Enzyme 51 Reactions Not Available
Enzyme 51 Pfam Domain Function
Enzyme 51 Signals
  • None
Enzyme 51 Transmembrane Regions
  • None
Enzyme 51 Essentiality Not Available
Enzyme 51 GenBank ID Protein 86827625 Link Image
Enzyme 51 UniProtKB/Swiss-Prot ID Q2KIA9 Link Image
Enzyme 51 UniProtKB/Swiss-Prot Entry Name ENOF1_BOVIN Link Image
Enzyme 51 PDB ID Not Available
Enzyme 51 Cellular Location Not Available
Enzyme 51 Gene Sequence >1332 bp
ATGGTGCACGGCAGGGTCTCCCGGCTCTCGGTCCACGACGTGCGCTTCCCCACGTCACTC
GGGGGCCACGGCTCGGACGCCATGCACACAGACCCTGACTACTCAGCAGCCTATGTTGTC
TTGGAGACGGATGCGGAAGACGGACTCAAGGGCTATGGAATTACCTTCACTCTGGGAAGA
GGCACTGAAGTTGTTGTCTGTGCTGTGAATGCTCTGGCCCCCCACGTGCTGAACAAGGAC
CTTGGCGAAATTGTTGGGGATTTCAGAGGTTTCTACAGGCAGCTCACGAGTGATGGGCAG
CTCAGATGGATCGGTCCTGAGAAGGGTGTGGTGCATCTGGCCACGGCGGCCGTGCTCAAT
GCCGTGTGGGACCTGTGGGCCAAGCAGGAGGGGAAGCCTCTGTGGAAGTTACTTGTTGAC
ATGGACCCCCGGACACTGGTGTCCTGCATCGATTTCAGGTACATCACTGACGTCCTGACG
GAGGAGGAAGCCTGCGAAATTCTGCGGCAAAGTCAGGTCGGGAAAAAAGAGCGAGAGGAG
CAAATGCTGGCACATGGCTACCCCGCCTACACCACATCGTGCGCCTGGCTGGGCTACCCT
GACGCCACGCTGAAGCAGCTCTGCAGCGAGGCGCTCAAGGACGGCTGGACCAGGTTTAAG
GTAAAAGTTGGTGCTGATCTCCAGGATGACATCCGTAGATGCCGACTCGTCAGAAACATG
ATTGGGCCTGAGAAGACACTGATGATGGACGCCAACCAGCGCTGGGACGTGCCCGAGGCC
GTGGAGTGGATGACAAAGCTGGCCGAGTTCAAGCCACTGTGGATTGAGGAGCCCACCTCC
CCTGACGACATTCTGGGACACGCTGCCATTTCCAAGGCACTGGCCCCCCTGGGCATCGGC
GTGGCCACAGGAGAACAGTGCCACAATAGAGTGATATTTAAGCAACTCCTGCAGGCGAAA
GCCCTGAAGTTTCTGCAGATTGACAGCTGCAGGCTGGGAAGTGTCAACGAGAACCTCTCA
GTGTTGCTGATGGCCAAGAAGTTTGAAATTCCTGTGTGCCCGCACGCCGGGGGAGTTGGC
CTCTGTGAACTGGTGCAGCATCTGATCATATTTGACTTCATATCCGTCTCTGCAAGCCTC
CAAGACAGGATGTGTGAATATGTCGACCACCTGCATGAGCATTTCAAGTACCCTGTGCTG
ATCAGGGAGGCTGCCTACATGCCTCCAAAGGATGCTGGTTATTCAACAGAAATGAAGGAG
GACTCGGTAAAGAGACACCGCTATCCAGATGGTGAAGTCTGGAAGAAGCTTCTAAGTGCT
CAAGGGAATTAA
Enzyme 51 GenBank Gene ID BC112706 Link Image
Enzyme 51 GeneCard ID ENOSF1 Link Image
Enzyme 51 GenAtlas ID Not Available
Enzyme 51 HGNC ID Not Available
Enzyme 51 Chromosome Location Chromosome:1
Enzyme 51 Locus 18p11.32
Enzyme 51 SNPs SNPJam Report Link Image
Enzyme 51 General References Not Available
Enzyme 51 Metabolite References Not Available
Enzyme 52 [top]
Enzyme 52 ID 454
Enzyme 52 Name Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
Enzyme 52 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
Enzyme 52 Gene Name IDH3G
Enzyme 52 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
MALKVATAAGGAVKAALRPALLWRPWEVLGSHEAPRRSFSQQTIPPSAKYGGRHTVTMIP
GDGIGPELMLHVKSVFRHACVPVDFEEVHVSSTADEEDIRNAIMAIRRNRVALKGNIETN
HNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHRDIDILIVRENTEGEYSSLEHES
VAGVVESLKIITKAKSLRIAEYAFQLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
RYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGH
VYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENM
HTPDIGGQGTTSEAIQDIIRHIRVINGRAVEA
Enzyme 52 Number of Residues 392
Enzyme 52 Molecular Weight 42863.0
Enzyme 52 Theoretical pI 9.16
Enzyme 52 GO Classification
Function
Process
Component
Enzyme 52 General Function Energy production and conversion
Enzyme 52 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 52 Pathways Not Available
Enzyme 52 Reactions Not Available
Enzyme 52 Pfam Domain Function
Enzyme 52 Signals
  • None
Enzyme 52 Transmembrane Regions
  • None
Enzyme 52 Essentiality Not Available
Enzyme 52 GenBank ID Protein 61555748 Link Image
Enzyme 52 UniProtKB/Swiss-Prot ID Q58CP0 Link Image
Enzyme 52 UniProtKB/Swiss-Prot Entry Name IDH3G_BOVIN Link Image
Enzyme 52 PDB ID Not Available
Enzyme 52 Cellular Location Not Available
Enzyme 52 Gene Sequence >1179 bp
ATGGCGCTGAAGGTGGCGACGGCCGCGGGCGGCGCTGTGAAGGCAGCGCTCAGGCCGGCC
CTCCTCTGGCGTCCTTGGGAGGTTCTAGGTTCCCACGAGGCCCCCCGGAGGAGCTTCTCA
CAACAAACAATTCCCCCGTCGGCGAAGTATGGTGGGCGGCACACGGTGACCATGATCCCG
GGAGATGGCATTGGGCCAGAGCTCATGCTGCACGTCAAGTCAGTGTTCAGGCATGCATGT
GTGCCTGTGGACTTTGAAGAGGTGCACGTGAGCTCCACCGCGGACGAGGAGGACATCCGC
AATGCCATCATGGCCATCCGTCGGAACCGCGTAGCCCTGAAGGGCAACATTGAAACAAAC
CACAACCTGCCCCCATCCCACAAATCGCGAAACAACATCCTTCGCACCAGCCTGGACCTC
TATGCCAACGTCATCCACTGTAAGAGCCTGCCAGGTGTGGTGACCCGGCATCGGGACATT
GATATCCTCATTGTCCGGGAGAACACAGAGGGCGAGTACAGCAGCCTGGAACACGAGAGT
GTGGCGGGCGTGGTGGAGAGCCTGAAGATCATCACCAAGGCCAAGTCCCTGCGTATTGCT
GAGTACGCCTTCCAACTGGCCCAGGAGAGCGGGCGCAAGAAAGTGACAGCCGTGCACAAG
GCCAACATCATGAAACTGGGCGATGGGCTTTTCCTCCAGTGCTGCAGGGAAGTGGCAGCC
CGCTACCCCCAGATCACCTTTGAGAATATGATTGTGGACAACACCACCATGCAGCTGGTG
TCCCGGCCCCAGCAGTTTGATGTCATGGTGATGCCCAATCTCTATGGCAACATCGTCAAC
AACGTCTGTGCTGGGCTAGTTGGGGGCCCCGGCCTTGTGGCTGGGGCCAACTATGGCCAT
GTGTATGCCGTGTTTGAGACGGCTACAAGGAACACAGGGAAGAGTATTGCCAATAAGAAC
ATTGCCAACCCCACAGCTACACTGCTGGCAAGTTGCATGATGCTCGACCACCTCAAGCTG
CACTCCTATGCCACCTCCATCCGCAAGGCCGTCCTGGCATCCATGGACAATGAAAACATG
CACACCCCAGACATCGGGGGCCAGGGCACCACGTCGGAAGCCATCCAGGACATCATCCGC
CATATCCGTGTCATTAACGGTCGGGCCGTGGAGGCCTAG
Enzyme 52 GenBank Gene ID BT021907 Link Image
Enzyme 52 GeneCard ID IDH3G Link Image
Enzyme 52 GenAtlas ID Not Available
Enzyme 52 HGNC ID Not Available
Enzyme 52 Chromosome Location Not Available
Enzyme 52 Locus Xq28
Enzyme 52 SNPs SNPJam Report Link Image
Enzyme 52 General References
  1. [PubMed Link Image]
Enzyme 52 Metabolite References Not Available
Enzyme 53 [top]
Enzyme 53 ID 455
Enzyme 53 Name Beta-enolase
Enzyme 53 Synonyms
  1. 2-phospho-D-glycerate hydro-lyase
  2. Muscle-specific enolase
  3. MSE
  4. Skeletal muscle enolase
  5. Enolase 3
Enzyme 53 Gene Name ENO3
Enzyme 53 Protein Sequence >Beta-enolase
MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGK
GVLKAVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK
AGAAEKGVPLYRHIADLAGNPELILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFRE
AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV
VIGMDVAASEFYRNGKYDLDFKSPDDPARHISGEKLGELYKNFIKNYPVVSIEDPFDQDD
WATWTSFLSGVNIQIVGDDLTVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA
QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDK
AVFAGRKFRNPKAK
Enzyme 53 Number of Residues 434
Enzyme 53 Molecular Weight 47095.6
Enzyme 53 Theoretical pI 7.85
Enzyme 53 GO Classification
Function
Process
Component
Enzyme 53 General Function Carbohydrate transport and metabolism
Enzyme 53 Specific Function Appears to have a function in striated muscle development and regeneration
Enzyme 53 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 4/5
Enzyme 53 Reactions Not Available
Enzyme 53 Pfam Domain Function
Enzyme 53 Signals
  • None
Enzyme 53 Transmembrane Regions
  • None
Enzyme 53 Essentiality Not Available
Enzyme 53 GenBank ID Protein 73587037 Link Image
Enzyme 53 UniProtKB/Swiss-Prot ID Q3ZC09 Link Image
Enzyme 53 UniProtKB/Swiss-Prot Entry Name ENOB_BOVIN Link Image
Enzyme 53 PDB ID Not Available
Enzyme 53 Cellular Location Not Available
Enzyme 53 Gene Sequence >1305 bp
ATGGCCATGCAAAAAATCTTTGCCCGGGAAATCCTGGACTCCAGGGGCAACCCCACTGTG
GAGGTGGACCTGCACACGGCCAAGGGCCGATTCCGAGCAGCTGTGCCCAGTGGCGCTTCC
ACAGGTATCTATGAAGCTCTGGAACTAAGAGATGGAGACAAGTCTCGCTACCTGGGGAAA
GGGGTCCTGAAAGCTGTGGAACACATCAACAAGACCCTCGGCCCTGCGCTGCTGGAAAAG
AAACTAAGTGTGGTGGATCAAGAAAAAGTTGACAAATTTATGATTGAGCTGGATGGGACA
GAGAATAAATCCAAGTTTGGGGCCAATGCCATCCTGGGCGTGTCCCTGGCCGTGTGTAAG
GCTGGAGCAGCTGAGAAGGGGGTGCCGCTCTACCGACACATTGCAGATCTCGCAGGGAAC
CCAGAGCTGATCCTCCCAGTCCCTGCCTTCAACGTGATCAATGGGGGCTCCCATGCTGGA
AACAAGCTGGCCATGCAGGAGTTCATGATCCTGCCTGTGGGAGCCAGCTCCTTCAGGGAA
GCCATGCGCATTGGGGCCGAGGTCTACCACCACCTCAAGGGGGTCATCAAAGCCAAGTAT
GGGAAGGACGCCACCAATGTGGGTGATGAGGGTGGCTTTGCACCCAACATCCTGGAGAAC
AATGAAGCCCTGGAGCTGCTGAAGACGGCCATCCAGGCGGCTGGTTACCCCGACAAGGTG
GTGATTGGCATGGATGTAGCAGCATCTGAGTTCTATCGCAATGGGAAGTACGATCTCGAC
TTCAAGTCACCTGACGACCCTGCTCGGCACATCAGTGGAGAGAAGCTGGGCGAACTGTAC
AAGAACTTCATCAAGAACTACCCTGTGGTGTCCATTGAGGATCCTTTTGACCAGGATGAC
TGGGCTACCTGGACCTCGTTCCTCTCGGGGGTCAACATCCAGATCGTGGGGGATGATCTC
ACAGTCACCAACCCCAAAAGGATTGCCCAGGCCGTGGAGAAGAAGGCCTGCAACTGCCTG
CTGCTGAAGGTCAACCAGATTGGCTCGGTGACTGAATCCATCCAGGCCTGCAAACTGGCT
CAGTCTAACGGCTGGGGGGTGATGGTGAGCCACCGCTCTGGAGAGACTGAGGACACCTTC
ATCGCTGACCTCGTGGTGGGGCTCTGCACAGGACAGATCAAGACTGGTGCCCCATGCCGC
TCAGAGCGTCTGGCCAAATACAATCAGCTCATGAGGATTGAGGAGGCTCTTGGGGACAAG
GCTGTCTTTGCTGGACGCAAGTTCCGTAACCCGAAGGCCAAGTGA
Enzyme 53 GenBank Gene ID BC102988 Link Image
Enzyme 53 GeneCard ID ENO3 Link Image
Enzyme 53 GenAtlas ID Not Available
Enzyme 53 HGNC ID Not Available
Enzyme 53 Chromosome Location Chromosome:1
Enzyme 53 Locus 17pter-p11
Enzyme 53 SNPs SNPJam Report Link Image
Enzyme 53 General References Not Available
Enzyme 53 Metabolite References Not Available
Enzyme 54 [top]
Enzyme 54 ID 456
Enzyme 54 Name Inositol monophosphatase
Enzyme 54 Synonyms
  1. Inositol-1(or 4)-monophosphatase
  2. IMPase
  3. IMP
  4. Lithium-sensitive myo-inositol monophosphatase A1
Enzyme 54 Gene Name IMPA1
Enzyme 54 Protein Sequence >Inositol monophosphatase
MADPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFG
IVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIE
RLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTG
GPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED
Enzyme 54 Number of Residues 277
Enzyme 54 Molecular Weight 30055.3
Enzyme 54 Theoretical pI 4.81
Enzyme 54 GO Classification
Function
Process
Component
Enzyme 54 General Function Carbohydrate transport and metabolism
Enzyme 54 Specific Function Responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides and has been implicated as the pharmacological target for lithium action in brain. Can use myo-inositol monophosphates, myo- inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo- inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates
Enzyme 54 Pathways
  • Polyol metabolism
  • myo-inositol biosynthesis
  • myo- inositol from D-glucose 6-phosphate:step 2/2
Enzyme 54 Reactions Not Available
Enzyme 54 Pfam Domain Function
Enzyme 54 Signals
  • None
Enzyme 54 Transmembrane Regions
  • None
Enzyme 54 Essentiality Not Available
Enzyme 54 GenBank ID Protein 163225 Link Image
Enzyme 54 UniProtKB/Swiss-Prot ID P20456 Link Image
Enzyme 54 UniProtKB/Swiss-Prot Entry Name IMPA1_BOVIN Link Image
Enzyme 54 PDB ID 2BJI Link Image
Enzyme 54 PDB File Show
Enzyme 54 3D Structure
Enzyme 54 Cellular Location Not Available
Enzyme 54 Gene Sequence >834 bp
ATGGCTGATCCTTGGCAGGAATGCATGGATTATGCAGTAACCCTGGCAGGACAAGCTGGA
GAGGTGGTTCGTGAAGCGCTCAAGAATGAAATGAATATTATGGTTAAAAGTTCTCCGGCT
GATTTGGTAACTGCTACTGACCAAAAAGTTGAAAAAATGCTTATCACATCCATAAAGGAA
AAGTATCCATCTCACAGTTTCATTGGTGAGGAATCTGTGGCAGCTGGGGAAAAAAGTATC
TTAACCGACAACCCTACATGGATCATTGACCCTATTGATGGAACAACTAACTTTGTACAT
GGATTTCCTTTTGTAGCTGTTTCAATTGGCTTTGTGGTAAATAAAAAGATGGAGTTTGGA
ATTGTGTACAGTTGCCTGGAGGATAAGATGTACACTGGCCGGAAAGGAAAAGGTGCCTTT
TGTAATGGTCAAAAACTACAGGTTTCACACCAAGAAGATATTACCAAATCTCTCTTGGTG
ACAGAGTTGGGCTCTTCCAGAACACCAGAGACTGTGAGAATTATTCTTTCTAATATAGAA
AGGCTTCTTTGCCTTCCCATCCATGGGATCCGGGGTGTTGGAACAGCAGCTCTGAACATG
TGCCTGGTGGCCGCTGGGGCTGCGGACGCGTATTATGAAATGGGGATCCACTGCTGGGAT
GTTGCAGGCGCCGGCATCATTGTGACTGAAGCTGGCGGAGTGCTCCTGGATGTCACAGGT
GGACCATTTGATTTGATGTCACGAAGAGTAATTGCTTCAAGCAATAAAACATTAGCAGAA
AGGATAGCCAAAGAAATTCAGATAATACCTCTTCAAAGAGATGATGAAGATTAA
Enzyme 54 GenBank Gene ID J05394 Link Image
Enzyme 54 GeneCard ID IMPA1 Link Image
Enzyme 54 GenAtlas ID Not Available
Enzyme 54 HGNC ID Not Available
Enzyme 54 Chromosome Location Chromosome:8
Enzyme 54 Locus 8q21.13-q21.3
Enzyme 54 SNPs SNPJam Report Link Image
Enzyme 54 General References
  1. [PubMed Link Image]
Enzyme 54 Metabolite References Not Available
Enzyme 55 [top]
Enzyme 55 ID 457
Enzyme 55 Name Pyruvate kinase
Enzyme 55 Synonyms Not Available
Enzyme 55 Gene Name PKM2
Enzyme 55 Protein Sequence >Pyruvate kinase
HWSDASRAPGPVCSSRASRAGPRRSSSGPKTSEAMSKHHSDAGTAFIQTQQLHAAMADTF
LEHMCRLDIDSPPITARNTGIICTIGPASRAVETLKEMIKSGMNVARLNFSHGTHEYHAE
TIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDN
AYMEKCDENILWLDYKNICKVVDVGSKIYVDDGLISLLVKQKGPDFLVTEVENGGSLGSK
KGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMVFASFIRKASDVHEVRKVLGEKGKNIK
IISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVIC
ATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAE
AAIYHLQLFEELRRLSPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRP
RAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKG
DVVIVLTGWRPGSGFTNTMRVVPVP
Enzyme 55 Number of Residues 565
Enzyme 55 Molecular Weight 61427.1
Enzyme 55 Theoretical pI 8.47
Enzyme 55 GO Classification
Function
Process
Component
Enzyme 55 General Function Carbohydrate transport and metabolism
Enzyme 55 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 55 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 55 Reactions Not Available
Enzyme 55 Pfam Domain Function
Enzyme 55 Signals
  • None
Enzyme 55 Transmembrane Regions
  • None
Enzyme 55 Essentiality Not Available
Enzyme 55 GenBank ID Protein 73587283 Link Image
Enzyme 55 UniProtKB/Swiss-Prot ID Q3ZC87 Link Image
Enzyme 55 UniProtKB/Swiss-Prot Entry Name Q3ZC87_BOVIN Link Image
Enzyme 55 PDB ID 1F3X Link Image
Enzyme 55 PDB File Show
Enzyme 55 3D Structure
Enzyme 55 Cellular Location Not Available
Enzyme 55 Gene Sequence Not Available
Enzyme 55 GenBank Gene ID BC102826 Link Image
Enzyme 55 GeneCard ID PKM2 Link Image
Enzyme 55 GenAtlas ID Not Available
Enzyme 55 HGNC ID Not Available
Enzyme 55 Chromosome Location Chromosome:1
Enzyme 55 Locus 15q22
Enzyme 55 SNPs SNPJam Report Link Image
Enzyme 55 General References Not Available
Enzyme 55 Metabolite References Not Available
Enzyme 56 [top]
Enzyme 56 ID 458
Enzyme 56 Name Interleukin-1 receptor-associated kinase 1
Enzyme 56 Synonyms
  1. IRAK-1
Enzyme 56 Gene Name IRAK1
Enzyme 56 Protein Sequence >Interleukin-1 receptor-associated kinase 1
MAGGPGPGDPAVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVRILTHLQLLRARDIITAWHPPAPLLPPSTTSLTPSS
ISAPSEAAVPGHRKLPSLASTFLSPAFPGSQTHSDPELCPGPSPAAHQPPLPSPAPSSTK
PSPESPMSLLPGAPSSSFCWPLHEICQGTHDFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKEEADLEWTTVKQSFQTEVQQLSRFRHPNIVDFAGYCAQSGFYCLVYGFLPNGSLEDRL
HVQTQAWPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDVKSSNVLLDERLMPKLGDFG
LARLSRFTGANPGQSSSVARTRTVRGTLAYLPEEYVKTGRLAVDTDTFSFGVVLLETLAG
QRAVRMHGAQPKYLKDLVEEEAEEAGVTLKGTQTAVQGGPAADTWAALVAAQIYKKHLDP
RPGPCPPQLGLALGQLACCCLHRRAKRRPPMTQVYQTLEELQVVVAGPCLELEAASRSPP
SPQENSYVSTSGSALSRASPWQPLAAPLGAQAQATDWPQKGANQPVESDESVSDLSAALH
SWHLSPSCPAGPGAPSWVPAPFGQAACTQGGAARESSCGSGPGLQPTAVEGPLLGSSMSS
RPPQIVINPARRKMLQKLALYEDGVLDSLQLLSSSSLPDSGQDLQDRQGPEERDEFRS
Enzyme 56 Number of Residues 718
Enzyme 56 Molecular Weight 77396.0
Enzyme 56 Theoretical pI 6.65
Enzyme 56 GO Classification
Function
Process
Component
Enzyme 56 General Function Involved in ATP binding
Enzyme 56 Specific Function Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization. The kinase activity of this enzyme may not be required for IL-1 signaling. Once phosphorylated, IRAK1 recruits the adapter protein PELI1
Enzyme 56 Pathways Not Available
Enzyme 56 Reactions Not Available
Enzyme 56 Pfam Domain Function
Enzyme 56 Signals
  • None
Enzyme 56 Transmembrane Regions
  • None
Enzyme 56 Essentiality Not Available
Enzyme 56 GenBank ID Protein 88657344 Link Image
Enzyme 56 UniProtKB/Swiss-Prot ID Q2LGB3 Link Image
Enzyme 56 UniProtKB/Swiss-Prot Entry Name IRAK1_BOVIN Link Image
Enzyme 56 PDB ID Not Available
Enzyme 56 Cellular Location Not Available
Enzyme 56 Gene Sequence >2157 bp
ATGGCCGGGGGGCCGGGCCCGGGAGACCCCGCCGTCCCCGGCGCCCAGCACTTCTTGTAC
GAGGTGCCTCCCTGGGTCATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGCC
GACTGGTGCCAGTTCGCCGCCCTGATCGTCCGCGACCAGACCGAGCTGCGGCTGTGCGAG
CGCTCCGGGCAGCGCACAGCCAGCGTCCTGTGGCCGTGGATCAACCGCAACGCCCGCGTG
GCCGATCTCGTGCGCATCCTCACGCACCTGCAGCTGCTGCGGGCGCGGGATATCATCACT
GCTTGGCACCCTCCCGCCCCCCTTCTGCCCCCAAGCACCACCTCCCTGACACCCAGCAGC
ATCTCCGCACCCTCCGAGGCTGCGGTTCCTGGCCACCGGAAGTTGCCGTCTCTGGCCTCC
ACCTTCCTCTCCCCAGCTTTTCCAGGCTCTCAGACTCACTCTGACCCCGAGCTCTGCCCT
GGACCAAGCCCAGCTGCCCACCAGCCACCATTGCCATCTCCAGCCCCCTCATCTACCAAG
CCCAGCCCGGAGAGCCCCATGTCCCTCCTGCCAGGGGCCCCCTCTTCTTCATTCTGCTGG
CCCCTCCATGAGATTTGCCAGGGTACCCACGACTTCTCAGAGGAGCTCAAGATCGGGGAG
GGCGGCTTTGGCTGTGTGTACCGGGCGGTGATGAGGAACACCGTCTATGCTGTGAAGAGG
CTCAAGGAGGAGGCCGACCTGGAGTGGACCACAGTGAAGCAGAGCTTCCAGACTGAAGTG
CAGCAGCTGTCGCGGTTTCGTCACCCCAACATCGTGGACTTTGCCGGCTACTGTGCTCAG
AGTGGCTTCTACTGCCTTGTCTATGGCTTCCTGCCCAATGGCTCCCTGGAAGACCGCCTC
CATGTCCAGACACAGGCCTGGCCCCCTCTCTCCTGGCCTCAGCGACTGGACATCCTTCTG
GGCACGGCCCGGGCAATTCAGTTCTTACATCAAGATAGCCCCAGCCTCATCCATGGAGAT
GTCAAGAGTTCCAACGTCCTTCTGGATGAGAGACTGATGCCCAAACTGGGGGACTTCGGC
CTGGCCCGTCTCAGCCGGTTTACAGGGGCCAACCCCGGCCAGAGCAGTAGTGTGGCCCGG
ACTCGGACAGTGCGCGGCACCCTGGCCTACCTGCCCGAGGAGTACGTGAAGACCGGGAGG
CTGGCCGTAGACACCGACACCTTCAGCTTTGGCGTGGTGCTGCTGGAGACCCTGGCCGGC
CAGAGGGCCGTGAGGATGCATGGCGCCCAGCCCAAGTATCTGAAAGACTTGGTTGAAGAG
GAGGCGGAAGAGGCCGGGGTGACCCTGAAGGGCACTCAGACCGCAGTCCAAGGCGGGCCG
GCCGCAGACACGTGGGCCGCCCTAGTCGCCGCCCAGATCTACAAGAAGCACCTGGACCCC
AGGCCAGGGCCGTGCCCACCACAACTGGGCCTGGCCCTGGGCCAGCTGGCTTGCTGCTGC
CTGCACCGCCGAGCCAAGAGGAGACCCCCAATGACCCAGGTGTACCAGACACTGGAGGAG
CTGCAGGTGGTGGTGGCAGGGCCATGCCTGGAGCTGGAGGCTGCCAGCCGCAGCCCCCCT
TCCCCGCAAGAGAACTCCTACGTGTCCACCAGCGGGAGCGCCCTGAGCCGTGCCAGCCCC
TGGCAGCCCCTGGCAGCGCCCTTGGGGGCCCAGGCCCAGGCTACAGACTGGCCACAAAAA
GGTGCCAACCAGCCCGTGGAGAGTGACGAGAGCGTGTCTGACCTCTCTGCTGCCCTGCAC
TCCTGGCATCTGAGCCCCAGCTGCCCTGCGGGCCCAGGGGCCCCCAGCTGGGTGCCAGCA
CCCTTCGGGCAGGCTGCCTGCACCCAAGGGGGTGCCGCCCGAGAGTCGAGCTGTGGGAGC
GGCCCGGGTCTCCAGCCCACAGCTGTGGAAGGACCCCTCCTGGGCAGCTCCATGTCCTCG
CGACCCCCGCAGATCGTGATCAATCCGGCGCGACGGAAGATGCTGCAGAAGCTGGCATTG
TACGAGGACGGGGTCCTAGACAGCCTGCAGCTGCTCTCGTCCAGCTCTCTCCCAGACTCG
GGCCAGGACCTTCAGGACAGGCAGGGGCCCGAAGAGAGAGACGAGTTTCGGAGCTGA
Enzyme 56 GenBank Gene ID DQ319075 Link Image
Enzyme 56 GeneCard ID IRAK1 Link Image
Enzyme 56 GenAtlas ID Not Available
Enzyme 56 HGNC ID Not Available
Enzyme 56 Chromosome Location Not Available
Enzyme 56 Locus Xq28
Enzyme 56 SNPs SNPJam Report Link Image
Enzyme 56 General References
  1. [PubMed Link Image]
Enzyme 56 Metabolite References Not Available
Enzyme 57 [top]
Enzyme 57 ID 459
Enzyme 57 Name Myosin light chain kinase, smooth muscle
Enzyme 57 Synonyms
  1. MLCK
  2. Telokin
Enzyme 57 Gene Name MYLK
Enzyme 57 Protein Sequence >Myosin light chain kinase, smooth muscle
MDFRANLQRQVKPKTLSEEERKVHGPQQVDFRSVLAKKGTPKTPVPEKVPPPKPATPDFR
SVLGSKKKLPTENGSNNTEALNAKAAEGLKPVGNAQPSGFLKPVGNAKLADTPKPLSSTK
PAETPKPLGNVKPAETPKPLGSTKPAETPKPLGSTKPAETPKPLGNVKPAETPKPLGNIK
PTETPKPLGSTKPAETPKPLGSTKPAETPKPLGNVKPAETPKPLGNVKPAETPKPLGNVK
PAETPKPVSNAKPAETLKPVGNAKPAETPKPLSNVKPAETPKLVGNAKPAETSKPLDNAK
PAEAPKPLGNAKPAEIPKPTGKEELKKEIKNDVNCKKGHAGATDSEKRPESRGTAPTFEE
KLQDLHVAEGQKLLLQCRVSSDPPATITWTLNGKTLKTTKFIVLSQEGSLCSVSIEKALP
EDRGLYKCVAKNSAGQAESSCQVTVDVPDAPTSENAKAPEMKARRPKSSLPPVLGTESDA
TVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVAGTQPITCTWMKFRKQIQD
SEHIKVENSEQGSKLTIRAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCA
SDIRSSSLTLSWYGSSYDGGSAVQSYSVEIWDSVDKTWKELATCRSTSFNVQDLLPDREY
KFRVRAINVYGTSEPSQESELTALGEKPEEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQK
VSDFYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKENIRQEISIMNCLHHP
KLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQ
GIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIG
YATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNL
LKKDMKNRLNCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLS
SMAMISGLSGRKSSTGSPTSPLNAEKLESEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV
VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY
TCKAVNSLGEATCTAELIVETMEEGEGEGGEEEEEE
Enzyme 57 Number of Residues 1176
Enzyme 57 Molecular Weight 128824.3
Enzyme 57 Theoretical pI 6.43
Enzyme 57 GO Classification
Function
Process
Component
Enzyme 57 General Function Involved in actin binding
Enzyme 57 Specific Function Calcium/calmodulin-dependent enzyme responsible for smooth muscle contraction via phosphorylation of a specific serine in the N-terminus of myosin light chains (MLC), an event that facilitates myosin interaction with actin filaments. Also regulates actin-myosin interaction through a non-kinase activty
Enzyme 57 Pathways Not Available
Enzyme 57 Reactions Not Available
Enzyme 57 Pfam Domain Function
Enzyme 57 Signals
  • None
Enzyme 57 Transmembrane Regions
  • None
Enzyme 57 Essentiality Not Available
Enzyme 57 GenBank ID Protein 298639 Link Image
Enzyme 57 UniProtKB/Swiss-Prot ID Q28824 Link Image
Enzyme 57 UniProtKB/Swiss-Prot Entry Name MYLK_BOVIN Link Image
Enzyme 57 PDB ID Not Available
Enzyme 57 Cellular Location Not Available
Enzyme 57 Gene Sequence >3531 bp
ATGGATTTCCGCGCCAACCTGCAGCGGCAGGTGAAGCCGAAGACCCTGTCAGAGGAGGAG
AGGAAAGTGCATGGCCCCCAGCAGGTGGACTTCCGCTCTGTCCTAGCCAAGAAGGGGACT
CCCAAGACCCCTGTGCCTGAGAAGGTACCCCCTCCAAAACCGGCCACGCCAGATTTTCGC
TCAGTGTTGGGCAGTAAGAAAAAATTACCAACAGAGAATGGTAGCAATAACACTGAGGCC
TTGAATGCCAAGGCAGCAGAAGGTCTCAAGCCTGTGGGCAATGCCCAGCCTTCAGGGTTC
CTGAAACCCGTGGGCAACGCCAAGCTGGCTGATACCCCCAAACCCTTGAGCAGCACCAAG
CCAGCAGAGACCCCCAAACCCTTGGGTAATGTCAAGCCAGCTGAGACCCCCAAACCCTTG
GGCAGCACCAAGCCAGCAGAAACCCCCAAACCCTTGGGCAGCACCAAGCCAGCAGAGACC
CCAAAACCCTTGGGTAACGTCAAGCCAGCTGAGACCCCCAAACCCTTGGGTAACATCAAG
CCAACTGAGACCCCCAAACCCTTGGGCAGCACCAAGCCAGCAGAAACCCCCAAACCCTTG
GGCAGCACCAAGCCAGCAGAGACCCCAAAACCCTTGGGTAATGTCAAGCCAGCCGAGACC
CCCAAACCCTTGGGTAATGTCAAGCCAGCTGAGACCCCCAAACCCTTGGGTAATGTCAAG
CCAGCTGAGACCCCTAAACCTGTGAGCAATGCCAAGCCAGCCGAAACCCTCAAACCTGTG
GGCAACGCCAAGCCAGCTGAGACCCCCAAACCCTTGAGTAACGTCAAGCCAGCTGAAACC
CCCAAACTTGTGGGCAATGCCAAGCCAGCTGAGACCTCTAAACCCTTGGATAACGCCAAG
CCAGCTGAGGCCCCCAAACCCTTGGGCAATGCCAAGCCGGCTGAAATCCCAAAACCCACT
GGGAAAGAAGAACTTAAGAAGGAGATTAAGAATGATGTGAACTGCAAGAAGGGCCATGCA
GGGGCCACAGATAGTGAAAAGAGACCAGAGAGCCGAGGGACAGCCCCGACCTTCGAGGAG
AAACTACAAGATCTCCATGTGGCAGAGGGTCAGAAGCTGCTGCTCCAGTGCCGGGTGTCC
TCTGACCCCCCAGCCACCATCACTTGGACACTGAATGGAAAGACGCTCAAGACCACCAAG
TTCATCGTCCTCTCCCAAGAAGGCTCCTTGTGCTCCGTCTCCATCGAGAAGGCACTGCCC
GAGGACAGAGGCTTATACAAGTGTGTAGCCAAGAACAGTGCCGGCCAGGCTGAGTCCTCC
TGCCAAGTCACCGTGGACGTTCCAGATGCCCCCACCAGTGAAAATGCCAAGGCCCCGGAG
ATGAAAGCCCGGAGGCCGAAGAGCTCTCTTCCTCCAGTGCTAGGAACAGAAAGTGACGCA
ACTGTGAAAAAGAAACCTGCCCCCAAGACACCTCCGAAGGCAGCCATGCCGCCTCAGATC
ATCCAGTTTCCTGAGGACCAGAAGGTGCGAGCAGGAGAGTCTGTGGAGCTCTTTGGTAAG
GTGGCCGGCACCCAGCCCATCACCTGCACCTGGATGAAGTTCCGAAAGCAGATCCAGGAC
AGCGAGCACATCAAGGTGGAGAACAGCGAGCAGGGCAGCAAGCTCACCATCCGGGCGGCA
CGCCAGGAGCACTGTGGCTGCTACACCCTGCTGGTGGAGAACAAACTGGGCAGCAGGCAG
GCCCAAGTCAACCTCACCGTGGTGGACAAGCCAGACCCCCCAGCCGGTACACCTTGTGCC
TCTGACATCCGAAGCTCCTCACTGACCTTGTCCTGGTATGGCTCCTCGTATGATGGGGGC
AGCGCCGTACAGTCATACAGTGTCGAGATCTGGGACTCAGTGGACAAGACGTGGAAGGAA
CTAGCCACGTGCCGCAGCACTTCTTTCAACGTCCAGGACCTGCTGCCTGACCGAGAATAT
AAGTTCCGTGTGCGTGCAATCAATGTCTATGGAACCAGTGAGCCAAGCCAGGAGTCTGAA
CTCACAGCCTTGGGAGAGAAACCTGAAGAAGAGCCGAAGGACGAAGTGGAGGTGTCAGAT
GATGATGAGAAGGAGCCTGAGGTCGACTACCGGACCGTCACGGTCAATACCGAGCAGAAA
GTGTCCGACTTCTACGACATCGAAGAGAGACTAGGATCTGGGAAATTTGGACAGGTCTTT
CGACTTGTAGAAAAGAAAACTGGAAAAATCTGGGCAGGGAAATTCTTCAAGGCGTATTCG
GCCAAGGAGAAAGAGAACATCCGGCAGGAGATCAGCATCATGAACTGCCTGCACCACCCC
AAGCTGGTCCAGTGTGTGGACGCCTTCGAAGAGAAGGCCAACATCGTCATGGTCCTGGAG
ATCGTGTCCGGGGGTGAGCTGTTCGAGCGCATCATTGATGAGGACTTTGAGCTGACGGAG
CGGGAGTGCATCAAGTACATGAAGCAGATCTCAGAGGGGGTGGAGTACATCCACAAGCAG
GGCATCGTCCACCTGGACCTCAAGCCCGAGAACATCATGTGTGTCAACAAGACAGGCACC
AGGATCAAGCTCATCGACTTCGGTCTGGCCAGGAGGTTGGAGAATGCGGGGTCTCTGAAG
GTCCTCTTTGGCACCCCGGAGTTCGTCGCACCCGAAGTGATCAACTATGAGCCCATTGGC
TATGCCACGGACATGTGGAGCATCGGGGTCATCTGCTACATCCTGGTCAGTGGACTGTCC
CCCTTCATGGGTGACAATGACAACGAAACCTTAGCCAACGTTACCTCAGCCACCTGGGAC
TTTGACGACGAGGCCTTCGACGAGATCTCCGATGACGCCAAGGATTTTATCAGCAACTTG
CTGAAGAAGGATATGAAAAACCGCCTGAACTGCACCCAGTGCCTTCAGCATCCATGGCTA
ATGAAAGACACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTAC
ATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATCGGAAGACTGTCC
TCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGC
CCGCTCAATGCAGAAAAACTAGAATCTGAAGATGTCTCCCAAGCTTTCCTGGAGGCTGTC
GCTGAGGAGAAGCCCCATGTAAAACCCTACTTTTCCAAGACCATTCGTGACTTAGAAGTT
GTGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCGGACCCTGAAGTC
GTCTGGTTCAAAGATGACCAATCAATCCGGGAGTCCCGCCACTTCCAGATAGACTACGAT
GAGGATGGGAACTGCTCTTTAATCATTAGTGATGTCTGCGGGGATGATGATGCCAAGTAC
ACCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATCGTGGAA
ACCATGGAGGAAGGAGAAGGAGAAGGGGGAGAAGAGGAGGAGGAAGAGTGA
Enzyme 57 GenBank Gene ID S57131 Link Image
Enzyme 57 GeneCard ID MYLK Link Image
Enzyme 57 GenAtlas ID Not Available
Enzyme 57 HGNC ID Not Available
Enzyme 57 Chromosome Location Chromosome:3
Enzyme 57 Locus 3q21
Enzyme 57 SNPs SNPJam Report Link Image
Enzyme 57 General References
  1. [PubMed Link Image]
Enzyme 57 Metabolite References Not Available
Enzyme 58 [top]
Enzyme 58 ID 460
Enzyme 58 Name Polyribonucleotide 5'-hydroxyl-kinase Clp1
Enzyme 58 Synonyms
  1. Polynucleotide kinase Clp1
  2. Pre-mRNA cleavage complex II protein Clp1
Enzyme 58 Gene Name CLP1
Enzyme 58 Protein Sequence >Polyribonucleotide 5'-hydroxyl-kinase Clp1
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAG
AKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVV
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI
QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQ
ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRD
MVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR
FMDLK
Enzyme 58 Number of Residues 425
Enzyme 58 Molecular Weight 47629.2
Enzyme 58 Theoretical pI 6.60
Enzyme 58 GO Classification
Function
Process
Component
Enzyme 58 General Function Involved in ATP binding
Enzyme 58 Specific Function Polynucleotide kinase that can phosphorylate the 5'- hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Appears to have roles in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex. Phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA. Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA- induced silencing complex (RISC). However endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing
Enzyme 58 Pathways Not Available
Enzyme 58 Reactions Not Available
Enzyme 58 Pfam Domain Function
Enzyme 58 Signals
  • None
Enzyme 58 Transmembrane Regions
  • None
Enzyme 58 Essentiality Not Available
Enzyme 58 GenBank ID Protein 126010715 Link Image
Enzyme 58 UniProtKB/Swiss-Prot ID A2VE01 Link Image
Enzyme 58 UniProtKB/Swiss-Prot Entry Name CLP1_BOVIN Link Image
Enzyme 58 PDB ID Not Available
Enzyme 58 Cellular Location Not Available
Enzyme 58 Gene Sequence >1278 bp
ATGGGAGAGGAGGCCAATGATGACAAGAAGCCAACAACTAAATTTGAACTGGAGCGGGAG
ACAGAGCTTCGCTTTGAGGTGGAGGCGTCGCAGTCAGTTCAGTTGGAGCTGCTGGCTGGC
ATGGCAGAAATCTTCGGCACAGAGCTGACCCGAAACAAGAAGTTCACCTTTGATGCCGGC
GCCAAGGTGGCTGTCTTCACTTGGCACGGCTGTTCGCTGCAGCTCAGTGGCCGCACCGAG
GTGGCTTACGTCTCCAAGGATACCCCAATGTTGCTTTATCTCAACACGCATACGGCCTTG
GAGCAGATGCGGAGGCAGGCAGAGAAGGAGGAGGAGCGAGGCCCCCGGGTGATGGTCGTG
GGCCCCACGGACGTGGGCAAGTCCACCGTGTGCCGTCTGCTGCTCAACTACGCGGTGCGT
TTGGGCCGCCGGCCCACGTACGTGGAGCTGGATGTGGGCCAGGGCTCTGTGTCCATCCCC
GGCACCATGGGGGCCCTGTACATTGAGCGGCCAGCGGACGTTGAGGAGGGGTTCTCCATC
CAGGCCCCGCTGGTGTACCACTTCGGCTCCACCACGCCTGGCACCAACATCAAGCTTTAT
AATAAGATTACATCTCGTTTAGCCGATGTGTTCAACCAGAGGTGTGAAGTGAACCGCAGG
GCCTCGGTGAGCGGCTGTGTCATTAACACCTGTGGCTGGGTCAAGGGCTCTGGTTACCAG
GCCCTGGTCCATGCAGCCTCAGCCTTTGAGGTGGATGTCGTTGTGGTTCTGGATCAAGAA
CGGCTGTACAATGAACTGAAACGGGACCTGCCTCACTTCGTCCGCACGGTGCTGCTCCCC
AAGTCGGGGGGTGTGGTGGAGCGCTCCAAGGACTTCCGGCGGGAATGCCGGGATGAGCGC
ATCCGTGAGTATTTCTATGGGTTCCGGGGCTGTTTCTATCCCCATGCCTTCAACGTCAAA
TTTTCAGATGTGAAAATCTACAAAGTCGGGGCACCCACCATCCCAGACTCTTGCCTGCCT
CTGGGCATGTCTCAGGAAGACAATCAGCTCAAGCTGGTGCCTGTTACCCCCGGCCGAGAT
ATGGTGCACCACCTGCTGAGCGTCAGCACGGCGGAGGGCACAGAGGAGAACCTCTCCGAG
ACCAGCGTGGCGGGCTTCATCGTGGTGACCAGTGTGGACCTGGAGCACCAGGTGTTCACC
GTTCTCTCTCCGGCCCCCCGCCCACTGCCCAAGAACTTCCTTCTCATCATGGATATCCGG
TTCATGGATCTTAAGTAG
Enzyme 58 GenBank Gene ID BC133499 Link Image
Enzyme 58 GeneCard ID CLP1 Link Image
Enzyme 58 GenAtlas ID Not Available
Enzyme 58 HGNC ID Not Available
Enzyme 58 Chromosome Location Chromosome:1
Enzyme 58 Locus 11q12
Enzyme 58 SNPs SNPJam Report Link Image
Enzyme 58 General References Not Available
Enzyme 58 Metabolite References Not Available
Enzyme 59 [top]
Enzyme 59 ID 461
Enzyme 59 Name Inositol polyphosphate 1-phosphatase
Enzyme 59 Synonyms
  1. IPPase
  2. IPP
Enzyme 59 Gene Name INPP1
Enzyme 59 Protein Sequence >Inositol polyphosphate 1-phosphatase
MSDILQELLRVSEKAANIARACRQQETLFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEV
IKENMENKFPGLGKKIFGEESNEFTNDLGEKIIMRLGPTEEETVALLSKVLNGNKLASEA
LAKVVHQDVFFSDPALDSVEINIPQDILGIWVDPIDSTYQYIKGSADITPNQGIFPSGLQ
CVTVLIGVYDIQTGVPLMGVINQPFVSQDLHTRRWKGQCYWGLSYLGTNIHSLLPPVSTR
SNSEAQSQGTQNPSSEGSCRFSVVISTSEKETIKGALSHVCGERIFRAAGAGYKSLCVIL
GLADIYIFSEDTTFKWDSCAAHAILRAMGGGMVDLKECLERNPDTGLDLPQLVYHVGNEG
AAGVDQWANKGGLIAYRSEKQLETFLSRLLQHLAPVATHT
Enzyme 59 Number of Residues 400
Enzyme 59 Molecular Weight 43964.8
Enzyme 59 Theoretical pI 5.06
Enzyme 59 GO Classification
Function
Process
Component
Enzyme 59 General Function Inorganic ion transport and metabolism
Enzyme 59 Specific Function 1D-myo-inositol 1,4-bisphosphate + H(2)O = 1D- myo-inositol 4-phosphate + phosphate
Enzyme 59 Pathways
  • Signal transduction
  • phosphatidylinositol signaling pathway
Enzyme 59 Reactions Not Available
Enzyme 59 Pfam Domain Function
Enzyme 59 Signals
  • None
Enzyme 59 Transmembrane Regions
  • None
Enzyme 59 Essentiality Not Available
Enzyme 59 GenBank ID Protein 163223 Link Image
Enzyme 59 UniProtKB/Swiss-Prot ID P21327 Link Image
Enzyme 59 UniProtKB/Swiss-Prot Entry Name INPP_BOVIN Link Image
Enzyme 59 PDB ID 1INP Link Image
Enzyme 59 PDB File Show
Enzyme 59 3D Structure
Enzyme 59 Cellular Location Not Available
Enzyme 59 Gene Sequence >1203 bp
ATGTCAGATATCCTCCAAGAGCTGCTCCGAGTCTCTGAGAAAGCTGCCAACATTGCCCGG
GCGTGCAGGCAGCAGGAAACCCTCTTCCAGCTGCTGATAGAAGAAAAGAAAGAGGGAGAA
AAGAACAAGAAGTTTGCAGTTGATTTCAAGACCCTGGCTGATGTACTGGTACAGGAAGTT
ATCAAAGAGAATATGGAGAACAAGTTTCCAGGCTTGGGGAAAAAAATTTTTGGAGAAGAA
TCCAATGAACTTACTAATGATTTGGGGGAAAAGATTATCATGAGACTGGGTCCTACAGAG
GAAGAAACAGTAGCTCTTCTCAGCAAAGTCCTTAATGGTAACAAGCTGGCATCTGAGGCC
TTAGCCAAGGTTGTGCACCAGGACGTTTTCTTCAGTGACCCAGCTCTGGATTCAGTAGAG
ATCAACATTCCACAGGACATCTTGGGAATCTGGGTGGATCCTATAGATTCAACTTACCAG
TATATAAAAGGTTCTGCTGACATTACACCCAACCAAGGAATCTTCCCCAGTGGACTTCAG
TGCGTCACTGTTTTGATTGGTGTCTATGACATACAGACAGGGGTGCCTCTCATGGGAGTC
ATCAACCAACCTTTTGTATCACAAGACCTACACACCCGCAGGTGGAAAGGACAGTGCTAC
TGGGGCCTTTCTTACCTGGGGACCAATATCCATTCCCTTCTGCCTCCTGTCTCTACAAGA
AGCAACAGCGAAGCGCAGAGCCAAGGGACCCAAAACCCCAGCTCCGAAGGCTCCTGCCGG
TTCTCAGTGGTCATTAGTACCAGTGAAAAGGAGACCATCAAGGGCGCGTTGTCGCATGTG
TGTGGAGAGCGCATCTTCCGGGCAGCTGGGGCTGGTTACAAGAGCCTCTGTGTGATCCTC
GGCCTCGCTGACATTTACATCTTCTCAGAAGATACCACGTTCAAGTGGGACTCCTGTGCT
GCCCACGCCATCCTCAGGGCCATGGGTGGGGGCATGGTGGACTTAAAAGAATGCCTGGAA
AGAAATCCTGACACGGGCCTTGACTTGCCACAGCTGGTGTATCACGTGGGAAACGAAGGC
GCTGCTGGAGTAGATCAGTGGGCCAACAAGGGAGGACTCATCGCATACAGATCAGAGAAG
CAGCTGGAGACGTTCTTGAGCCGCCTCCTCCAGCACCTTGCCCCTGTGGCTACACACACG
TAG
Enzyme 59 GenBank Gene ID M55916 Link Image
Enzyme 59 GeneCard ID INPP1 Link Image
Enzyme 59 GenAtlas ID Not Available
Enzyme 59 HGNC ID Not Available
Enzyme 59 Chromosome Location Chromosome:2
Enzyme 59 Locus 2q32
Enzyme 59 SNPs SNPJam Report Link Image
Enzyme 59 General References
  1. [PubMed Link Image]
Enzyme 59 Metabolite References Not Available
Enzyme 60 [top]
Enzyme 60 ID 462
Enzyme 60 Name Testis-specific serine/threonine-protein kinase 1
Enzyme 60 Synonyms
  1. TSSK-1
  2. Testis-specific kinase 1
  3. TSK-1
Enzyme 60 Gene Name TSSK1B
Enzyme 60 Protein Sequence >Testis-specific serine/threonine-protein kinase 1
MDDAAVLKRRGYIMGINLGEGSYAKVKSAYSERLKFNVAVKIIDRKKAPTDFLEKFLPRE
IEILAMLNHRSIIKTYEIFETSDGKVYIVMELGVQGDLLEFIKTRGALQEDDARKKFHQL
SSAIKYCHDLDVVHRDLKCENLLLDKDFNIKLSDFGFSKRCLRDDSGRLTLSKTFCGSAA
YAAPEVLQGIPYQPKVYDIWSLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKH
LTGECKDLIYRMLQPDVTRRLHIDEILSHCWVQPKARGLSSAAVNKEGESSRAAEPPWTP
EPSSDKKSATKLEPREEVRPEPRAEPSPEEEMATVQVSRQSEAVGLPSEQPSKTEEGAPP
QPSETHA
Enzyme 60 Number of Residues 367
Enzyme 60 Molecular Weight 41568.2
Enzyme 60 Theoretical pI 7.52
Enzyme 60 GO Classification
Function
Process
Component
Enzyme 60 General Function Involved in ATP binding
Enzyme 60 Specific Function May be involved in a signaling pathway during male germ cell development or mature sperm function
Enzyme 60 Pathways Not Available
Enzyme 60 Reactions Not Available
Enzyme 60 Pfam Domain Function
Enzyme 60 Signals
  • None
Enzyme 60 Transmembrane Regions
  • None
Enzyme 60 Essentiality Not Available
Enzyme 60 GenBank ID Protein 74354673 Link Image
Enzyme 60 UniProtKB/Swiss-Prot ID Q3SZW1 Link Image
Enzyme 60 UniProtKB/Swiss-Prot Entry Name TSSK1_BOVIN Link Image
Enzyme 60 PDB ID Not Available
Enzyme 60 Cellular Location Not Available
Enzyme 60 Gene Sequence >1104 bp
ATGGATGACGCTGCCGTCCTCAAGCGACGAGGCTACATCATGGGGATCAATTTGGGAGAG
GGCTCCTACGCCAAAGTCAAATCCGCTTACTCTGAGCGCCTCAAGTTCAACGTGGCGGTC
AAGATCATCGACCGCAAGAAAGCCCCCACGGACTTCCTGGAGAAATTCCTTCCCCGGGAA
ATTGAGATTCTGGCCATGCTAAACCACCGCTCCATCATCAAGACCTACGAGATCTTCGAG
ACGTCAGATGGCAAGGTCTACATCGTCATGGAACTCGGGGTCCAGGGTGACCTCCTTGAG
TTCATCAAGACCCGGGGGGCCCTGCAGGAAGACGACGCTCGAAAGAAGTTCCACCAGCTG
TCCTCGGCCATCAAATACTGCCACGACCTGGACGTCGTCCACCGAGACCTCAAGTGCGAG
AACCTTCTCCTCGACAAGGACTTCAACATCAAGCTGTCCGACTTTGGCTTCTCCAAGCGC
TGCCTGCGGGACGACAGCGGCCGGCTGACGCTGAGCAAGACCTTCTGCGGGTCGGCGGCG
TACGCGGCCCCCGAGGTGCTGCAGGGCATCCCCTACCAGCCCAAGGTGTACGACATCTGG
AGCCTGGGCGTGATTCTCTACATCATGGTCTGCGGCTCCATGCCGTATGACGACTCCAAC
ATCAAGAAGATGCTGCGCATCCAGAAGGAGCACCGTGTCAACTTCCCGCGCTCCAAGCAC
CTGACGGGCGAGTGCAAGGACCTTATCTACCGGATGCTGCAGCCGGACGTCACCCGGCGC
CTGCACATCGACGAGATCCTCAGCCACTGCTGGGTCCAGCCCAAGGCCCGGGGCCTGTCC
TCCGCAGCCGTCAACAAGGAGGGCGAGAGCTCCCGGGCTGCTGAGCCCCCATGGACCCCC
GAACCCAGCTCCGACAAGAAGTCCGCCACCAAGCTGGAGCCCCGGGAAGAGGTGCGGCCC
GAGCCCCGGGCTGAGCCGAGCCCCGAGGAGGAGATGGCAACGGTGCAGGTGTCCCGGCAG
TCAGAGGCCGTGGGTCTGCCCAGTGAGCAGCCCAGCAAGACCGAGGAGGGGGCGCCCCCG
CAGCCTTCAGAGACGCACGCCTAG
Enzyme 60 GenBank Gene ID BC102681 Link Image
Enzyme 60 GeneCard ID TSSK1B Link Image
Enzyme 60 GenAtlas ID Not Available
Enzyme 60 HGNC ID Not Available
Enzyme 60 Chromosome Location Chromosome:5
Enzyme 60 Locus 5q22.2
Enzyme 60 SNPs SNPJam Report Link Image
Enzyme 60 General References Not Available
Enzyme 60 Metabolite References Not Available
Enzyme 61 [top]
Enzyme 61 ID 463
Enzyme 61 Name Alkaline phosphatase, tissue-nonspecific isozyme
Enzyme 61 Synonyms
  1. AP-TNAP
  2. Liver/bone/kidney isozyme
Enzyme 61 Gene Name ALPL
Enzyme 61 Protein Sequence >Alkaline phosphatase, tissue-nonspecific isozyme
MISPFLLLAIGTCFASSLVPEKEKDPKYWRDQAQQTLKNALRLQTLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHSPGEETKLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRSQCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSASYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIEVIMGGGRKYMFPKNRTDVEYELDE
KARGTRLDGLNLIDIWKSFKPKHKHSHYVWNRTDLLALDPHSVDYLLGLFEPGDMQYELN
RNNATDPSLSEMVEMAIRILNKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
QAGAMTSVEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANRDHCASASSSGSPSPGPLLLLLALLPLGSLF
Enzyme 61 Number of Residues 524
Enzyme 61 Molecular Weight 57192.3
Enzyme 61 Theoretical pI 6.77
Enzyme 61 GO Classification
Function
Process
Component
Enzyme 61 General Function Inorganic ion transport and metabolism
Enzyme 61 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 61 Pathways Not Available
Enzyme 61 Reactions Not Available
Enzyme 61 Pfam Domain Function
Enzyme 61 Signals
  • 1-17
Enzyme 61 Transmembrane Regions
  • None
Enzyme 61 Essentiality Not Available
Enzyme 61 GenBank ID Protein 162676 Link Image
Enzyme 61 UniProtKB/Swiss-Prot ID P09487 Link Image
Enzyme 61 UniProtKB/Swiss-Prot Entry Name PPBT_BOVIN Link Image
Enzyme 61 PDB ID Not Available
Enzyme 61 Cellular Location Not Available
Enzyme 61 Gene Sequence >1575 bp
ATGATTTCACCATTCTTACTGCTGGCTATCGGTACCTGTTTTGCCAGCTCCTTAGTGCCA
GAGAAAGAGAAAGATCCCAAGTACTGGCGAGACCAAGCTCAGCAGACCCTGAAAAATGCC
CTGAGGCTTCAGACTCTCAACACCAACGTGGCTAAGAACGTCATCATGTTCCTGGGAGAC
GGTATGGGCGTGTCCACCGTGACAGCTGCCCGCATCCTCAAGGGGCAGCTCCACCACAGC
CCTGGGGAGGAGACCAAGCTGGAGATGGACAAGTTTCCCTACGTGGCCCTCTCCAAGACG
TACAACACCAACGCCCAGGTCCCTGATAGCGCAGGCACCGCCACCGCCTACTTGTGTGGG
GTGAAGGCCAATGAGGGCACCGTGGGGGTGAGCGCAGCAACCCAGCGCTCCCAGTGTAAC
ACCACTCAGGGCAACGAGGTGACCTCCATCCTGCGCTGGGCCAAGGACGCAGGGAAATCC
GTGGGCATCGTGACCACCACGCGCGTGAACCACGCCACCCCCAGCGCCTCCTACGCCCAC
TCTGCTGACCGGGACTGGTACTCGGACAACGAGATGCCCCCGGAGGCCCTGAGCCAGGGC
TGCAAGGACATCGCCTACCAGCTCATGTACAACATTAAGGACATCGAGGTGATCATGGGC
GGCGGCCGGAAGTACATGTTCCCCAAGAACAGAACCGATGTGGAGTATGAGCTGGATGAG
AAGGCCAGAGGCACGAGGCTGGACGGCCTGAACCTCATCGACATCTGGAAGAGCTTCAAA
CCGAAACACAAGCACTCTCACTATGTCTGGAACCGCACTGATCTCCTGGCCCTTGACCCC
CACAGCGTGGACTACCTCTTGGGTCTCTTTGAGCCGGGGGACATGCAGTACGAACTCAAC
AGGAACAATGCGACTGACCCTTCACTCTCTGAGATGGTAGAGATGGCCATCAGGATCCTG
AACAAGAACCCCAAAGGCTTCTTCCTGCTGGTGGAAGGGGGCAGGATTGACCACGGGCAC
CACGAGGGCAAAGCCAAGCAGGCACTGCACGAGGCGGTGGAGATGGACCAGGCCATCGGG
CAGGCAGGTGCTATGACCTCCGTAGAAGACACACTGACCGTTGTCACCGCTGACCACTCC
CACGTCTTTACCTTTGGCGGGTACACCCCCCGTGGCAACTCGATCTTTGGTCTGGCCCCC
ATGGTGAGTGACACAGACAAGAAGCCGTTCACCGCCATCCTGTACGGCAACGGGCCTGGC
TACAAGGTGGTGGGTGGTGAGCGAGAGAATGTCTCCATGGTGGACTACGCTCACAATAAC
TACCAGGCGCAGTCCGCGGTGCCCCTGCGCCACGAGACCCACGGCGGCGAGGACGTGGCC
GTCTTTGCCAAGGGCCCCATGGCGCACCTGCTGCACGGCGTCCAAGAGCAGAACTACATC
CCCCACGTGATGGCCTACGCAGCCTGCATTGGTGCCAACCGCGACCACTGTGCCTCAGCC
AGCTCGTCCGGCAGCCCCTCCCCCGGCCCCCTGCTGCTCCTCCTGGCCCTGCTGCCCCTG
GGCAGCCTGTTCTGA
Enzyme 61 GenBank Gene ID M18443 Link Image
Enzyme 61 GeneCard ID ALPL Link Image
Enzyme 61 GenAtlas ID Not Available
Enzyme 61 HGNC ID Not Available
Enzyme 61 Chromosome Location Chromosome:1
Enzyme 61 Locus 1p36.12
Enzyme 61 SNPs SNPJam Report Link Image
Enzyme 61 General References
  1. [PubMed Link Image]
Enzyme 61 Metabolite References Not Available
Enzyme 62 [top]
Enzyme 62 ID 464
Enzyme 62 Name Alpha-enolase
Enzyme 62 Synonyms
  1. 2-phospho-D-glycerate hydro-lyase
  2. Non-neural enolase
  3. NNE
  4. Enolase 1
  5. Phosphopyruvate hydratase
  6. HAP47
Enzyme 62 Gene Name ENO1
Enzyme 62 Protein Sequence >Alpha-enolase
MSILKVHAREIFDSRGNPTVEVDLFTAKGLFRAAVPSGASTGIYEALELRDNDKTRYMGK
GVSKAVEHINKTIAPALVSKKLNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCK
AGAVEKGVPLYRHIADLAGNAEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGAENFRE
AMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNILENKEALELLKNAIGKAGYSDKV
VIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDELANLYKSFIRDYPVVSIEDPFDQDD
WEAWQKFTASAGIQVVGDDLTVTNPKRIAKAVSEKSCNCLLLKVNQIGSVTESLQACKLA
QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTVAPCRSERLAKYNQILRIEEELGSK
AKFAGRSFRNPLAK
Enzyme 62 Number of Residues 434
Enzyme 62 Molecular Weight 47325.7
Enzyme 62 Theoretical pI 6.79
Enzyme 62 GO Classification
Function
Process
Component
Enzyme 62 General Function Carbohydrate transport and metabolism
Enzyme 62 Specific Function Multifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production
Enzyme 62 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 4/5
Enzyme 62 Reactions Not Available
Enzyme 62 Pfam Domain Function
Enzyme 62 Signals
  • None
Enzyme 62 Transmembrane Regions
  • None
Enzyme 62 Essentiality Not Available
Enzyme 62 GenBank ID Protein 4927286 Link Image
Enzyme 62 UniProtKB/Swiss-Prot ID Q9XSJ4 Link Image
Enzyme 62 UniProtKB/Swiss-Prot Entry Name ENOA_BOVIN Link Image
Enzyme 62 PDB ID Not Available
Enzyme 62 Cellular Location Not Available
Enzyme 62 Gene Sequence Not Available
Enzyme 62 GenBank Gene ID AF149256 Link Image
Enzyme 62 GeneCard ID ENO1 Link Image
Enzyme 62 GenAtlas ID Not Available
Enzyme 62 HGNC ID Not Available
Enzyme 62 Chromosome Location Chromosome:1
Enzyme 62 Locus 1p36.3-p36.2
Enzyme 62 SNPs SNPJam Report Link Image
Enzyme 62 General References
  1. [PubMed Link Image]
Enzyme 62 Metabolite References Not Available
Enzyme 63 [top]
Enzyme 63 ID 465
Enzyme 63 Name Pyruvate kinase
Enzyme 63 Synonyms Not Available
Enzyme 63 Gene Name PKLR
Enzyme 63 Protein Sequence >Pyruvate kinase
MEQIPGDRQRQQLPATMADTFLEHLCLLDIDSEPVVARSTSIIATIGPASRSVERLKEMI
EAGMNIARLNFSHGSHEYHAESIANIREAVESFANSPLSYRPVAIALDTKGPEIRTGILQ
GDPASEVEIVKGSRVLVTVDPEFQTRGDANTVWVDYPNIVRVMPVGGRIYIDDGLISLVV
KKIGPEGLETEVENGGVLGSRKGVNLPGTQVDLPGLSEQDVQDLRFGVEHGVDIVFVSFV
RKASDVAAVRDALGPEGQGIKIVSKIENHEGVKKFNEILEVSDGIMVARGDLGIEIPAEK
VFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGET
AKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCA
GAIIVLTTTGRSAQLLSRYRPRATVIAVTRSAQAARQAHLCRGVFPVLYREPPEDIWADD
VDRRVQFGIDNGKLCGFLSSGDLVIVVTGWQPGSGHTNIMRVLSVT
Enzyme 63 Number of Residues 526
Enzyme 63 Molecular Weight 56869.7
Enzyme 63 Theoretical pI 5.40
Enzyme 63 GO Classification
Function
Process
Component
Enzyme 63 General Function Carbohydrate transport and metabolism
Enzyme 63 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 63 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 63 Reactions Not Available
Enzyme 63 Pfam Domain Function
Enzyme 63 Signals
  • None
Enzyme 63 Transmembrane Regions
  • None
Enzyme 63 Essentiality Not Available
Enzyme 63 GenBank ID Protein 95768271 Link Image
Enzyme 63 UniProtKB/Swiss-Prot ID Q1JPG7 Link Image
Enzyme 63 UniProtKB/Swiss-Prot Entry Name Q1JPG7_BOVIN Link Image
Enzyme 63 PDB ID 1LIU Link Image
Enzyme 63 PDB File Show
Enzyme 63 3D Structure
Enzyme 63 Cellular Location Not Available
Enzyme 63 Gene Sequence >1581 bp
ATGGAGCAGATCCCCGGAGACAGGCAGCGGCAGCAGCTGCCAGCCACTATGGCAGACACC
TTCCTGGAACATCTGTGCCTGCTGGACATCGACTCTGAGCCTGTGGTCGCTCGCAGTACC
AGTATCATCGCCACCATCGGGCCGGCATCTCGCTCCGTGGAGCGTCTCAAGGAGATGATC
GAGGCCGGGATGAACATCGCGAGACTCAACTTCTCCCACGGCTCCCACGAGTACCACGCT
GAGTCCATCGCTAACATCCGGGAGGCGGTGGAGAGCTTTGCAAATTCTCCGCTCAGCTAC
CGACCCGTGGCCATCGCCCTGGACACCAAGGGACCAGAGATACGCACTGGGATCCTGCAA
GGGGACCCGGCGTCAGAAGTGGAGATAGTGAAGGGCTCCCGGGTGCTGGTGACCGTGGAC
CCAGAGTTCCAGACCCGCGGGGACGCGAACACCGTGTGGGTGGACTACCCCAATATCGTC
CGAGTCATGCCGGTGGGGGGCCGCATCTACATTGACGACGGGCTCATCTCCCTAGTGGTC
AAGAAAATCGGTCCGGAAGGGCTAGAGACCGAAGTGGAGAACGGCGGTGTCCTGGGCAGT
CGGAAGGGCGTGAACTTGCCAGGCACCCAGGTGGACCTGCCCGGGCTGTCCGAGCAAGAT
GTCCAGGACCTGCGCTTCGGGGTGGAGCATGGCGTGGACATCGTCTTTGTCTCTTTCGTG
CGGAAAGCCAGCGACGTGGCTGCCGTCCGGGATGCTCTGGGGCCGGAAGGACAGGGCATC
AAGATCGTTAGCAAAATCGAGAACCACGAGGGCGTAAAGAAGTTCAATGAAATCCTGGAG
GTGAGCGACGGTATTATGGTGGCACGGGGTGACCTGGGCATTGAGATCCCGGCTGAGAAG
GTTTTCCTGGCTCAGAAGATGATGATCGGCCGTTGCAACTTGGCGGGAAAGCCCGTTGTC
TGTGCTACACAGATGCTGGAGAGCATGATCACTAAGCCCCGGCCAACTCGGGCAGAGACG
AGTGACGTGGCCAATGCTGTTCTGGATGGGGCAGACTGCATCATGCTGTCAGGGGAGACT
GCCAAAGGCAACTTTCCTGTGGAGGCTGTAAAGATGCAGCATGCGATTGCCCGGGAGGCA
GAGGCTGCCGTGTACCACCGGCAGCTCTTTGAGGAGCTACGCCGGGCAGCACCACTGAGC
CGGGATCCCACGGAGGTCACCGCTATTGGTGCTGTGGAGGCTGCCTTCAAGTGCTGTGCT
GGTGCCATCATTGTGCTGACCACAACTGGCCGCTCAGCCCAGCTTCTGTCCCGGTACCGA
CCTCGGGCAACAGTCATTGCCGTCACCCGCTCTGCTCAGGCTGCCCGCCAGGCCCACCTG
TGCCGAGGAGTCTTCCCTGTGCTCTACCGTGAACCTCCAGAGGACATCTGGGCCGATGAT
GTGGACCGTCGGGTCCAATTTGGCATCGACAATGGAAAGCTCTGTGGCTTCCTCAGTTCT
GGGGACCTGGTGATTGTGGTGACAGGCTGGCAACCAGGCTCCGGCCATACCAACATCATG
CGGGTGCTGAGCGTAACCTGA
Enzyme 63 GenBank Gene ID BT025386 Link Image
Enzyme 63 GeneCard ID PKLR Link Image
Enzyme 63 GenAtlas ID Not Available
Enzyme 63 HGNC ID Not Available
Enzyme 63 Chromosome Location Chromosome:1
Enzyme 63 Locus 1q21
Enzyme 63 SNPs SNPJam Report Link Image
Enzyme 63 General References
  1. [PubMed Link Image]
Enzyme 63 Metabolite References Not Available
Enzyme 64 [top]
Enzyme 64 ID 466
Enzyme 64 Name Adenylate cyclase type 7
Enzyme 64 Synonyms
  1. Adenylate cyclase type VII
  2. ATP pyrophosphate-lyase 7
  3. Adenylyl cyclase 7
Enzyme 64 Gene Name ADCY7
Enzyme 64 Protein Sequence >Adenylate cyclase type 7
MPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLMLLLVAIAACTTLIVITFSYGDPS
RHRAVLGTAFFTLAMFVLLYALVYVECLDRRGLRISALLIWGCLVTLGYVLVFDFDSPRK
DTLCLWGRCPSSSFVVFVVYTLLPFSMWGAVTAGLVSSISHLLVLAMHQEDFTSPVGLKL
LATAVVFVCGNLTGAFHKHHMQDASHDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKERGDRRYLPDNNFHNLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPQPSQHNSKNKGNATLKMRA
SVRMTRYLESWGAARPFAHLNQRESVSSSETLVSHGRRPKAVPLRRHRTPDRSASPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFSTFGSIFLEKGFEREYRLAPIPRVRYYFACA
SLVFVCILLIHVLLLYSMKTLGVSFGLVACVLGLVLGLCFADVFLRCCPALGKLRAIAES
VETQPLLRVSLAILTIGSLLVIAVVNLPLMPFRDRGLTAGNETGLRAVSGWEMSPCYLLP
YYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFNVYPSWQWDCCGHSLGNLTGT
NGTLSSSSCSWHLKTMTNFYLVLFYTTLIMLSRQIDYYCRLDCLWKKKFKKEHEEFETME
NVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGL
ECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVPSGPENQDLERQHAHIG
IMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRM
ESTGELGKIQVTEETCTILQGLGYSCECRGLIDVKGKGELRTYFVCTDTAKFQGLGLN
Enzyme 64 Number of Residues 1078
Enzyme 64 Molecular Weight 120818.4
Enzyme 64 Theoretical pI 8.10
Enzyme 64 GO Classification
Function
Process
Component
Enzyme 64 General Function Signal transduction mechanisms
Enzyme 64 Specific Function This is a membrane-bound, calcium-inhibitable adenylyl cyclase
Enzyme 64 Pathways Not Available
Enzyme 64 Reactions Not Available
Enzyme 64 Pfam Domain Function
Enzyme 64 Signals
  • None
Enzyme 64 Transmembrane Regions
  • 34-54 63-83 95-120 125-145 150-170 176-196 595-615 620-640 669-688 718-737 746-773 792-812
Enzyme 64 Essentiality Not Available
Enzyme 64 GenBank ID Protein 2204110 Link Image
Enzyme 64 UniProtKB/Swiss-Prot ID Q29450 Link Image
Enzyme 64 UniProtKB/Swiss-Prot Entry Name ADCY7_BOVIN Link Image
Enzyme 64 PDB ID Not Available
Enzyme 64 Cellular Location Not Available
Enzyme 64 Gene Sequence >3291 bp
ATGCTCCCCAGGCCGTGGGGTTTCCTGCGTGGACCACTGGGTGTGCCAAGGTGGAGGATG
CCAGCCAAGGGGCGCTACTTCCTCAACGAGGGCGAGGAGGGCCCCGACCAGGATGCGCTC
TACGAGAAGTACCGCCTCACCAGCCAGCACGGGCCACTCCTGCTCATGCTCCTGTTGGTG
GCCATCGCTGCCTGCACCACGCTCATCGTCATCACCTTCAGCTATGGGGACCCCTCCAGA
CACCGGGCCGTCCTGGGGACGGCGTTCTTCACGCTCGCCATGTTTGTGCTCCTCTACGCT
CTGGTGTACGTTGAGTGCCTCGACCGGCGGGGGCTCAGGATTTCCGCGCTGCTCATCTGG
GCCTGCCTTGTGACGCTGGGCTACGTGTTGGTGTTTGATTTCGACTCGCCGAGGAAGGAC
ACCTGTGTCTTGGGGCAGGTGCCCTTCTTCCTGTTCGTGGTCTTCGTGGTGTACACGCTG
CTGCCCTTCAGCATGTGGGGCGCCGTCACGGCCGGACTCGTCTCCAGCATCTCCCACCTC
CTGGTGCTCGCAATGCACCAGGAAGACTTCACCAGCCCTGTGGGGCTGAAGCTGCTGGCC
ACTGCGGTGGTCTTCGTGTGCGGGAACCTCACAGGCGCCTTCCACAAGCACCACATGCAG
GACGCCTCCCACGACCTCTTCACCTACACAGTGAAGTGCATCCAGATTCGGCGTAAGCTG
CGCATCGAGAAGCGCCAGCAGGAGAACCTGCTGCTGTCTGTGCTGCCTGCCCACATCTCC
ATGGGCATGAAGCTGGCCATCATCGAGCGGCTCAAGGAGCGCGGGGACCGCCGTTACCTG
CCCGACAACAACTTCCACAACCTCTACGTCAAGAGGCACCAGAATGTCAGCATCCTCTAC
GCTGACATCGTGGGCTTCACGCGACTGGCCAGTGACTGCTCCCCCAAAGAGCTGGTGGTG
GTGCTGAATGAGCTCTTCGGCAAGTTTGACCAGATCGCCAAGGCCAACGAGTGCATGCGG
ATTAAGATCCTGGGCGACTGCTACTACTGCGTGTCCGGCTTGCCTGTGTCCCTGCCCAAC
CACGCCCGTAACTGTGTGAAGATGGGGCTGGACATGTGTGAGGCCATCAAGCAGGTGCGG
GAGGCCACAGGCGTGGACATCAGCATGCGCGTGGGCATCCACTCGGGGAACGTGCTGTGC
GGCGTCATCGGGCTGCGCAAGTGGCAGTACGACGTGTGGTCCCACGATGTGTCCCTGGCC
AACAGGATGGAGGCGGCCGGAGTCCCTGGCCGGGTGCACATCACAGAGGCGACGCTGAAG
CACCTGGACAAGGCGTATGAGGTGGAGGACGGGCACGGGCAGCAGCGGGACCCTTACCTC
AAAGAGATGAACATCCGCACCTACCTGGTCATCGACCCCCGGAGCCAGCAGCCGCCCCAG
CCCAGCCAGCACAACTCCAAGAACAAGGGGGACGCGACCCTGAAGATGCGGGCGTCCGTG
CGCATGACGCGCTACCTGGAGTCCTGGGGGGCGGCTCGCCCCTTCGCGCACCTCAACCAA
CGCGAGAGCGTGAGCAGCAGTGAGACCCTTGTGTCCCATGGGCGGAGGCCCAAGGCTGTT
CCCCTGAGGCGCCATCGGACCCCTGACAGAAGCGCATCCCCCAAGGGGCGGTCAGAGGAC
GACTCATACGATGATGAGATGCTGTCAGCCATCGAGGGGCTCAGCTCTACCAGACCCTGC
TGCTCCAAGTCTGATGACTTCTCCACCTTTGGGTCCATCTTCCTGGAGAAGGGCTTCGAG
CGAGAGTACCGCCTGGCGCCCATCCCCCGGGTCCGCTACTACTTCGCTTGTGCCAGCCTC
GTCTTCGTCTTCATCCTGCTCATCCACGTCTTGCTGTTGTACAGTATGAAGACTCTGGGC
GTGTCCTTTGGGCTGGTGGCCTGTGTGCTTGGGCTGGTACTAGGCTTGTGCTTCGCCGAT
GTGTTCTTGAGGTGCTGCCCGGCCCTGGGGAAGCTCCGAGCCATTGCCGAGAGCGTGGAG
ACGCAGCCCCTGCTGCGGGTGTCCCTGGCCATCCTGACCATCGGCAGCCTGCTCGTCATT
GCTGTCGTCAACCTGCCCCTGATGCCCTTCCGGGACCGGGGGCTGACTGCTGGGAACGAG
ACGGGCCTGAGGGCTGTGAGCGGCTGGGAGATGAGCCCGTGCTACCTCCTCCCGTACTAC
ACCTGCAGCTGCATCCTGGCCTTCATCGCTTGCTCTGTCTTCCTGCGGATGAGCCTGGAG
CTGAAGGTCGTGCTGCTGACCGTGGCCTTGGTGGCCTACCTGGTCCTCTTCAACGTCTAC
CCGAGCTGGCAGTGGGACTGCTGTGGCCACAGCCTGGGCAACCTCACCGGGACCAATGGC
ACCCTCAGCTCCTCATCCTGTTCATGGCATCTGAAGACGATGACCAATTTCTACCTGGTC
TTGTTCTACACCACCCTCATCATGCTCTCCAGACAGATTGACTATTATTGCCGCCTGGAC
TGTCTGTGGAAGAAGAAGTTCAAGAAGGAACACGAGGAGTTTGAAACAATGGAGAATGTG
AACCGCCTTCTTCTAGAGAATGTCCTGCCCGCGCACGTGGCCGCCCACTTCATCGGTGAC
AAGTTAAATGAGGACTGGTACCATCAGTCCTACGACTGCGTGTGTGTCATGTTTGCGTCG
GTGCCGGACTTTAAAGTCTTCTACACAGAGTGCGACGTCAACAAGGAAGGGCTGGAGTGC
CTGCGCCTGCTCAACGAGATCATCGCCGACTTTGACGAGCTGCTGTTAAAGCCTAAGTTC
AGTGGTGTGGAGAAGATCAAGACCATCGGCAGCACGTACATGGCCGCTGCGGGGCTCAGC
GTCCCCTCGGGGCCTGAGAACCAGGACCTGGAGCGGCAGCACGCCCACATCGGCATCATG
GTAGAGTTCAGCACCGCCCTGATGAGCAAGCTGGACGGCATCAATCGGCACTCCTTCAAC
TCCTTTCGCCTCCGAGTCGGCATAAACCATGGGCCTGTGATTGCTGGAGTGATTGGGGCA
CGAAAACCTCAGTACGACATCTGGGGAAACACGGTCAATGTTGCCAGTCGAATGGAGAGC
ACTGGAGAACTTGGAAAAATCCAGGTTACTGAAGAGACATGTACCATCCTCCAGGGACTA
GGGTATTCCTGTGAGTGCCGCGGGCTGATTGACGTCAAAGGCAAAGGTGAACTGAGGACT
TACTTTGTCTGTACGGACACCGCCAAGTTCCAAGGCCTGGGGCTGAACTGA
Enzyme 64 GenBank Gene ID Z49806 Link Image
Enzyme 64 GeneCard ID ADCY7 Link Image
Enzyme 64 GenAtlas ID Not Available
Enzyme 64 HGNC ID Not Available
Enzyme 64 Chromosome Location Chromosome:1
Enzyme 64 Locus 16q12-q13
Enzyme 64 SNPs SNPJam Report Link Image
Enzyme 64 General References
  1. [PubMed Link Image]
Enzyme 64 Metabolite References Not Available
Enzyme 65 [top]
Enzyme 65 ID 467
Enzyme 65 Name Intestinal alkaline phosphatase
Enzyme 65 Synonyms
  1. IAP
Enzyme 65 Gene Name ALPI
Enzyme 65 Protein Sequence >Intestinal alkaline phosphatase
MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDA
SVNGVRKRKQNLVQAWQAKHQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD
HTKDPTLQEMTEVALRVVSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAGMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYAL
GGGSRPDVNDSTSEDPSYQQQAAVPQASETHGGEDVAVFARGPQAHLVHGVEEETFVAHI
MAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY
Enzyme 65 Number of Residues 533
Enzyme 65 Molecular Weight 57099.1
Enzyme 65 Theoretical pI 6.08
Enzyme 65 GO Classification
Function
Process
Component
Enzyme 65 General Function Inorganic ion transport and metabolism
Enzyme 65 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 65 Pathways Not Available
Enzyme 65 Reactions Not Available
Enzyme 65 Pfam Domain Function
Enzyme 65 Signals
  • 1-19
Enzyme 65 Transmembrane Regions
  • None
Enzyme 65 Essentiality Not Available
Enzyme 65 GenBank ID Protein 289416 Link Image
Enzyme 65 UniProtKB/Swiss-Prot ID P19111 Link Image
Enzyme 65 UniProtKB/Swiss-Prot Entry Name PPBI_BOVIN Link Image
Enzyme 65 PDB ID Not Available
Enzyme 65 Cellular Location Not Available
Enzyme 65 Gene Sequence Not Available
Enzyme 65 GenBank Gene ID L07733 Link Image
Enzyme 65 GeneCard ID ALPI Link Image
Enzyme 65 GenAtlas ID Not Available
Enzyme 65 HGNC ID Not Available
Enzyme 65 Chromosome Location Chromosome:2
Enzyme 65 Locus 2q37.1
Enzyme 65 SNPs SNPJam Report Link Image
Enzyme 65 General References
  1. [PubMed Link Image]
Enzyme 65 Metabolite References Not Available
Enzyme 66 [top]
Enzyme 66 ID 468
Enzyme 66 Name Protein phosphatase 1B
Enzyme 66 Synonyms
  1. Protein phosphatase 2C isoform beta
  2. PP2C-beta
Enzyme 66 Gene Name PPM1B
Enzyme 66 Protein Sequence >Protein phosphatase 1B
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITNNEDFRAAGKSGSALEPSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAMRKDSELDKYLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGNI
IFFRRHVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEML
TSYRLAKVEGEENPAEQAATAASSNSDAGNTVAMQESHTESKSDLAELDSCTEDAGTKMS
GEKL
Enzyme 66 Number of Residues 484
Enzyme 66 Molecular Weight 53430.2
Enzyme 66 Theoretical pI 4.73
Enzyme 66 GO Classification
Function
Process
Component
Enzyme 66 General Function Signal transduction mechanisms
Enzyme 66 Specific Function Enzyme with a broad specificity
Enzyme 66 Pathways Not Available
Enzyme 66 Reactions Not Available
Enzyme 66 Pfam Domain Function
Enzyme 66 Signals
  • None
Enzyme 66 Transmembrane Regions
  • None
Enzyme 66 Essentiality Not Available
Enzyme 66 GenBank ID Protein 3063745 Link Image
Enzyme 66 UniProtKB/Swiss-Prot ID O62830 Link Image
Enzyme 66 UniProtKB/Swiss-Prot Entry Name PPM1B_BOVIN Link Image
Enzyme 66 PDB ID Not Available
Enzyme 66 Cellular Location Not Available
Enzyme 66 Gene Sequence >1164 bp
ATGGGTGCATTTTTGGACAAACCCAAAACTGAGAAACATAATGCTCATGGTGCTGGGAAT
GGTTTACGTTACGGCCTGAGCAGCATGCAAGGATGGAGAGTGGAAATGGAAGATGCGCAC
ACAGCTGTTGTAGGTATTCCGCACGGCTTGGAAGACTGGTCGTTTTTTGCAGTTTATGAT
GGTCACGCCGGATCCCGAGTAGCAAATTACTGCTCAACACACTTATTAGAACACATCACG
AACAACGAAGACTTCAGGGCAGCTGGAAAGTCAGGATCTGCTCTTGAGCCTTCAGTGGAA
AATGTCAAGAATGGTATCAGAACTGGCTTTTTGAAGATTGATGAATACATGCGTAACTTT
TCAGACCTCAGAAATGGCATGGACAGGAGCGGTTCAACTGCAGTGGGAGTTATGATTTCA
CCTAAGCACATCTACTTCATCAACTGTGGCGATTCACGGGCTGTTCTGTATAGGAGTGGA
CAAGTCTGCTTTTCTACCCAAGATCACAAACCTTGCAACCCAAGGGAGAAAGAGCGAATC
CAAAATGCAGGAGGCAGCGTAATGATACAGCGTGTTAATGGTTCATTAGCAGTGTCTCGT
GCTCTGGGGGACTATGATTACAAGTGTGTTGATGGCAAGGGCCCAACAGAACAACTTGTT
TCTCCAGAGCCTGAGGTTTATGAAATTTTAAGAGCAGAAGAGGATGAATTTATCATCTTG
GCTTGTGATGGGATCTGGGATGTTATGAGTAATGAGGAGCTCTGTGAATTTGTTAAATCT
AGGCTTGAGGTATCTGATGACCTGGAAAATGTGTGCAATTGGGTAGTGGACACTTGTTTA
CATAAGGGAAGTCGAGATAACATGAGTATTGTACTAGTTTGCTTTTCAAATGCTCCCAAG
GTCTCAGATGAAGCAATGAGAAAAGACTCAGAGTTGGATAAGTACTTGGAATCACGGGTG
GAAGAAATTATGGAGAAGTCTGGTGAGGAAGGGATGCCTGATCTTGCCCACGTCATGCGC
ATCTTGTCTGCAGAAAATATCCCAAATTTGCCTCCTGGGGGAGGTCTTGCTGGCAAGCGC
CATGTTATTGAAGCTGTTTATAGTAGGCTGAATCCACATAGAGAAAGTGATGGGGGTGCT
GGAGATCTAGAAGACCCATGGTAG
Enzyme 66 GenBank Gene ID AJ005458 Link Image
Enzyme 66 GeneCard ID PPM1B Link Image
Enzyme 66 GenAtlas ID Not Available
Enzyme 66 HGNC ID Not Available
Enzyme 66 Chromosome Location Chromosome:2
Enzyme 66 Locus 2p21
Enzyme 66 SNPs SNPJam Report Link Image
Enzyme 66 General References
  1. [PubMed Link Image]
Enzyme 66 Metabolite References Not Available
Enzyme 67 [top]
Enzyme 67 ID 469
Enzyme 67 Name Ribonuclease ZC3H12A
Enzyme 67 Synonyms
  1. Zinc finger CCCH domain-containing protein 12A
Enzyme 67 Gene Name ZC3H12A
Enzyme 67 Protein Sequence >Ribonuclease ZC3H12A
MSLWELEDRRSCQGTPRPAQEPTAEEATTAELQMKVDFFRKLGYSSAEIHSVLQKLGIQA
DTNTVLGELVKHGSAAERERQASPDPCPQLPLVPRGGGTPKAPTVETYPPEEDKEGSDLR
PIVIDGSNVAMSHGNKDVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQ
HILRDLEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGIVVSNDTYRDLQGERQEW
KRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLTSEHKKQPCPYGRKCTYGI
KCRFLHPERPSRPQRSVADELRANALLPPSRAASKDKNSRRPSPSSQPGSLPTEHEQCSP
DRKKLGAQASPGTPREGLMQTFAPTGRSLPPSGSSGGSFGPSEWFPQTLDSLPYASQDCL
DSGIGSLESQMSELWGVRGGGPGEPGPPRGPYAGYCTYGAELPATPAFSAFSRALGAGHF
SVPADYAPPPAAFPPREYWSEPYQLPPPTQRLQEPQAPGPGADRGPWGGAGRLAKERASV
YTKLCGVFPPHLVEAVMSRFPQLLDPQQLAAEILSYKSQHLSE
Enzyme 67 Number of Residues 583
Enzyme 67 Molecular Weight 64262.0
Enzyme 67 Theoretical pI 7.89
Enzyme 67 GO Classification
Function
Process
Component
Enzyme 67 General Function Involved in endonuclease activity
Enzyme 67 Specific Function Has RNase activity and selectively degrades specific target mRNA species. Modulates the immune response and inflammation by regulating the decay of specific mRNA molecules. Recognizes the 3'-untranslated region (UTR) of the mRNA for IL6, CALCR and IL12B. Required for normal decay of IL6 mRNA. Triggers apoptosis and promotes angiogenesis in response to the binding of CCL2 to CCR2. Regulates expression of CDH12 and CHD19
Enzyme 67 Pathways Not Available
Enzyme 67 Reactions Not Available
Enzyme 67 Pfam Domain Function
Enzyme 67 Signals
  • None
Enzyme 67 Transmembrane Regions
  • None
Enzyme 67 Essentiality Not Available
Enzyme 67 GenBank ID Protein 151554535 Link Image
Enzyme 67 UniProtKB/Swiss-Prot ID A6QQJ8 Link Image
Enzyme 67 UniProtKB/Swiss-Prot Entry Name ZC12A_BOVIN Link Image
Enzyme 67 PDB ID Not Available
Enzyme 67 Cellular Location Not Available
Enzyme 67 Gene Sequence >1752 bp
ATGAGCCTGTGGGAACTTGAAGACCGCCGAAGCTGCCAGGGGACCCCCAGGCCGGCCCAG
GAGCCCACGGCCGAGGAGGCAACGACTGCAGAGTTGCAGATGAAGGTTGACTTCTTCCGG
AAGCTGGGCTACTCATCTGCTGAGATCCACAGTGTCCTGCAGAAGCTGGGCATCCAGGCA
GACACCAACACAGTGCTGGGGGAGCTGGTTAAACATGGGTCAGCGGCCGAGCGGGAGCGC
CAGGCATCGCCGGACCCCTGCCCTCAGCTGCCTCTGGTCCCCCGGGGTGGGGGCACCCCC
AAGGCTCCCACCGTGGAGACTTATCCACCCGAGGAAGACAAGGAGGGCAGTGACCTGAGA
CCCATAGTCATCGATGGGAGCAACGTGGCCATGAGCCATGGGAACAAGGACGTCTTCTCC
TGCCGGGGGATCCTCCTGGCAGTGAATTGGTTCCTGGAGCGGGGCCACACAGACATCACC
GTGTTTGTGCCGTCCTGGAGGAAAGAGCAGCCTCGCCCAGATGTGCCCATCACTGATCAG
CACATCCTGCGGGACCTGGAGAAGAAGAAGATCTTGGTGTTCACACCGTCGCGGCGGGTG
GGTGGCAAGCGGGTAGTCTGCTATGACGACCGCTTCATCGTGAAGCTGGCCTTTGAGTCG
GACGGCATCGTGGTCTCCAATGACACGTACCGGGACCTGCAGGGCGAGCGGCAGGAGTGG
AAGCGTTTCATCGAGGAGCGGCTGCTCATGTACTCCTTTGTCAATGACAAGTTCATGCCC
CCCGATGACCCTTTGGGCCGTCATGGGCCGAGCCTGGACAACTTCCTGCGTAAGAAGCCG
CTCACATCAGAGCACAAGAAGCAGCCGTGTCCCTATGGGAGGAAATGCACCTACGGGATC
AAGTGCCGATTCTTGCACCCCGAGCGGCCGAGCCGGCCCCAGCGCTCCGTGGCCGACGAG
CTCCGCGCCAACGCCCTGCTGCCACCCTCCAGGGCCGCGAGCAAAGACAAAAACAGCCGG
CGGCCTTCACCCTCCTCTCAGCCCGGCTCTCTGCCAACAGAGCACGAGCAGTGCAGCCCG
GACAGGAAGAAGCTGGGGGCCCAGGCGTCTCCAGGAACCCCCCGGGAGGGCCTGATGCAG
ACCTTTGCCCCGACAGGCAGGAGCCTCCCTCCTAGTGGGAGCAGTGGCGGCAGCTTCGGG
CCCTCAGAGTGGTTCCCGCAGACCCTGGACTCTCTCCCCTACGCCTCCCAGGACTGCCTG
GACTCGGGCATCGGCTCCCTGGAGAGCCAGATGTCAGAACTCTGGGGGGTTCGAGGAGGG
GGCCCTGGCGAGCCGGGCCCACCTCGGGGCCCTTATGCCGGCTACTGCACCTACGGGGCA
GAGCTCCCTGCCACCCCGGCCTTCTCGGCCTTCAGCCGGGCCCTGGGTGCCGGCCACTTC
AGCGTCCCCGCTGACTATGCACCCCCGCCGGCCGCCTTTCCACCTCGGGAATACTGGTCT
GAGCCATACCAGCTGCCCCCGCCCACCCAACGCCTGCAGGAGCCCCAGGCACCTGGCCCA
GGAGCTGACAGGGGCCCCTGGGGTGGGGCAGGCAGGCTGGCGAAGGAGCGAGCCAGCGTG
TACACTAAGCTGTGTGGAGTCTTCCCCCCACACCTGGTGGAGGCCGTGATGTCGCGCTTC
CCGCAGCTCCTGGACCCCCAGCAGCTGGCCGCCGAGATCCTCTCCTACAAGTCCCAGCAC
CTCAGTGAATAA
Enzyme 67 GenBank Gene ID BC149867 Link Image
Enzyme 67 GeneCard ID ZC3H12A Link Image
Enzyme 67 GenAtlas ID Not Available
Enzyme 67 HGNC ID Not Available
Enzyme 67 Chromosome Location Chromosome:1
Enzyme 67 Locus 1p34.3
Enzyme 67 SNPs SNPJam Report Link Image
Enzyme 67 General References Not Available
Enzyme 67 Metabolite References Not Available
Enzyme 68 [top]
Enzyme 68 ID 470
Enzyme 68 Name Integrin-linked kinase-associated serine/threonine phosphatase 2C
Enzyme 68 Synonyms
  1. ILKAP
Enzyme 68 Gene Name ILKAP
Enzyme 68 Protein Sequence >Integrin-linked kinase-associated serine/threonine phosphatase 2C
MDLFGDLPEPERSPRPAAGSGGPLLFDDLPPASSGDSGSLDTSLSEEVKNEGKGAKRKAS
DEEKNGSEELVEKKVCKASSVIFSLKGYVAERKGEREEMQDAHVILNDITAECQPPSALV
TRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDGISVEKTVKRCLLDTFKHTDEEF
LKQASSQKPAWKDGSTATCVLAVDNTLYIANLGDSRAILCRYNEESQKHAALSLSKEHNP
TQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFIL
LACDGLFKVFTPEEAVNFILSCLEDEKIQRREGKPTVDARYEAACNRLANKAVQRGSADN
VTVMVVRIGL
Enzyme 68 Number of Residues 370
Enzyme 68 Molecular Weight 40621.5
Enzyme 68 Theoretical pI 7.05
Enzyme 68 GO Classification
Function
Process
Component
Enzyme 68 General Function Signal transduction mechanisms
Enzyme 68 Specific Function Protein phosphatase that may play a role in regulation of cell cycle progression via dephosphorylation of its substrates whose appropriate phosphorylation states might be crucial for cell proliferation. Selectively associates with integrin linked kinase (ILK), to modulate cell adhesion and growth factor signaling. Inhibits the ILK-GSK3B signaling axis and may play an important role in inhibiting oncogenic transformation
Enzyme 68 Pathways Not Available
Enzyme 68 Reactions Not Available
Enzyme 68 Pfam Domain Function
Enzyme 68 Signals
  • None
Enzyme 68 Transmembrane Regions
  • None
Enzyme 68 Essentiality Not Available
Enzyme 68 GenBank ID Protein 113911858 Link Image
Enzyme 68 UniProtKB/Swiss-Prot ID Q0IIF0 Link Image
Enzyme 68 UniProtKB/Swiss-Prot Entry Name ILKAP_BOVIN Link Image
Enzyme 68 PDB ID Not Available
Enzyme 68 Cellular Location Not Available
Enzyme 68 Gene Sequence >1113 bp
ATGGACCTGTTCGGGGACCTGCCGGAGCCCGAGCGCTCGCCGCGGCCGGCTGCTGGCTCT
GGGGGACCTTTGCTTTTTGACGATCTCCCGCCAGCCAGCAGTGGCGATTCAGGTTCTCTT
GACACTTCGTTATCCGAGGAGGTAAAGAATGAAGGGAAAGGAGCAAAGAGAAAAGCCTCT
GATGAAGAGAAGAATGGGAGTGAAGAGCTTGTGGAAAAGAAAGTTTGTAAAGCCTCTTCG
GTGATCTTCAGCCTGAAAGGCTACGTGGCTGAGCGGAAGGGCGAGCGGGAAGAGATGCAG
GATGCCCACGTCATCCTGAACGACATCACCGCGGAGTGCCAGCCCCCGTCCGCTCTCGTC
ACCCGGGTTTCATACTTTGCTGTTTTTGATGGACATGGAGGAATTCGAGCCTCAAAATTC
GCCGCACAGAATTTGCATCAGAACTTAATCAGGAAATTTCCTAAAGGAGATGGAATCAGC
GTAGAGAAAACGGTGAAAAGGTGCCTTCTGGACACCTTCAAGCATACTGATGAAGAGTTC
CTTAAGCAAGCCTCAAGCCAGAAACCTGCCTGGAAAGATGGGTCCACTGCCACGTGTGTG
CTGGCCGTAGACAACACTCTTTACATCGCCAACCTGGGGGACAGTCGGGCAATCCTTTGT
CGTTACAATGAGGAGAGTCAAAAACACGCGGCCTTAAGCCTCAGCAAGGAGCATAATCCA
ACCCAGTATGAAGAACGAATGAGAATACAGAAGGCCGGAGGGAATGTCAGGGACGGGCGT
GTCCTGGGTGTGCTGGAGGTGTCCCGCTCCATCGGGGACGGGCAGTACAAGCGCTGCGGG
GTCACCTCGGTGCCGGACATCAGACGCTGCCAGCTGACCCCCAACGACAGGTTTATTTTG
CTGGCCTGTGATGGCCTCTTCAAGGTCTTTACCCCAGAAGAAGCCGTGAACTTCATCTTG
TCCTGCCTGGAGGACGAGAAGATCCAAAGGCGGGAAGGGAAGCCCACTGTGGATGCCCGC
TACGAAGCCGCCTGCAACAGGCTGGCCAACAAGGCGGTGCAGCGGGGCTCGGCGGACAAC
GTCACCGTGATGGTGGTGCGGATAGGGCTCTGA
Enzyme 68 GenBank Gene ID BC122677 Link Image
Enzyme 68 GeneCard ID ILKAP Link Image
Enzyme 68 GenAtlas ID Not Available
Enzyme 68 HGNC ID Not Available
Enzyme 68 Chromosome Location Chromosome:2
Enzyme 68 Locus 2q37.3
Enzyme 68 SNPs SNPJam Report Link Image
Enzyme 68 General References Not Available
Enzyme 68 Metabolite References Not Available
Enzyme 69 [top]
Enzyme 69 ID 471
Enzyme 69 Name Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
Enzyme 69 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
  3. NAD(+)-isocitrate dehydrogenase subunit 1
  4. IDH1
Enzyme 69 Gene Name IDH3B
Enzyme 69 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
MAALSRVRWLTRALVAAPNPGAWRSLCTSTVAQASSRTQGEDVRVEGAFPVTMLPGDGVG
PELMHAVKEVFKAASVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRTKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFEKMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEHHSNMIAEAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLHPYGG
Enzyme 69 Number of Residues 385
Enzyme 69 Molecular Weight 42496.9
Enzyme 69 Theoretical pI 8.91
Enzyme 69 GO Classification
Function
Process
Component
Enzyme 69 General Function Energy production and conversion
Enzyme 69 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 69 Pathways Not Available
Enzyme 69 Reactions Not Available
Enzyme 69 Pfam Domain Function
Enzyme 69 Signals
  • None
Enzyme 69 Transmembrane Regions
  • None
Enzyme 69 Essentiality Not Available
Enzyme 69 GenBank ID Protein 3643257 Link Image
Enzyme 69 UniProtKB/Swiss-Prot ID O77784 Link Image
Enzyme 69 UniProtKB/Swiss-Prot Entry Name IDH3B_BOVIN Link Image
Enzyme 69 PDB ID Not Available
Enzyme 69 Cellular Location Not Available
Enzyme 69 Gene Sequence >1152 bp
ATGGCTGCCCTCAGCCGTGTCCGCTGGCTGACCCGAGCACTGGTCGCCGCTCCGAATCCC
GGAGCATGGAGGAGCCTGTGTACCTCAACCGTGGCGCAAGCCTCCTCGCGGACCCAGGGC
GAGGATGTGAGGGTGGAGGGCGCCTTTCCCGTGACTATGCTGCCAGGAGACGGCGTGGGG
CCTGAGCTGATGCACGCTGTCAAGGAGGTGTTCAAGGCTGCCTCTGTCCCAGTGGAGTTC
CAGGAGCATCACCTGAGCGAGGTGCAGAATATGGCATCTGAGGAGAAGCTGGAGCAGGTG
CTGAGTTCCATGAAGGAGAACAAAGTGGCCATCATTGGAAAGATCCACACCCCAATGGAG
TATAAAGGGGAGCTAGCCTCCTATGATATGCGGCTGAGGCGGAAGTTGGACTTGTTTGCC
AATGTGGTCCATGTGAAGTCACTTCCTGGGTACAAGACTCGACACAACAATCTAGATTTG
GTGATTATTCGAGAGCAGACAGAAGGGGAGTACAGTTCTCTGGAACACGAGAGTGCGAGG
GGTGTGATTGAGTGCTTGAAGATTGTCACTCGAACCAAATCACAGCGGATTGCAAAGTTC
GCCTTTGACTATGCCACTAAGAAGGGGCGGGGCAAGGTCACGGCTGTCCACAAGGCCAAT
ATCATGAAACTGGGGGATGGGTTGTTCCTGCAGTGCTGTGAGGAAGTTGCTGAACTGTAT
CCCAAGATCAAGTTTGAGAAAATGATCATAGACAACTGCTGCATGCAGCTGGTGCAGAAT
CCTTACCAGTTTGACGTGCTGGTGATGCCCAATCTCTATGGGAACATTATTGACAATCTG
GCTGCTGGCCTGGTTGGGGGAGCTGGTGTGGTCCCTGGTGAGAGCTACAGTGCAGAGTAC
GCAGTGTTTGAGACGGGTGCCCGGCATCCATTTGCCCAGGCAGTGGGCAGGAATATAGCC
AACCCCACAGCCATGCTGCTGTCAGCTTCCAACATGCTGCGGCATCTCAATCTCGAGCAT
CACTCCAACATGATTGCAGAGGCAGTGAAGAAGGTGATTAAAGTTGGCAAGGTTCGAACT
TCTGACATGGGTGGTTATGCCACCTGCCAAGACTTCACTGAGGCTGTCATTGGTGCCCTG
TCCAACCCATAG
Enzyme 69 GenBank Gene ID AF090321 Link Image
Enzyme 69 GeneCard ID IDH3B Link Image
Enzyme 69 GenAtlas ID Not Available
Enzyme 69 HGNC ID Not Available
Enzyme 69 Chromosome Location Chromosome:2
Enzyme 69 Locus 20p13
Enzyme 69 SNPs SNPJam Report Link Image
Enzyme 69 General References
  1. [PubMed Link Image]
Enzyme 69 Metabolite References Not Available
Enzyme 70 [top]
Enzyme 70 ID 472
Enzyme 70 Name DNA polymerase beta
Enzyme 70 Synonyms Not Available
Enzyme 70 Gene Name POLB
Enzyme 70 Protein Sequence >DNA polymerase beta
MSKRKAPQETLNGGITDMLTELANFEKNVNQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLSEVKKVDSEYIATVCGS
FRRGAESSGDMDVLLTHPSFTSESAKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Enzyme 70 Number of Residues 335
Enzyme 70 Molecular Weight 38266.5
Enzyme 70 Theoretical pI 9.53
Enzyme 70 GO Classification
Function
Process
Component
Enzyme 70 General Function Replication, recombination and repair
Enzyme 70 Specific Function Repair polymerase. Conducts "gap-filling" DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases. Has a 5'-deoxyribose-5- phosphate lyase (dRP lyase) activity
Enzyme 70 Pathways Not Available
Enzyme 70 Reactions Not Available
Enzyme 70 Pfam Domain Function
Enzyme 70 Signals
  • None
Enzyme 70 Transmembrane Regions
  • None
Enzyme 70 Essentiality Not Available
Enzyme 70 GenBank ID Protein 73587414 Link Image
Enzyme 70 UniProtKB/Swiss-Prot ID Q27958 Link Image
Enzyme 70 UniProtKB/Swiss-Prot Entry Name DPOLB_BOVIN Link Image
Enzyme 70 PDB ID 8ICK Link Image
Enzyme 70 PDB File Show
Enzyme 70 3D Structure
Enzyme 70 Cellular Location Not Available
Enzyme 70 Gene Sequence >1008 bp
ATGAGCAAACGGAAGGCGCCGCAGGAGACTCTCAACGGGGGCATCACCGACATGCTCACA
GAACTCGCAAACTTTGAGAAGAACGTGAACCAGGCTATCCACAAATACAATGCCTACAGA
AAAGCAGCATCTGTGATAGCAAAGTACCCACACAAAATAAAGAGTGGAGCGGAAGCTAAG
AAACTGCCTGGAGTAGGAACAAAAATTGCTGAAAAAATTGATGAGTTTTTAGCTACTGGA
AAATTGCGTAAACTGGAAAAGATTCGGCAGGATGATACGAGTTCATCCATCAATTTCCTG
ACTCGAGTTAGTGGCATTGGTCCATCTGCTGCAAGGAAGTTTGTAGATGAAGGAATTAAG
ACATTAGAAGATCTCAGAAAAAATGAAGATAAATTGAACCATCATCAACGAATTGGGCTA
AAATATTTTGAGGACTTTGAGAAAAGAATTCCTCGTGAAGAAATGTTACAAATGCAAGAT
ATTGTACTAAGTGAAGTTAAAAAAGTGGATTCTGAATACATTGCTACAGTCTGTGGCAGT
TTCAGAAGAGGTGCAGAGTCCAGTGGTGACATGGATGTCCTTCTCACCCATCCAAGCTTT
ACCTCTGAGTCAGCCAAACAGCCCAAACTGTTACATCGTGTTGTGGAGCAGTTACAAAAG
GTCCGTTTCATTACAGACACTCTGTCAAAGGGTGAAACAAAGTTCATGGGTGTTTGCCAG
CTTCCCAGTAAAAACGATGAAAAGGAATATCCACACAGGAGAATTGATATCAGGTTGATA
CCCAAGGATCAGTATTACTGCGGTGTCCTCTATTTCACTGGGAGTGATATTTTCAATAAG
AATATGAGAGCTCATGCCCTAGAAAAAGGCTTCACAATCAATGAATACACAATCCGTCCC
CTGGGTGTCACTGGCGTTGCCGGGGAGCCCCTGCCCGTGGACAGTGAGAAGGACATCTTC
GACTACATCCAGTGGAAATACCGTGAGCCCAAGGACCGAAGCGAGTGA
Enzyme 70 GenBank Gene ID BC103229 Link Image
Enzyme 70 GeneCard ID POLB Link Image
Enzyme 70 GenAtlas ID Not Available
Enzyme 70 HGNC ID Not Available
Enzyme 70 Chromosome Location Chromosome:8
Enzyme 70 Locus 8p11.2
Enzyme 70 SNPs SNPJam Report Link Image
Enzyme 70 General References
  1. [PubMed Link Image]
Enzyme 70 Metabolite References Not Available
Enzyme 71 [top]
Enzyme 71 ID 473
Enzyme 71 Name Serine/threonine-protein kinase 4
Enzyme 71 Synonyms
  1. STE20-like kinase MST1
  2. MST-1
  3. Mammalian STE20-like protein kinase 1
Enzyme 71 Gene Name STK4
Enzyme 71 Protein Sequence >Serine/threonine-protein kinase 4
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDSFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQEEEENSEEDELDSGTMVRAAGDEMGTVRVASSMSDGANTMIEHDDT
LPSQLGTMVINTEDEEEEGTMKRRDETMQPARPSFLEYFEQKEKENQINSFGKSVPGPLQ
NSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
Enzyme 71 Number of Residues 487
Enzyme 71 Molecular Weight 55586.7
Enzyme 71 Theoretical pI 4.68
Enzyme 71 GO Classification
Function
Process
Component
Enzyme 71 General Function Involved in ATP binding
Enzyme 71 Specific Function Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Phosphorylates 'Ser-14' of histone H2B during apoptosis. Phosphorylates FOXO3 upon oxidative stress, which results in its nuclear translocation and cell death initiation
Enzyme 71 Pathways Not Available
Enzyme 71 Reactions Not Available
Enzyme 71 Pfam Domain Function
Enzyme 71 Signals
  • None
Enzyme 71 Transmembrane Regions
  • None
Enzyme 71 Essentiality Not Available
Enzyme 71 GenBank ID Protein 59858173 Link Image
Enzyme 71 UniProtKB/Swiss-Prot ID Q5E9L6 Link Image
Enzyme 71 UniProtKB/Swiss-Prot Entry Name STK4_BOVIN Link Image
Enzyme 71 PDB ID Not Available
Enzyme 71 Cellular Location Not Available
Enzyme 71 Gene Sequence >1464 bp
ATGGAGACGGTGCAGCTTAGGAACCCGCCGCGCCGGCAGCTGAAAAAGTTGGATGAAGAT
AGTTTAACTAAACAACCGGAAGAAGTGTTTGATGTCTTAGAGAAACTTGGAGAAGGGTCC
TATGGCAGCGTGTACAAAGCTATTCATAAAGAGACCGGTCAGATTGTTGCTATTAAGCAA
GTTCCTGTGGAATCAGACCTGCAGGAGATAATCAAAGAAATCTCTATCATGCAGCAATGT
GACAGCCCTCATGTAGTCAAATATTACGGCAGTTACTTTAAGAACACAGACTTGTGGATC
GTGATGGAGTACTGTGGGGCTGGTTCTGTATCTGATATTATTCGATTACGAAATAAAACG
TTAACAGAAGATGAAATAGCTACAATATTACAGTCAACACTTAAGGGACTGGAATATCTT
CATTTTATGAGAAAAATACACCGAGATATCAAAGCAGGAAATATTTTGCTCAATACAGAA
GGTCATGCAAAACTTGCAGATTTTGGGGTAGCAGGTCAACTTACAGATACCATGGCCAAG
CGAAATACAGTGATAGGAACACCTTTTTGGATGGCTCCAGAAGTGATCCAGGAAATTGGG
TACAACTGTGTAGCAGACATCTGGTCATTGGGAATAACAGCCATAGAAATGGCTGAAGGA
AAGCCTCCATATGCTGATATCCATCCAATGAGGGCCATCTTCATGATTCCTACCAACCCA
CCCCCCACATTCCGAAAGCCGGAACTGTGGTCAGATAGCTTCATGGATTTTGTGAAGCAG
TGTCTTGTCAAGAGCCCCGAGCAGAGAGCCACAGCCACTCAACTCCTCCAGCACCCGTTT
GTCAAGAGTGCCAAAGGAGTGTCCATACTGCGGGACTTGATTAATGAAGCCATGGACGTG
AAGCTGAAACGCCAGGAGGCCCAGCAGCGGGAGGTGGACCAGGAGGAGGAAGAAAACTCT
GAGGAGGATGAGCTAGATTCTGGCACGATGGTCCGAGCAGCAGGGGATGAGATGGGCACT
GTCCGAGTAGCCAGCAGCATGAGTGACGGGGCCAATACGATGATCGAGCACGATGACACG
TTGCCGTCCCAGCTGGGCACCATGGTGATCAACACGGAGGACGAGGAAGAAGAAGGCACA
ATGAAAAGAAGGGACGAGACCATGCAGCCTGCCAGACCATCGTTCCTTGAATATTTCGAA
CAAAAAGAAAAGGAAAATCAGATCAACAGCTTCGGCAAGAGTGTCCCTGGCCCATTGCAG
AACTCCTCAGATTGGAAAGTTCCCCAGGATGGAGACTATGAATTCCTGAAGAGTTGGACG
GTGGAAGACCTTCAGAAGAGGCTCCTGGCCCTGGACCCCATGATGGAGCAGGAGATTGAG
GAGATCCGGCAGAAGTACCAGTCGAAGCGGCAGCCCATCCTGGACGCCATTGAGGCCAAG
AAGCGGCGGCAGCAGAACTTCTGA
Enzyme 71 GenBank Gene ID BT020904 Link Image
Enzyme 71 GeneCard ID STK4 Link Image
Enzyme 71 GenAtlas ID Not Available
Enzyme 71 HGNC ID Not Available
Enzyme 71 Chromosome Location Chromosome:2
Enzyme 71 Locus 20q11.2-q13.2
Enzyme 71 SNPs SNPJam Report Link Image
Enzyme 71 General References
  1. [PubMed Link Image]
Enzyme 71 Metabolite References Not Available
Enzyme 72 [top]
Enzyme 72 ID 474
Enzyme 72 Name Mitogen-activated protein kinase kinase kinase 7
Enzyme 72 Synonyms Not Available
Enzyme 72 Gene Name MAP3K7
Enzyme 72 Protein Sequence >Mitogen-activated protein kinase kinase kinase 7
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDITSTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTGNGQPRRRSIQDLTVTG
TDPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
Enzyme 72 Number of Residues 579
Enzyme 72 Molecular Weight 64215.1
Enzyme 72 Theoretical pI 6.64
Enzyme 72 GO Classification
Function
Process
Component
Enzyme 72 General Function Involved in ATP binding
Enzyme 72 Specific Function Component of a protein kinase signal transduction cascade. Mediator of TGF-beta signal transduction. Stimulates NF- kappa-B activation and the p38 MAPK pathway
Enzyme 72 Pathways Not Available
Enzyme 72 Reactions Not Available
Enzyme 72 Pfam Domain Function
Enzyme 72 Signals
  • None
Enzyme 72 Transmembrane Regions
  • None
Enzyme 72 Essentiality Not Available
Enzyme 72 GenBank ID Protein 124829090 Link Image
Enzyme 72 UniProtKB/Swiss-Prot ID A2VDU3 Link Image
Enzyme 72 UniProtKB/Swiss-Prot Entry Name M3K7_BOVIN Link Image
Enzyme 72 PDB ID Not Available
Enzyme 72 Cellular Location Not Available
Enzyme 72 Gene Sequence >1740 bp
ATGTCTACAGCCTCCGCCGCTTCTTCTTCTTCCTCGTCTTCCGCCGGTGAGATGATCGAA
GCCCCCTCCCAAGTCCTCAACTTTGAAGAGATAGACTACAAGGAGATCGAGGTGGAAGAG
GTTGTTGGAAGAGGAGCTTTTGGAGTAGTATGCAAAGCCAAGTGGAGAGCAAAAGATGTT
GCCATTAAACAAATAGAAAGTGAATCTGAGAGGAAAGCTTTTATTGTAGAGCTTCGACAG
TTATCGCGTGTGAACCATCCTAACATCGTAAAGCTATATGGAGCCTGCTTGAATCCAGTG
TGTCTTGTAATGGAATATGCTGAAGGGGGCTCCTTGTATAATGTGCTGCATGGTGCTGAA
CCATTGCCATATTACACCGCTGCCCACGCAATGAGTTGGTGTTTACAGTGTTCCCAAGGA
GTGGCTTATCTTCACAGCATGCAGCCCAAAGCTCTAATCCACAGGGACCTGAAACCACCA
AACTTGCTGCTGGTTGCAGGGGGGACAGTTTTAAAAATCTGTGATTTTGGTACAGCCTGT
GACATTCAGACTCACATGACCAACAATAAGGGGAGTGCTGCTTGGATGGCACCTGAAGTT
TTTGAAGGTAGCAATTACAGTGAAAAATGTGATGTCTTCAGCTGGGGTATTATCCTTTGG
GAAGTGATAACACGTCGGAAACCCTTTGATGAAATTGGTGGCCCGGCTTTCCGTATCATG
TGGGCTGTTCATAACGGTACTCGACCACCACTGATCAAAAATTTACCTAAGCCCATTGAG
AGCCTGATGACTCGTTGTTGGTCTAAAGATCCTTCTCAGCGCCCTTCAATGGAGGAAATT
GTGAAAATAATGACTCACTTGATGCGGTACTTTCCAGGAGCAGATGAGCCGTTACAATAT
CCTTGTCAGTATTCAGATGAAGGACAGAGCAACTCTGCTACCAGTACAGGCTCCTTCATG
GACATCACTTCTACAAACACCAGTAATAAAAGTGACACTAACATGGAACAAGTTCCTGCC
ACAAATGATACAATTAAACGCTTAGAATCAAAATTGTTGAAAAACCAGGCAAAACAACAG
AGTGAATCTGGGCGTTTGAGTTTGGGAGCTTCTCGTGGGAGCAGCGTGGAGAGCTTGCCC
CCAACCTCTGAAGGCAAGAGGATGAGTGCCGATATGTCTGAAATAGAAGCCAGGATTGCT
GCAACCACAGGCAACGGGCAGCCAAGACGTAGATCCATCCAAGACTTGACTGTTACTGGA
ACAGATCCTGGTCAGGTGAGCAGTAGGTCATCCAGTCCTAGCGTCAGAATGATCACTACC
TCAGGACCAACCTCAGAAAAGCCAGCTCGCAGTCATCCATGGACCCCTGATGATTCCACA
GATACCAATGGATCAGATAATTCCATCCCAATGGCATATCTTACACTGGATCACCAACTA
CAGCCTCTAGCACCATGCCCAAACTCCAAAGAATCTATGGCAGTGTTTGAACAGCATTGT
AAGATGGCACAGGAATACATGAAAGTCCAAACAGAAATTGCATTGTTATTACAGAGAAAG
CAGGAACTAGTTGCAGAACTGGACCAGGATGAAAAGGACCAGCAAAATACATCTCGTCTG
GTGCAGGAACATAAAAAGCTTTTAGATGAAAACAAAAGCCTTTCAACTTACTATCAGCAA
TGCAAAAAACAGCTAGAGGTCATCAGGAGTCAGCAGCAAAAACGACAAGGCACTTCATGA
Enzyme 72 GenBank Gene ID BC133404 Link Image
Enzyme 72 GeneCard ID MAP3K7 Link Image
Enzyme 72 GenAtlas ID Not Available
Enzyme 72 HGNC ID Not Available
Enzyme 72 Chromosome Location Chromosome:6
Enzyme 72 Locus 6q16.1-q16.3
Enzyme 72 SNPs SNPJam Report Link Image
Enzyme 72 General References Not Available
Enzyme 72 Metabolite References Not Available
Enzyme 73 [top]
Enzyme 73 ID 475
Enzyme 73 Name Mitogen-activated protein kinase kinase kinase 13
Enzyme 73 Synonyms Not Available
Enzyme 73 Gene Name MAP3K13
Enzyme 73 Protein Sequence >Mitogen-activated protein kinase kinase kinase 13
MANPQEHLSCSSSPRLPLSENKTFNGLQDDLAPMGSHASPKLLKDQQEKGMVQTELAEGT
NSPITTTVLTSISEDSRDQFENSVLQLREQDESEMAMSHGNSNTVDGEGTSGTEDIKIQF
SRSGSGSGGFLEGLFGCLRPVWNIIGKAYSTDYKLQQQDTWEVPFEEISELQWLGSGAQG
AVFLGKFRAEEVAIKKVREQNETDIKHLRKLKHPNIIAFKGVCTQAPCYCIIMEYCAHGQ
LYEVLRAGRKITPRLLVDWSTGIASGMNYLHLHKIIHRDLKSPNVLVTHTDAVKISDFGT
SKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSA
IIWGVGSNSLHLPVPSTCPDGFKILMKQTWQSKTRNRPSFRQTLMHLDIASADVLATPQE
TYFKSQAEWREEVKKHFEKIKSEGTCIHRLDEELIRRRREELRHALDIREHYERKLERAN
NLYMELSAIMLQLEMREKELIKREQAVEKKYPGTYKRHPVRPIIHPNAMEKLMKRKGMPH
RPGMQAKRPDLLRSEGIPSVEVAPTASPLSGSPKLSSSSSKSRYRSKPRHRRGNSRGSHG
DFAAILKNQPAQEDSPHPTSLHQAEPQYPSSQHHNLLQQQYQQPPPAMSQSHHPRLNMHG
QDIATCPNNLRYFGPAAALRSPLSNHSQRQMPGSSPDLISTAMAADCWRSSEPDKGQAGP
WGCCQADPYDPCLQCRPEQHGSLDVPSAKPVGRSPSLFKPPAHNPLLENAQGSEKMEENE
FSGYRSASSLGASHHITPPVLPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCIS
SCQSYSTFSSENFSVSDGEEGNTSDHSNSPDELADKLEDHLAEKLDDLLSQTPEIPIEIS
SHSDGLSDKECAVRRVKTQMSLGKLCAEERGYENPMQFEESDCDSSDGECSDATVRTNKH
YSSATW
Enzyme 73 Number of Residues 966
Enzyme 73 Molecular Weight 108151.3
Enzyme 73 Theoretical pI 6.60
Enzyme 73 GO Classification
Function
Process
Component
Enzyme 73 General Function Involved in ATP binding
Enzyme 73 Specific Function Activates the JUN N-terminal pathway through activation of the MAP kinase kinase MAP2K7. Acts synergistically with PRDX3 to regulate the activation of NF-kappa-B in the cytosol. This activation is kinase-dependent and involves activating the IKK complex, the IKBKB-containing complex that phosphorylates inhibitors of NF-kappa-B
Enzyme 73 Pathways Not Available
Enzyme 73 Reactions Not Available
Enzyme 73 Pfam Domain Function
Enzyme 73 Signals
  • None
Enzyme 73 Transmembrane Regions
  • None
Enzyme 73 Essentiality Not Available
Enzyme 73 GenBank ID Protein 154426190 Link Image
Enzyme 73 UniProtKB/Swiss-Prot ID A7MBB4 Link Image
Enzyme 73 UniProtKB/Swiss-Prot Entry Name M3K13_BOVIN Link Image
Enzyme 73 PDB ID Not Available
Enzyme 73 Cellular Location Not Available
Enzyme 73 Gene Sequence >2901 bp
ATGGCCAACCCTCAGGAGCACCTGAGCTGCTCCTCTTCTCCACGTTTGCCTTTGAGTGAA
AACAAAACCTTCAATGGACTACAAGATGACCTCGCACCTATGGGGAGCCACGCTTCCCCC
AAGCTTCTTAAGGACCAGCAGGAAAAGGGCATGGTGCAAACTGAGCTAGCTGAAGGCACG
AACAGCCCCATCACCACAACAGTGTTGACAAGCATAAGTGAGGATTCCAGGGACCAGTTT
GAGAACAGCGTTCTTCAGCTAAGGGAACAAGATGAATCAGAGATGGCCATGTCTCATGGG
AACAGCAACACTGTGGATGGAGAGGGCACAAGTGGAACTGAAGACATCAAGATTCAGTTC
AGCAGGTCGGGCAGCGGCAGTGGTGGGTTTCTTGAAGGACTATTTGGATGCTTAAGGCCT
GTATGGAATATCATTGGAAAGGCATATTCCACTGATTACAAATTGCAGCAGCAAGATACT
TGGGAAGTGCCATTTGAGGAGATCTCAGAGCTGCAGTGGCTGGGTAGTGGAGCCCAGGGA
GCTGTCTTCTTGGGCAAGTTCCGAGCGGAGGAGGTGGCCATCAAGAAAGTGAGAGAACAG
AATGAGACGGATATCAAGCATTTGAGGAAGTTGAAGCACCCTAACATCATCGCTTTCAAG
GGTGTTTGTACTCAGGCCCCATGTTACTGTATCATCATGGAATACTGTGCCCATGGACAA
CTCTATGAGGTTTTGCGAGCTGGCAGGAAAATCACACCTCGATTGCTAGTAGACTGGTCC
ACGGGAATTGCAAGTGGAATGAATTATTTGCACCTTCATAAAATTATTCATCGTGATCTC
AAATCACCTAATGTTTTAGTGACTCACACAGATGCAGTAAAAATTTCAGATTTTGGTACA
TCTAAGGAACTCAGTGATAAGAGTACCAAGATGTCCTTCGCTGGCACTGTCGCCTGGATG
GCACCAGAAGTGATACGGAATGAACCTGTCTCTGAAAAAGTTGATATATGGTCTTTTGGA
GTGGTGCTTTGGGAGCTGCTCACAGGGGAGATTCCGTACAAAGATGTGGACTCTTCAGCC
ATTATTTGGGGGGTTGGAAGCAATAGCCTACACCTTCCAGTTCCTTCCACTTGCCCTGAT
GGATTCAAAATCCTTATGAAGCAGACATGGCAGAGTAAAACTCGCAACCGACCTTCTTTT
CGGCAGACGCTCATGCATTTGGACATCGCATCTGCAGATGTACTTGCCACCCCACAAGAA
ACCTATTTCAAGTCTCAGGCTGAATGGAGAGAAGAAGTGAAAAAGCACTTTGAGAAGATC
AAGAGTGAAGGAACCTGTATCCACCGATTAGATGAAGAACTTATTCGAAGGCGCAGAGAA
GAGCTCAGGCATGCTTTGGATATTCGTGAGCACTATGAGCGGAAACTTGAGCGGGCTAAT
AATTTGTACATGGAACTGAGTGCCATCATGCTGCAGCTAGAGATGCGGGAGAAGGAGCTC
ATCAAGCGTGAGCAGGCTGTGGAGAAGAAGTATCCTGGGACCTACAAACGACATCCTGTC
CGTCCAATAATCCACCCCAATGCCATGGAGAAGCTCATGAAGAGGAAAGGCATGCCACAC
AGACCTGGGATGCAGGCCAAGCGGCCAGATCTGTTGAGATCTGAAGGTATCCCCAGTGTG
GAAGTGGCTCCCACAGCATCCCCTTTATCCGGAAGTCCCAAACTGTCCTCCTCCAGCAGC
AAGAGCCGATATCGGAGCAAACCACGCCACCGACGTGGGAACAGCCGAGGCAGCCACGGT
GACTTTGCGGCCATCTTGAAAAACCAGCCAGCCCAGGAGGATTCGCCCCATCCCACTTCC
CTCCACCAAGCTGAGCCCCAGTACCCATCTTCCCAGCACCATAATCTTCTGCAGCAGCAA
TACCAGCAACCCCCACCTGCCATGTCGCAGAGTCACCATCCCAGACTCAATATGCACGGA
CAGGACATTGCCACCTGCCCCAACAACCTGAGGTACTTTGGTCCTGCAGCAGCCCTGCGG
AGCCCACTCAGCAACCACTCTCAAAGACAGATGCCTGGCTCTAGCCCTGACCTCATCTCC
ACGGCCATGGCGGCAGATTGTTGGAGAAGTTCTGAGCCTGACAAGGGCCAGGCTGGCCCC
TGGGGCTGTTGTCAGGCTGACCCCTATGACCCCTGCCTCCAGTGCAGGCCAGAACAGCAT
GGGTCCCTAGACGTCCCCTCGGCCAAGCCGGTAGGGAGGAGCCCCAGCCTTTTCAAGCCA
CCAGCACACAATCCCCTCTTGGAAAATGCCCAGGGTTCTGAGAAAATGGAAGAAAATGAA
TTCAGCGGTTATCGGTCTGCATCATCCCTTGGCGCCTCTCATCACATCACTCCCCCAGTG
CTACCTCGCAAAACAAGGCCACTTCAGAAGAGTGGAGATGACTCCTCTGAAGAGGAAGAA
GGGGAAGTAGATAGTGAAGTTGAATTTCCACGAAGACAGAGGCCCCATCGCTGTATCAGC
AGCTGCCAGTCATATTCCACCTTTAGCTCTGAGAATTTCTCTGTGTCTGATGGCGAGGAA
GGAAATACCAGTGACCACTCAAACAGCCCTGATGAGTTAGCAGATAAACTCGAAGATCAC
CTGGCAGAGAAGCTTGATGACCTGCTGTCCCAGACGCCGGAGATCCCCATTGAGATATCC
TCACATTCGGACGGGCTCTCTGACAAGGAGTGTGCTGTGCGTCGCGTGAAAACACAGATG
TCTCTGGGCAAGCTATGTGCGGAGGAACGTGGCTATGAGAATCCTATGCAGTTTGAAGAA
TCGGACTGTGACTCTTCAGATGGGGAGTGTTCTGATGCCACAGTCAGGACCAATAAACAC
TACAGCTCTGCTACCTGGTAA
Enzyme 73 GenBank Gene ID BC151464 Link Image
Enzyme 73 GeneCard ID MAP3K13 Link Image
Enzyme 73 GenAtlas ID Not Available
Enzyme 73 HGNC ID Not Available
Enzyme 73 Chromosome Location Chromosome:3
Enzyme 73 Locus 3q27
Enzyme 73 SNPs SNPJam Report Link Image
Enzyme 73 General References Not Available
Enzyme 73 Metabolite References Not Available
Enzyme 74 [top]
Enzyme 74 ID 476
Enzyme 74 Name Alkaline phosphatase
Enzyme 74 Synonyms Not Available
Enzyme 74 Gene Name Not Available
Enzyme 74 Protein Sequence >Alkaline phosphatase
MQGACVLLLLGLWLQLSLAFIPVEEEDPAFWNRQAAQALDVAKKLQPIQKAAKNVILFLG
DGMGVPTVTATRILKGQMNDKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCNTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRDWYSDADLPADAQTYGCQDIATQLVNNMDIDVILGGGRKYMFPEGTPDPEYPHDA
SVNGVRKDKRNLVQEWQAKHQGAQYVWNRTELLQAANDSSVTHLMGLFEPADMKYNVQQD
PTKDPTLEEMTEAALQVLSRNPQGFYLFVEGGRIDHGHHDSKAYMALTEAVMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKASDKKSYTSILYGNGPGYVL
GGGSRPDVNDSISEDPSYRQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEETFVAHV
MAFAGCVEPYTDCNLPAPSGLSDAAHLAASAPSLALLAGAMLLLLAPALY
Enzyme 74 Number of Residues 530
Enzyme 74 Molecular Weight 57065.9
Enzyme 74 Theoretical pI 5.55
Enzyme 74 GO Classification
Function
Process
Component
Enzyme 74 General Function Inorganic ion transport and metabolism
Enzyme 74 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 74 Pathways Not Available
Enzyme 74 Reactions Not Available
Enzyme 74 Pfam Domain Function
Enzyme 74 Signals
  • None
Enzyme 74 Transmembrane Regions
  • None
Enzyme 74 Essentiality Not Available
Enzyme 74 GenBank ID Protein 3510651 Link Image
Enzyme 74 UniProtKB/Swiss-Prot ID O77578 Link Image
Enzyme 74 UniProtKB/Swiss-Prot Entry Name O77578_BOVIN Link Image
Enzyme 74 PDB ID Not Available
Enzyme 74 Cellular Location Not Available
Enzyme 74 Gene Sequence >1593 bp
ATGCAGGGGGCCTGCGTGCTGCTGCTGCTGGGCCTGTGGCTACAGCTCTCCCTCGCCTTC
ATCCCAGTTGAGGAGGAAGACCCCGCCTTCTGGAACCGCCAGGCAGCCCAGGCCCTTGAT
GTGGCTAAGAAGCTGCAGCCCATCCAGAAAGCCGCCAAGAATGTCATCCTCTTCTTGGGA
GATGGGATGGGGGTGCCTACGGTGACAGCCACTCGGATACTGAAGGGGCAGATGAATGAC
AAGCTGGGACCTGAGACACCCCTGGCCATGGACCAGTTCCCATACGTGGCTCTGTCCAAG
ACATACAACGTGGACAGACAGGTGCCAGACAGCGCAGGCACTGCCACTGCCTACCTGTGT
GGGGTCAAGGGCAACTACAGAACCATCGGTGTAAGTGCAGCCGCCCGCTACAATCAGTGC
AACACGACACGTGGGAATGAGGTCACGTCTGTGATGAACCGGGCCAAGAAAGCAGGGAAG
TCAGTGGGAGTGGTGACCACCACCAGGGTGCAGCACGCCTCCCCAGCCGGTGCTTATGCA
CACACGGTGAACCGTGACTGGTACTCAGACGCCGACCTGCCTGCCGATGCACAGACGTAT
GGCTGCCAGGACATCGCCACACAACTGGTCAACAACATGGATATTGACGTGATCCTGGGT
GGAGGCCGAAAGTACATGTTTCCTGAGGGGACCCCAGACCCTGAATACCCACACGATGCC
AGTGTGAATGGAGTCCGGAAGGACAAGCGGAATCTGGTGCAGGAGTGGCAGGCCAAGCAC
CAGGGAGCCCAGTATGTGTGGAACCGCACGGAGCTCCTTCAGGCAGCCAATGACTCCAGT
GTTACACATCTCATGGGCCTCTTTGAGCCGGCAGACATGAAGTATAATGTTCAGCAAGAC
CCCACCAAGGACCCGACCCTGGAGGAGATGACGGAGGCGGCCCTGCAAGTGCTGAGCAGG
AACCCCCAGGGCTTCTACCTCTTCGTGGAGGGAGGCCGCATTGACCACGGTCACCATGAT
AGCAAAGCTTATATGGCGCTGACTGAGGCGGTCATGTTTGACAATGCCATCGCCAAGGCT
AACGAGCTCACTAGCGAACTGGACACGCTGATCCTTGTCACTGCAGACCACTCCCATGTC
TTCTCTTTTGGTGGCTACACACTGCGTGGGACCTCCATTTTCGGTCTGGCCCCCAGCAAG
GCCTCAGACAAGAAGTCCTACACCTCCATCCTCTATGGCAATGGCCCTGGCTACGTGCTT
GGTGGGGGCTCAAGGCCCGATGTTAATGACAGCATAAGCGAGGACCCCTCATACCGGCAG
CAGGCGGCCGTGCCCCTGTCTAGCGAGACCCACGGGGGCGAAGACGTGGCGGTGTTCGCG
CGAGGCCCGCAGGCGCACCTGGTGCACGGCGTGCAGGAGGAGACCTTCGTGGCGCACGTC
ATGGCCTTTGCGGGCTGCGTGGAGCCCTACACCGACTGCAATCTGCCGGCCCCCTCTGGC
CTCTCCGACGCCGCGCACCTGGCGGCCAGCGCGCCTTCGCTAGCGCTGCTGGCCGGGGCG
ATGCTGCTGCTGCTGGCGCCCGCCTTGTACTGA
Enzyme 74 GenBank Gene ID AF052226 Link Image
Enzyme 74 GeneCard ID Not Available
Enzyme 74 GenAtlas ID Not Available
Enzyme 74 HGNC ID Not Available
Enzyme 74 Chromosome Location Not Available
Enzyme 74 Locus Not Available
Enzyme 74 SNPs SNPJam Report Link Image
Enzyme 74 General References Not Available
Enzyme 74 Metabolite References Not Available
Enzyme 75 [top]
Enzyme 75 ID 477
Enzyme 75 Name Bis(5'-adenosyl)-triphosphatase
Enzyme 75 Synonyms
  1. Diadenosine 5',5'''-P1,P3-triphosphate hydrolase
  2. Dinucleosidetriphosphatase
  3. AP3A hydrolase
  4. AP3Aase
  5. Fragile histidine triad protein
Enzyme 75 Gene Name FHIT
Enzyme 75 Protein Sequence >Bis(5'-adenosyl)-triphosphatase
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQ
AAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKH
DREDKDSPALWRSEEEMAAEAAALRVYFQ
Enzyme 75 Number of Residues 149
Enzyme 75 Molecular Weight 16951.2
Enzyme 75 Theoretical pI 6.97
Enzyme 75 GO Classification
Function
Process
Component
Enzyme 75 General Function Nucleotide transport and metabolism
Enzyme 75 Specific Function Cleaves A-5'-PPP-5'A to yield AMP and ADP
Enzyme 75 Pathways Not Available
Enzyme 75 Reactions Not Available
Enzyme 75 Pfam Domain Function
Enzyme 75 Signals
  • None
Enzyme 75 Transmembrane Regions
  • None
Enzyme 75 Essentiality Not Available
Enzyme 75 GenBank ID Protein 84688623 Link Image
Enzyme 75 UniProtKB/Swiss-Prot ID Q1KZG4 Link Image
Enzyme 75 UniProtKB/Swiss-Prot Entry Name FHIT_BOVIN Link Image
Enzyme 75 PDB ID Not Available
Enzyme 75 Cellular Location Not Available
Enzyme 75 Gene Sequence >450 bp
ATGTCGTTCAGATTTGGCCAACATCTCATCAAGCCCTCGGTGGTGTTTCTCAAAACAGAA
CTGTCCTTTGCCCTGGTGAACAGGAAGCCTGTGGTACCTGGACATGTCCTCGTGTGTCCC
CTCCGGCCAGTGGAGCGCTTCCGAGACATGAGTCCTGAAGAAGTGGCTGACTTGTTTCAG
GCAGCACAGAGAGTCGGCACGGTGGTAGAGAAGCATTTCCAGGGCACCTCGCTCACGTTT
TCCATGCAGGATGGCCCCGAAGCCGGACAGACTGTGAAGCATGTTCACGTCCACATTCTT
CCAAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGATGCGCTCGAGAAACAC
GACAGAGAGGATAAAGACTCCCCAGCCTTGTGGCGGTCAGAGGAGGAAATGGCAGCTGAG
GCTGCAGCGCTGAGGGTCTACTTTCAGTGA
Enzyme 75 GenBank Gene ID DQ335870 Link Image
Enzyme 75 GeneCard ID FHIT Link Image
Enzyme 75 GenAtlas ID Not Available
Enzyme 75 HGNC ID Not Available
Enzyme 75 Chromosome Location Chromosome:3
Enzyme 75 Locus 3p14.2
Enzyme 75 SNPs SNPJam Report Link Image
Enzyme 75 General References
  1. [PubMed Link Image]
Enzyme 75 Metabolite References Not Available
Enzyme 76 [top]
Enzyme 76 ID 478
Enzyme 76 Name Ribose-phosphate pyrophosphokinase
Enzyme 76 Synonyms Not Available
Enzyme 76 Gene Name LOC504248
Enzyme 76 Protein Sequence >Ribose-phosphate pyrophosphokinase
MDAKSLLQLTKKPNIKIFSGRSHQDLSQKIADRLGLELGKVVTKKLSNQETCVEIGESVQ
GEDVYIVQSGCGEINDNLMELLIMINACKIASAGRVTAVIPCFPYARQDKRGESRAPISA
KLVADMLSTAGADHIITMDLHASQIQGFFDIPVDNLCAEPAVLKWIKEQISDWRSCTIVS
PDAGEVKRATSIADRLNVDFALIHKVRKKAGEVDGMVLVGDVKYRVAILVDDMADTCGTI
CHAADKLLSAGATRVYAILTHGIFSGPAVTRINSAGFEAVVVTNTVPQEDKMKHCSKIQV
IDISMILAEAIRRIHSGKSVSYLFSHVPL
Enzyme 76 Number of Residues 329
Enzyme 76 Molecular Weight 35727.1
Enzyme 76 Theoretical pI 7.48
Enzyme 76 GO Classification
Function
Process
Component
Enzyme 76 General Function Nucleotide transport and metabolism
Enzyme 76 Specific Function ATP + D-ribose 5-phosphate = AMP + 5-phospho- alpha-D-ribose 1-diphosphate
Enzyme 76 Pathways Not Available
Enzyme 76 Reactions Not Available
Enzyme 76 Pfam Domain Function
Enzyme 76 Signals
  • None
Enzyme 76 Transmembrane Regions
  • None
Enzyme 76 Essentiality Not Available
Enzyme 76 GenBank ID Protein 151554029 Link Image
Enzyme 76 UniProtKB/Swiss-Prot ID A6QQ58 Link Image
Enzyme 76 UniProtKB/Swiss-Prot Entry Name A6QQ58_BOVIN Link Image
Enzyme 76 PDB ID Not Available
Enzyme 76 Cellular Location Not Available
Enzyme 76 Gene Sequence >990 bp
ATGGACGCAAAGAGCCTACTGCAGTTGACCAAAAAGCCAAATATCAAAATCTTCAGCGGC
AGATCCCACCAGGACTTATCCCAGAAAATCGCCGACCGATTGGGCCTGGAGCTGGGCAAG
GTGGTGACCAAGAAATTAAGCAACCAGGAGACCTGCGTGGAAATTGGCGAGAGTGTGCAA
GGAGAGGATGTCTACATAGTGCAGAGTGGCTGTGGCGAAATCAATGACAATTTGATGGAG
CTTTTGATCATGATTAATGCCTGCAAGATTGCTTCAGCAGGCCGGGTTACGGCAGTTATC
CCGTGCTTCCCGTATGCCCGTCAGGATAAGAGAGGTGAGAGCCGAGCCCCGATCTCCGCC
AAACTTGTTGCAGATATGCTGTCAACGGCAGGCGCAGATCATATCATCACGATGGACCTA
CATGCCTCTCAAATTCAGGGCTTTTTTGATATCCCAGTAGACAATTTGTGTGCAGAACCT
GCTGTCCTGAAGTGGATAAAGGAGCAAATCTCTGACTGGAGGAGCTGCACGATAGTCTCC
CCAGATGCTGGTGAAGTTAAGAGAGCGACCTCCATTGCAGACAGATTGAATGTGGACTTT
GCCTTGATTCACAAAGTACGGAAGAAAGCCGGTGAAGTGGACGGAATGGTACTAGTGGGA
GATGTGAAGTATCGTGTGGCTATCCTTGTGGATGACATGGCTGACACTTGTGGTACAATC
TGCCACGCAGCCGACAAACTTCTCTCAGCTGGAGCCACCAGAGTTTATGCGATCTTGACT
CATGGAATCTTTTCTGGCCCAGCCGTTACTCGCATTAACAGTGCAGGCTTTGAAGCAGTC
GTAGTCACCAATACCGTACCTCAGGAGGATAAGATGAAGCACTGCTCCAAAATACAGGTG
ATTGACATCTCCATGATTCTTGCAGAAGCCATCAGAAGAATTCACAGTGGGAAATCTGTC
TCCTACCTGTTCAGCCATGTCCCATTATAA
Enzyme 76 GenBank Gene ID BC149656 Link Image
Enzyme 76 GeneCard ID LOC504248 Link Image
Enzyme 76 GenAtlas ID Not Available
Enzyme 76 HGNC ID Not Available
Enzyme 76 Chromosome Location Not Available
Enzyme 76 Locus Not Available
Enzyme 76 SNPs SNPJam Report Link Image
Enzyme 76 General References Not Available
Enzyme 76 Metabolite References Not Available
Enzyme 77 [top]
Enzyme 77 ID 479
Enzyme 77 Name 6-phosphofructokinase, liver type
Enzyme 77 Synonyms
  1. Phosphofructokinase 1
  2. Phosphohexokinase
  3. Phosphofructo-1-kinase isozyme B
  4. PFK-B
Enzyme 77 Gene Name PFKL
Enzyme 77 Protein Sequence >6-phosphofructokinase, liver type
MASVDLEKLRTTGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVSEGKISEGTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGGSFENNWNIYKLLSHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKNQVQEVSWHDVAGWLGRGGSMLGTKRTLPKGFMEKI
VENIRLHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTEIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAIIWMSEKLRAVYRNGRVFANASDSACVIGLQKKVVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIETGF
Enzyme 77 Number of Residues 780
Enzyme 77 Molecular Weight 85291.0
Enzyme 77 Theoretical pI 7.39
Enzyme 77 GO Classification
Function
Process
Component
Enzyme 77 General Function Carbohydrate transport and metabolism
Enzyme 77 Specific Function ATP + D-fructose 6-phosphate = ADP + D- fructose 1,6-bisphosphate
Enzyme 77 Pathways
  • Carbohydrate degradation
  • glycolysis
  • D-glyceraldehyde 3- phosphate and glycerone phosphate from D-glucose:step 3/4
Enzyme 77 Reactions Not Available
Enzyme 77 Pfam Domain Function
Enzyme 77 Signals
  • None
Enzyme 77 Transmembrane Regions
  • None
Enzyme 77 Essentiality Not Available
Enzyme 77 GenBank ID Protein 119223906 Link Image
Enzyme 77 UniProtKB/Swiss-Prot ID A1A4J1 Link Image
Enzyme 77 UniProtKB/Swiss-Prot Entry Name K6PL_BOVIN Link Image
Enzyme 77 PDB ID Not Available
Enzyme 77 Cellular Location Not Available
Enzyme 77 Gene Sequence >2343 bp
ATGGCCAGCGTGGATCTGGAGAAGCTGCGGACCACCGGGGCTGGCAAGGCCATCGGCGTG
CTGACCAGTGGCGGTGATGCGCAAGGCATGAATGCCGCTGTCAGAGCCGTGACTCGTATG
GGCATTTACGTGGGGGCCAAGGTCTTCCTCATCTACGAGGGCTATGAAGGCCTCGTGGAG
GGCGGCGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGTTGGGC
GGCACCGTCATCGGCAGCGCCCGCTGCAAGGCCTTCACCACGCGGGAGGGACGCCGGGCG
GCCGCCTACAACCTGGTCCAGCGTGGCATCACCAACCTGTGCGTCATCGGCGGGGACGGC
AGCCTCACTGGGGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTCCTGGAGGAGCTGGTG
AGCGAAGGCAAGATCTCAGAGGGCACGGCTCAGACCTATTCACACCTGAACATCGCGGGG
CTGGTGGGCTCCATCGACAATGACTTCTGTGGCACCGACATGACCATCGGCACAGACTCG
GCGCTGCACCGCATCATGGAAGTCATCGACGCCATCACCACCACTGCCCAGAGCCACCAG
AGGACCTTTGTGCTGGAGGTGATGGGACGGCACTGCGGGTACCTGGCCCTGGTGTCTGCC
CTGGCCTCGGGGGCCGACTGGCTGTTCATCCCTGAGGCGCCCCCTGAGGACGGCTGGGAG
AACTTCATGTGTGAGCGGCTCGGCGAGACTCGGAGCCGAGGGTCCCGCCTCAACATTATC
ATCATTGCTGAGGGCGCCATCGACCGCAACGGGAAGCCCATCTCGTCCCGCTACGTGAAG
GACCTGGTGGTCCAGAGACTGGGCTTCGACACGCGTGTGACTGTGCTGGGCCACGTGCAG
AGGGGAGGGACCCCCTCGGCATTCGACCGCATCCTGAGCAGTAAGATGGGCATGGAGGCG
GTGATGGCGCTGCTGGAGGCCACGCCCGACACGCCGGCCTGCGTGGTCAGCCTCTCGGGG
AACCAGTCCGTGCGGCTGCCCCTCATGGAGTGTGTGCAGATGACCAAGGAGGTGCAGAAG
GCCATGGACGAGAAGAGGTTTGACGAGGCCATCCAGCTCCGAGGCGGGAGCTTTGAGAAC
AACTGGAATATTTACAAGCTGCTTTCCCACCAGAAGATCTCCAAGGAGAAGACCAACTTC
TCCCTGGCCATCCTGAACGTGGGGGCCCCAGCAGCCGGCATGAACGCGGCCGTGCGCTCG
GCGGTGCGTTCTGGCATCTCCCAGGGCCACACGGTGTACGTTGTGCATGACGGCTTTGAA
GGCCTGGCCAAGAACCAGGTGCAAGAAGTGAGCTGGCATGACGTGGCCGGCTGGCTGGGG
CGTGGTGGCTCCATGCTGGGGACAAAGAGGACGCTGCCCAAAGGCTTCATGGAGAAAATT
GTGGAAAACATCCGCCTTCACAACATCCACGCCCTGCTGGTCATCGGGGGCTTTGAGGCC
TACGAGGGGGTGCTGCAGCTGGTGGAGGCCCGTGGGCGCTATGAGGAGCTGTGCATCGTC
ATGTGCGTCATCCCCGCCACCATCAGCAACAACGTGCCAGGCACGGACTTCAGCCTGGGC
TCCGACACGGCCGTCAACGCCGCCATGGAGAGTTGTGACCGCATCAAGCAGTCGGCCTCG
GGGACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGTGGCTACTGCGGCTACCTGGCT
ACTGTGACTGGCATTGCTGTGGGCGCCGACGCTGCCTATGTCTTCGAGGATCCCTTCAAC
ATTCAAGACTTAAAGGCCAATGTGGAGCACATGACCGAGAAGATGAAGACAGAGATCCAG
CGGGGCCTGGTACTCCGGAACGAGAAGTGCCACGAGCACTACACCACAGAGTTCCTGTAC
AACCTCTACTCCTCCGAGGGCAAGGGCGTGTTTGACTGCAGGACCAACGTCCTGGGCCAC
CTGCAGCAGGGTGGAGCTCCCACCCCCTTTGACCGGAACTATGGTACCAAGCTCGGGGTG
AAAGCCATAATCTGGATGTCGGAGAAGCTGCGGGCAGTCTATCGCAATGGGCGGGTGTTT
GCCAATGCCTCTGACTCGGCCTGCGTGATTGGCCTGCAGAAGAAAGTGGTGGCCTTCAGC
CCTGTCACCGAGCTCAAGAAAGACACCGACTTTGAGCACCGCATGCCCCGGGAGCAGTGG
TGGCTGAACCTGCGGCTCATGCTGAAGATGCTGGCACACTACCGCATCAGCATGGCTGAC
TACGTGTCCGGGGAGCTGGAGCACGTCACCCGCCGCACCCTCAGCATTGAGACGGGCTTC
TGA
Enzyme 77 GenBank Gene ID BC126578 Link Image
Enzyme 77 GeneCard ID PFKL Link Image
Enzyme 77 GenAtlas ID Not Available
Enzyme 77 HGNC ID Not Available
Enzyme 77 Chromosome Location Chromosome:2
Enzyme 77 Locus 21q22.3
Enzyme 77 SNPs SNPJam Report Link Image
Enzyme 77 General References Not Available
Enzyme 77 Metabolite References Not Available
Enzyme 78 [top]
Enzyme 78 ID 480
Enzyme 78 Name 5'-nucleotidase domain-containing protein 1
Enzyme 78 Synonyms Not Available
Enzyme 78 Gene Name NT5DC1
Enzyme 78 Protein Sequence >5'-nucleotidase domain-containing protein 1
MAQHFSLAACDVVGFDLDHTLCCYNLPESARLIYNSFAQFLVKEKGYDKGLLTVTPEDWD
FCCKGLALDLEDGNFIKLADNGTVLRASHGTKMLSAEALAEEFGRKEWKHFMPDTGMAFR
SGKYYFYDNYFDLPGALLCARVVDSLTKQNNGQKPFDFWKDIVAGIQHNYKMSAFKENCG
IYFPEIKRDPGKYLHTCPESVKKWLRQLKNAGKILMLITSSHSDYCRLLCQYILGNDFED
LFDIVITNALKPGFFSHLPSQRPFRTLENDEEREALPFLDKPGWYSQGNAVHLYELLKKM
TGKPEPKVVYFGDSMHSDIFPACHYSNWETVLILEELRGDKDGKPEESEPEEKKGKYEGS
KAKPLNTSSKKWGSFFIDSVSGLENREDSLVYTWSCKRISAYSTIAIPSIEAIAELPLDY
KFTRFSSNNSKTAGYYPNPPLVLSNAGKLTAK
Enzyme 78 Number of Residues 452
Enzyme 78 Molecular Weight 51365.0
Enzyme 78 Theoretical pI 6.58
Enzyme 78 GO Classification
Function
Process
Component
Enzyme 78 General Function Involved in hydrolase activity
Enzyme 78 Specific Function Not Available
Enzyme 78 Pathways Not Available
Enzyme 78 Reactions Not Available
Enzyme 78 Pfam Domain Function
Enzyme 78 Signals
  • None
Enzyme 78 Transmembrane Regions
  • None
Enzyme 78 Essentiality Not Available
Enzyme 78 GenBank ID Protein 83638737 Link Image
Enzyme 78 UniProtKB/Swiss-Prot ID Q2TBU5 Link Image
Enzyme 78 UniProtKB/Swiss-Prot Entry Name NT5D1_BOVIN Link Image
Enzyme 78 PDB ID Not Available
Enzyme 78 Cellular Location Not Available
Enzyme 78 Gene Sequence >1359 bp
ATGGCTCAGCACTTCTCCCTGGCCGCCTGCGACGTGGTCGGCTTCGACCTGGACCACACT
CTGTGTTGCTACAACCTGCCCGAGAGCGCCCGGCTCATTTATAATAGCTTTGCTCAGTTC
CTGGTCAAGGAGAAAGGGTATGACAAGGGATTGCTCACGGTGACCCCAGAGGATTGGGAT
TTCTGTTGCAAGGGCTTGGCACTGGATCTGGAAGATGGGAACTTCATTAAACTTGCAGAT
AATGGCACCGTGCTCAGGGCCAGCCACGGCACGAAGATGCTGTCTGCGGAGGCGCTGGCG
GAGGAGTTCGGCAGGAAGGAGTGGAAGCACTTCATGCCGGACACGGGAATGGCCTTCCGG
TCAGGAAAATACTACTTTTATGATAACTACTTTGACCTGCCTGGAGCTCTTCTGTGTGCC
AGAGTGGTAGACTCTTTAACAAAGCAGAACAATGGTCAAAAACCATTTGATTTTTGGAAG
GACATAGTTGCTGGTATACAACATAATTATAAAATGTCAGCTTTTAAAGAAAACTGTGGA
ATATATTTTCCAGAAATAAAAAGAGATCCAGGCAAATATTTACACACTTGTCCGGAATCA
GTAAAAAAGTGGCTTCGACAGCTAAAGAATGCTGGCAAAATCCTTATGTTAATTACCAGT
TCTCACAGTGATTACTGTAGACTCCTCTGCCAGTATATCCTTGGGAATGATTTTGAAGAT
CTTTTTGACATTGTGATTACAAATGCATTGAAGCCTGGCTTCTTCTCTCATTTACCAAGT
CAGAGGCCTTTCCGGACGCTTGAGAATGACGAGGAGCGCGAGGCACTGCCATTTCTGGAT
AAACCTGGCTGGTACTCCCAAGGGAACGCTGTCCACCTTTATGAACTTCTGAAGAAAATG
ACTGGCAAGCCTGAACCCAAGGTTGTTTACTTTGGTGACAGCATGCATTCAGATATTTTC
CCAGCCTGTCATTATAGTAATTGGGAGACAGTCCTTATCCTCGAAGAGCTCCGAGGGGAC
AAAGATGGGAAGCCTGAGGAATCAGAACCTGAAGAGAAAAAAGGAAAATATGAGGGATCA
AAGGCAAAGCCTCTGAATACATCATCTAAAAAATGGGGCTCTTTTTTTATTGATTCAGTT
TCCGGGCTGGAAAATAGAGAAGATTCCTTGGTTTATACATGGTCCTGTAAGCGAATAAGT
GCTTACAGCACTATTGCAATTCCAAGTATTGAAGCAATAGCAGAATTACCCCTGGACTAC
AAATTTACAAGGTTCTCTTCAAATAATTCAAAAACAGCAGGCTATTATCCAAACCCTCCA
TTGGTCTTATCAAATGCTGGAAAACTGACAGCCAAATAA
Enzyme 78 GenBank Gene ID BC109642 Link Image
Enzyme 78 GeneCard ID NT5DC1 Link Image
Enzyme 78 GenAtlas ID Not Available
Enzyme 78 HGNC ID Not Available
Enzyme 78 Chromosome Location Chromosome:6
Enzyme 78 Locus 6q22.1
Enzyme 78 SNPs SNPJam Report Link Image
Enzyme 78 General References Not Available
Enzyme 78 Metabolite References Not Available
Enzyme 79 [top]
Enzyme 79 ID 481
Enzyme 79 Name Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Enzyme 79 Synonyms
  1. Core 1 beta1,3-galactosyltransferase 1
  2. Core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1
  3. Core 1 beta3-Gal-T
  4. C1GalT1
  5. Core 1 O-glycan T-synthase
Enzyme 79 Gene Name C1GALT1
Enzyme 79 Protein Sequence >Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
MASKSWLNILTFLCGSAVGFVLCSQLLSILFEEQKDIQPSILHNDPHARHSDDNEQNHLE
GQMNFDADASQHKDENTDIADKLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVEAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPEKMLKEVSQIYKNEDTNVNQ
EPLKEKHK
Enzyme 79 Number of Residues 368
Enzyme 79 Molecular Weight 43040.5
Enzyme 79 Theoretical pI 6.45
Enzyme 79 GO Classification
Function
Process
Component
Enzyme 79 General Function Involved in glycoprotein-N-acetylgalactosamine 3-beta-g
Enzyme 79 Specific Function Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development
Enzyme 79 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 79 Reactions Not Available
Enzyme 79 Pfam Domain Function Not Available
Enzyme 79 Signals
  • None
Enzyme 79 Transmembrane Regions
  • 7-29
Enzyme 79 Essentiality Not Available
Enzyme 79 GenBank ID Protein 111307567 Link Image
Enzyme 79 UniProtKB/Swiss-Prot ID Q0VC84 Link Image
Enzyme 79 UniProtKB/Swiss-Prot Entry Name C1GLT_BOVIN Link Image
Enzyme 79 PDB ID Not Available
Enzyme 79 Cellular Location Not Available
Enzyme 79 Gene Sequence >1107 bp
ATGGCCTCTAAATCTTGGCTGAATATTTTAACCTTCCTTTGTGGATCAGCAGTCGGATTT
GTTTTATGCTCTCAGCTACTTAGTATTTTGTTCGAAGAACAGAAGGACATCCAGCCTAGT
ATTCTTCATAATGATCCTCACGCTAGGCATTCAGATGACAATGAACAGAATCATCTAGAA
GGACAGATGAACTTCGATGCAGATGCCAGCCAACATAAAGATGAGAACACTGACATCGCT
GATAAGCTCTATCAGAAGGTTAAAATTCTTTGCTGGGTAATGACAGGGCCTCAAAATCTA
GAGAAAAAGGCTAAACATGTCAAAGCCACATGGGCCCAGCGTTGTAATAAAGTGTTGTTT
ATGAGTTCAGAAGAAAACAAGGACTTCCCTGCTGTGGGATTAAAAACCAGAGAAGGCAGA
GACCAACTGTACTGGAAAACAATTAAAGCCTTTCAGTATGTTCATGATCATTATTTAGAA
GATGCTGATTGGTTTATGAAAGCAGATGATGATACTTACGTTATACTAGATAACTTGAGA
TGGCTTCTCTCAAAATACAACCCTGAAGAACCCATTTACTTTGGGAGAAGATTTAAGCCC
TATGTAAAGCAGGGCTACATGAGTGGAGGAGCAGGATATGTACTGAGCAAAGAAGCTTTG
AAGAGATTTGTTGAAGCATTTAAAACAGACAAATGTACACACAGTTCCTCAATCGAAGAT
TTAGCACTGGGGAGATGCATGGAAATTATAAATGTAGAAGCGGGAGATTCCAGAGACACC
ACTGGAAAAGAAACTTTTCATCCTTTTGTACCAGAACACCACTTAATCAAGGGTTATCTG
CCGAGAACCTTTTGGTACTGGAATTATAACTATTATCCTCCTGTAGAGGGTCCTGGTTGC
TGTTCCGATCTTGCAGTTTCTTTTCACTATGTTGATCCTACAACTATGTATGAGTTAGAA
TACCTCGTTTATCATCTTCGTCCGTATGGTTATTTATACAGATATCAACCTGCCTTACCT
GAGAAGATGCTAAAGGAAGTAAGTCAGATATACAAAAATGAAGACACAAACGTAAATCAG
GAGCCCTTGAAAGAAAAACATAAATGA
Enzyme 79 GenBank Gene ID BC120299 Link Image
Enzyme 79 GeneCard ID C1GALT1 Link Image
Enzyme 79 GenAtlas ID Not Available
Enzyme 79 HGNC ID Not Available
Enzyme 79 Chromosome Location Chromosome:7
Enzyme 79 Locus 7p14-p13
Enzyme 79 SNPs SNPJam Report Link Image
Enzyme 79 General References Not Available
Enzyme 79 Metabolite References Not Available
Enzyme 80 [top]
Enzyme 80 ID 482
Enzyme 80 Name Ribose-phosphate pyrophosphokinase 1
Enzyme 80 Synonyms
  1. Phosphoribosyl pyrophosphate synthetase I
  2. PRS-I
Enzyme 80 Gene Name PRPS1
Enzyme 80 Protein Sequence >Ribose-phosphate pyrophosphokinase 1
MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGC
GEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAG
ADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTS
IADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAG
ATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAI
RRTHNGESVSYLFSHVPL
Enzyme 80 Number of Residues 318
Enzyme 80 Molecular Weight 34833.9
Enzyme 80 Theoretical pI 6.98
Enzyme 80 GO Classification
Function
Process
Component
Enzyme 80 General Function Nucleotide transport and metabolism
Enzyme 80 Specific Function ATP + D-ribose 5-phosphate = AMP + 5-phospho- alpha-D-ribose 1-diphosphate
Enzyme 80 Pathways
  • Metabolic intermediate biosynthesis
  • 5-phospho-alpha-D- ribose 1-diphosphate biosynthesis
  • 5-phospho-alpha-D-ribose 1- diphosphate from D-ribose 5-phosphate (route I):step 1/1
Enzyme 80 Reactions Not Available
Enzyme 80 Pfam Domain Function
Enzyme 80 Signals
  • None
Enzyme 80 Transmembrane Regions
  • None
Enzyme 80 Essentiality Not Available
Enzyme 80 GenBank ID Protein 87578167 Link Image
Enzyme 80 UniProtKB/Swiss-Prot ID Q2HJ58 Link Image
Enzyme 80 UniProtKB/Swiss-Prot Entry Name PRPS1_BOVIN Link Image
Enzyme 80 PDB ID Not Available
Enzyme 80 Cellular Location Not Available
Enzyme 80 Gene Sequence >957 bp
ATGCCGAATATCAAAATCTTCAGCGGCAGCTCCCACCAGGACCTATCCCAGAAGATTGCC
GACCGCCTGGGCCTGGAACTGGGCAAGGTGGTGACTAAGAAATTCAGCAACCAGGAGACC
TGTGTGGAAATCGGAGAAAGTGTTCGTGGAGAAGATGTCTACATTGTTCAGAGTGGCTGC
GGTGAAATCAATGACAATCTCATGGAACTTTTGATTATGATTAATGCCTGCAAGATTGCT
TCAGCCAGCCGGGTTACTGCAGTCATCCCGTGCTTCCCTTATGCCCGGCAGGATAAGAAG
GATAAGAGCCGGGCTCCAATCTCAGCCAAGCTGGTTGCAAATATGCTGTCTGTAGCAGGC
GCGGATCATATTATCACCATGGACCTTCATGCTTCTCAAATTCAGGGCTTTTTTGATATC
CCAGTCGACAATTTGTATGCAGAGCCAGCGGTCCTCAAGTGGATAAGGGAGAACATCTCT
GAGTGGAGGAACTGCACAATTGTCTCACCTGATGCTGGAGGAGCAAAGAGAGTGACTTCC
ATCGCAGACCGGTTGAATGTGGACTTTGCCTTGATTCACAAAGAACGGAAGAAGGCCAAT
GAAGTGGACCGCATGGTGCTCGTAGGAGACGTGAAGGACCGTGTGGCCATCCTCGTGGAT
GACATGGCTGACACTTGTGGCACAATCTGCCATGCAGCTGACAAACTTCTCTCAGCTGGA
GCCACCAGGGTTTATGCTATCCTGACTCATGGAATCTTTTCTGGCCCAGCCATTTCTCGT
ATTAATAATGCATGCTTTGAAGCAGTAGTAGTCACCAATACCATACCTCAGGAGGATAAG
ATGAAGCATTGCTCCAAAATACAGGTGATTGACATCTCCATGATCCTCGCAGAAGCCATC
AGGAGAACTCACAATGGAGAATCCGTCTCCTATCTGTTCAGCCATGTCCCTTTATAA
Enzyme 80 GenBank Gene ID BC113300 Link Image
Enzyme 80 GeneCard ID PRPS1 Link Image
Enzyme 80 GenAtlas ID Not Available
Enzyme 80 HGNC ID Not Available
Enzyme 80 Chromosome Location Not Available
Enzyme 80 Locus Xq21.32-q24
Enzyme 80 SNPs SNPJam Report Link Image
Enzyme 80 General References Not Available
Enzyme 80 Metabolite References Not Available
Enzyme 81 [top]
Enzyme 81 ID 483
Enzyme 81 Name Interleukin-1 receptor-associated kinase 4
Enzyme 81 Synonyms
  1. IRAK-4
Enzyme 81 Gene Name IRAK4
Enzyme 81 Protein Sequence >Interleukin-1 receptor-associated kinase 4
MNKPITASTYVRCLSLGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QIGKSPTCELLFDWGTTNCTVGDLVDILVQNEFFAPASLLLPDAVPKNVNTLPSKVTVVA
VQQKPKPLCGKDRTSVISDENPEQNYVLPDSSSPENTSLEFSDTRFHSFSFFELKDVTNN
FDERPISVGGNKMGEGGFGVVYKGYVNNRTVAVKKLAAMVDISTEELKQQFDQEIKVMAK
CQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWNMRCKIAQGAANGL
SYLHENHHIHRDIKSANILLDEDFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEA
LRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDRKMN
DIDSTSIETMYSVASQCLHEKKNKRPDIKKVQQLLEEMTGS
Enzyme 81 Number of Residues 461
Enzyme 81 Molecular Weight 51574.2
Enzyme 81 Theoretical pI 4.87
Enzyme 81 GO Classification
Function
Process
Component
Enzyme 81 General Function Involved in ATP binding
Enzyme 81 Specific Function Required for the efficient recruitment of IRAK1 to the IL-1 receptor complex following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up- regulation and mRNA stabilization. Phosphorylates IRAK1
Enzyme 81 Pathways Not Available
Enzyme 81 Reactions Not Available
Enzyme 81 Pfam Domain Function
Enzyme 81 Signals
  • None
Enzyme 81 Transmembrane Regions
  • None
Enzyme 81 Essentiality Not Available
Enzyme 81 GenBank ID Protein 92097491 Link Image
Enzyme 81 UniProtKB/Swiss-Prot ID Q1RMT8 Link Image
Enzyme 81 UniProtKB/Swiss-Prot Entry Name IRAK4_BOVIN Link Image
Enzyme 81 PDB ID Not Available
Enzyme 81 Cellular Location Not Available
Enzyme 81 Gene Sequence >1386 bp
ATGAACAAACCCATAACAGCATCAACATACGTGCGCTGCCTCAGTCTTGGACTAATTAGA
AAGCTGTCCGATTTTATTGATCCTCAAGAAGGATGGAAGAAGTTAGCAGTCGCTATTAAA
AAACCATCTGGTGATGATAGATACAATCAGTTTCACATAAGGAGATTTGAAGCATTACTG
CAAATTGGAAAAAGCCCCACGTGTGAGTTACTGTTTGACTGGGGCACCACAAATTGCACA
GTTGGTGATCTTGTGGATATTTTGGTCCAAAATGAGTTTTTTGCCCCTGCAAGTCTTTTG
CTACCAGATGCTGTACCCAAAAATGTTAATACACTGCCTTCTAAAGTCACTGTAGTAGCA
GTTCAGCAGAAACCGAAGCCCCTCTGTGGCAAAGACAGGACATCTGTGATATCTGATGAG
AATCCTGAACAAAACTATGTGCTACCTGACTCCTCAAGTCCAGAAAATACAAGTTTAGAA
TTTAGTGATACACGTTTTCACAGTTTTTCATTTTTTGAATTGAAGGATGTCACAAATAAC
TTTGATGAACGGCCCATTTCTGTTGGTGGTAACAAAATGGGAGAAGGAGGGTTTGGAGTT
GTGTATAAAGGCTACGTGAACAACAGGACTGTAGCAGTGAAGAAGCTTGCAGCAATGGTT
GACATTAGTACTGAAGAACTGAAACAACAATTTGATCAAGAAATAAAAGTAATGGCAAAG
TGTCAACATGAAAACTTAGTAGAATTACTTGGTTTCTCAAGTGATGGAGATGACCTCTGC
TTAGTATATGTTTACATGCCCAATGGTTCATTGCTGGACAGACTGTCTTGCTTGGATGGT
ACTCCCCCACTCTCTTGGAACATGAGATGCAAGATTGCCCAGGGTGCAGCTAATGGCCTC
AGTTATTTACATGAAAACCATCATATTCATAGAGATATTAAAAGTGCAAATATCTTATTA
GATGAAGACTTTACAGCCAAAATATCTGACTTTGGGCTTGCACGGGCTTCTGAGAAGTTT
GCCCAGACAGTCATGACTAGCAGAATTGTGGGAACAACAGCTTATATGGCACCTGAAGCT
TTGCGAGGAGAAATTACACCCAAATCTGACATCTACAGCTTTGGTGTGGTTTTGCTAGAA
ATAATAACTGGACTTCCAGCTGTGGATGAACACCGTGAACCTCAGTTATTGCTAGATATT
AAAGAAGAAATTGAAGATGAAGAAAAGACAATTGAAGATTATGTTGATAGGAAGATGAAT
GACATTGATTCCACTTCCATTGAAACTATGTACTCTGTTGCCAGTCAGTGTCTGCATGAA
AAGAAAAATAAGAGACCAGACATTAAGAAGGTTCAACAGCTGCTAGAAGAAATGACAGGT
TCTTAA
Enzyme 81 GenBank Gene ID BC114720 Link Image
Enzyme 81 GeneCard ID IRAK4 Link Image
Enzyme 81 GenAtlas ID Not Available
Enzyme 81 HGNC ID Not Available
Enzyme 81 Chromosome Location Chromosome:1
Enzyme 81 Locus 12q12
Enzyme 81 SNPs SNPJam Report Link Image
Enzyme 81 General References Not Available
Enzyme 81 Metabolite References Not Available
Enzyme 82 [top]
Enzyme 82 ID 484
Enzyme 82 Name Endoribonuclease Dicer
Enzyme 82 Synonyms Not Available
Enzyme 82 Gene Name DICER1
Enzyme 82 Protein Sequence >Endoribonuclease Dicer
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVSASWTKEKWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGEAD
TEPVVDDDDVFPPYVLRPEDGPRVTINTAIGHVNRYCARLPSDPFTHLAPKCRTRELPDG
TFYSTLYLPINSPLRASIVGPPMSCIRLAERVVALICCEKLHKIGELDDHLMPVGKETVK
YEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPRPGQPCYLYVIGMVLTTPL
PDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSLQ
MLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIE
KSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFP
SPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRK
AKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVG
VRSLPVDFRYPNLDFGWKKSIDSKSFISIANSSSAENENYCKHSTIVVPENAAHQGANRT
SPLENHDQMSVNCRTLFSESPGKLQIEVSTDLTAINGLSYNKSLANGSYDLANRDFCQGN
HLNYYKQEIPVQPTTSYPIQNLYNYENQPKPSDECTLLSNKYLDGNANTSTSDGSPVTAA
VPGTTETGEAPPDRTASEQSPSPGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTVSLSALILDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVN
GLPPGYVVNQDKSNTEKWEKDEMTKDCMLANGKLDDDFEEEEEEEEDLMWRAHKEDADDE
DDFLEYDQEHIKFIDNMLMGSGAFVKKISLSPFSATDSAYEWKMPKKSSLGSLPFSSDFE
DFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSI
ADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKAMCPTRENFTSQQKNLSG
SRAAASGAGYRASVLKDLEYGCLKIPPRCMFDHPEADRTLRHLISGFENFEKKINYRFKN
KAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSAL
VNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKE
EDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLE
MEPEITKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQV
PNS
Enzyme 82 Number of Residues 1923
Enzyme 82 Molecular Weight 218255.7
Enzyme 82 Theoretical pI 5.46
Enzyme 82 GO Classification
Function
Process
Component
Enzyme 82 General Function Replication, recombination and repair
Enzyme 82 Specific Function Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, EIF2C2/AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre- miRNAs) to mature miRNAs and then load them onto EIF2C2/AGO2. EIF2C2/AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. Also cleaves double-stranded RNA to produce short interfering RNAs (siRNAs) which target the selective destruction of complementary RNAs
Enzyme 82 Pathways Not Available
Enzyme 82 Reactions Not Available
Enzyme 82 Pfam Domain Function
Enzyme 82 Signals
  • None
Enzyme 82 Transmembrane Regions
  • None
Enzyme 82 Essentiality Not Available
Enzyme 82 GenBank ID Protein 38679195 Link Image
Enzyme 82 UniProtKB/Swiss-Prot ID Q6TUI4 Link Image
Enzyme 82 UniProtKB/Swiss-Prot Entry Name DICER_BOVIN Link Image
Enzyme 82 PDB ID Not Available
Enzyme 82 Cellular Location Not Available
Enzyme 82 Gene Sequence >5772 bp
ATGAAAAGCCCTGCTTTGCAACCCCTCAGCATGGCAGGCCTGCAGCTCATGACCCCTGCT
TCCTCACCAATGGGTCCTTTCTTTGGACTGCCATGGCAACAAGAAGCAATTCATGATAAC
ATTTATACGCCAAGAAAATATCAGGTTGAACTGCTTGAAGCAGCTCTGGATCATAATACC
ATAGTCTGTTTAAACACTGGCTCAGGGAAGACGTTTATTGCAGTACTACTCACTAAAGAG
CTGTCTTATCAGATCAGGGGAGACTTCAACAGAAATGGCAAAAGGACGGTGTTCTTGGTC
AACTCTGCAAACCAGGTTGCCCAACAAGTGTCAGCTGTCAGAACTCACTCAGATCTCAAG
GTCGGGGAATACTCAAACCTAGAAGTAAGTGCATCTTGGACAAAAGAGAAATGGAACCAA
GAGTTTACTAAGCACCAGGTTCTCATTATGACCTGCTATGTCGCCTTGAATGTTTTGAAA
AATGGTTACTTATCACTGTCAGACATTAACCTTTTGGTGTTTGATGAGTGTCATCTTGCA
ATCCTAGACCACCCCTACCGAGAAATTATGAAGCTTTGTGAAAATTGTCCATCATGTCCT
CGTATTTTGGGACTAACTGCTTCCATTTTAAATGGGAAATGTGATCCAGAGGAATTGGAA
GAGAAGATTCAGAAACTGGAGAAAATTCTTAAGAGTAATGCTGAAACTGCAACTGACTTG
GTGGTCTTAGACAGATATACTTCTCAGCCATGTGAGATTGTGGTAGACTGTGGACCATTT
ACTGACAGAAGTGGGCTTTATGAAAGACTGCTGATGGAGTTAGAAGAAGCACTTAATTTT
ATCAATGACTGTAACATATCTGTACATTCAAAAGAAAGAGATTCTACTTTAATTTCTAAA
CAGATACTCTCAGACTGCCGTGCGGTCCTGGTTGTCCTGGGACCCTGGTGTGCCGATAAA
GTAGCTGGAATGATGGTCAGAGAGCTGCAGAAACACATCAAACATGAGCAGGAGGAGCTG
CACCGGAAGTTTCTGTTGTTCACAGACACTTTCCTACGGAAAATCCACGCCCTGTGTGAA
GAGCACTTCTCCCCTGCCTCGCTTGACCTGAAGTTTGTCACTCCTAAAGTAATAAAGCTG
CTCGAGATCTTACGCAAATACAAACCGTATGAGCGGCAGCAGTTTGAAAGCGTGGAGTGG
TATAATAATAGGAACCAGGATAATTACGTGTCCTGGAGCGATTCTGAGGATGACGAGGAA
GATGAAGAGATTGAAGAGAAAGAAAAGCCAGAGACAAATTTTCCTTCTCCGTTTACCAAC
ATTTTGTGTGGAATTATTTTTGTGGAAAGAAGATACACAGCCGTGGTCTTAAACAGATTG
ATAAAGGAAGCTGGCAAACAAGATCCAGAGCTGGCTTACATCAGCAGCAATTTTATAACT
GGACATGGCATCGGAAAGAATCAGCCTCGGAACAAACAGATGGAAGCGGAATTCAGAAAA
CAGGAAGAGGTACTTAGGAAATTTCGAGCACATGAAACCAACCTGCTTATTGCAACAAGT
ATTGTGGAGGAGGGTGTTGACATACCGAAATGCAACTTGGTGGTTCGTTTCGATCTGCCC
ACAGAGTATCGATCCTACGTTCAGTCCAAGGGAAGAGCGAGGGCACCCATCTCTAATTAT
GTAATGTTAGCAGACACAGATAAAATAAAGAGTTTTGAAGAAGACCTTAAAACATACAAA
GCTATTGAAAAGATCTTGCGAAACAAATGTTCCAAGTCGGTTGATACCGGGGAGGCCGAC
ACGGAGCCCGTGGTGGATGACGACGATGTTTTCCCACCGTATGTGCTGAGGCCTGAGGAC
GGTCCCCGCGTCACGATCAACACGGCCATTGGGCACGTCAACAGATACTGTGCTAGATTA
CCAAGTGATCCGTTTACTCATCTGGCTCCTAAATGTAGAACCCGAGAGTTGCCTGATGGT
ACATTTTATTCAACTCTTTATCTGCCAATTAACTCACCTCTTCGAGCCTCCATTGTTGGT
CCCCCAATGAGCTGCATTCGGTTGGCTGAAAGAGTCGTGGCTCTCATTTGCTGTGAAAAA
CTGCACAAAATTGGCGAACTGGATGACCATTTGATGCCAGTTGGGAAGGAGACTGTTAAA
TATGAGGAAGAGCTGGATTTACACGATGAAGAAGAGACCAGTGTTCCAGGAAGACCAGGT
TCCACAAAACGAAGACAGTGCTACCCAAAAGCAATTCCAGAATGTTTGAGGGAGAGCTAC
CCCAGGCCTGGTCAGCCCTGTTACCTGTACGTGATCGGAATGGTCCTGACGACACCTTTA
CCTGATGAGCTCAACTTCAGAAGGCGGAAGCTCTACCCCCCTGAGGACACCACAAGATGC
TTTGGAATACTGACAGCCAAGCCCATACCTCAGATCCCACACTTTCCTGTGTACACGCGC
TCTGGAGAGGTGACCATATCTATTGAGTTGAAGAAGTCCGGCTTCACGTTATCTCTGCAA
ATGCTTGAGTTGATCACAAGGCTTCACCAGTATATATTCTCACATATTCTTCGGCTTGAA
AAACCTGCACTAGAATTTAAACCCACAGACGCGGACTCAGCCTACTGCGTTCTACCTCTT
AATGTTGTTAATGACTCCAGCACTTTGGACATTGACTTTAAATTCATGGAAGATATCGAG
AAATCTGAAGCTCGAATAGGCATTCCCAGCACAAAGTATTCAAAAGAAACTCCTTTTGTT
TTCAAATTAGAAGATTACCAAGATGCAGTTATCATTCCAAGATACCGCAATTTTGATCAG
CCTCATCGATTTTATGTCGCTGACGTGTACACTGATCTTACCCCCCTGAGTAAATTTCCT
TCCCCTGAGTATGAAACGTTTGCGGAGTATTATAAAACAAAGTATAACCTTGACCTGACC
AATCTCAACCAGCCGCTGCTGGACGTGGACCACACGTCTTCACGACTCAATCTTTTGACA
CCTCGTCATTTGAATCAGAAGGGGAAAGCTCTCCCTCTGAGCAGTGCTGAGAAGAGGAAA
GCCAAGTGGGAGAGCCTGCAGAATAAGCAGATACTGGTTCCAGAACTCTGTGCTATACAT
CCAATTCCAGCATCACTGTGGAGAAAAGCCGTTTGTCTCCCGAGCATACTTTACCGCCTT
CACTGCCTTCTGACTGCAGAGGAGCTCAGAGCCCAGACGGCCAGCGACGCTGGTGTGGGA
GTCAGGTCACTTCCTGTGGATTTTAGATACCCTAACTTAGACTTCGGGTGGAAAAAATCT
ATCGACAGCAAATCTTTCATCTCAATTGCTAACTCCTCTTCAGCTGAAAATGAGAATTAC
TGTAAGCACAGCACAATTGTCGTCCCTGAAAATGCTGCACATCAAGGTGCTAATAGAACC
TCCCCTCTAGAAAATCATGACCAAATGTCTGTGAACTGCAGAACGTTGTTCAGCGAGTCA
CCTGGTAAGCTCCAAATTGAAGTTTCAACAGATCTGACAGCAATTAATGGTCTTTCTTAC
AATAAAAGTCTTGCCAATGGCAGTTACGATTTAGCTAACAGAGACTTTTGCCAAGGAAAC
CATCTGAATTACTACAAGCAGGAAATACCTGTACAACCAACTACCTCATATCCCATTCAG
AATTTATACAATTACGAGAACCAGCCCAAGCCCAGCGATGAATGTACTCTACTGAGTAAT
AAATACCTTGATGGAAATGCTAACACATCTACCTCAGATGGAAGTCCCGTGACGGCTGCC
GTGCCTGGTACTACAGAGACTGGGGAGGCGCCCCCGGACAGGACGGCTTCTGAGCAGAGC
CCTTCTCCTGGGTACTCCTCGAGGACGCTTGGCCCCAACCCTGGGCTCATTCTTCAGGCT
TTGACCCTTTCGAACGCTAGTGATGGATTTAACCTGGAGCGGCTCGAGATGCTTGGCGAC
TCCTTCCTCAAGCATGCCATCACCACCGTATCTCTTTCTGCACTTATCCTGGATGCGCAT
GAGGGCCGCCTTTCCTACATGAGAAGCAAAAAGGTCAGCAACTGTAATCTGTATCGGCTT
GGAAAAAAGAAGGGGCTGCCCAGCCGCATGGTGGTGTCCATATTTGACCCCCCTGTGAAT
GGGCTTCCTCCTGGTTACGTAGTAAATCAAGACAAAAGTAACACAGAGAAATGGGAAAAA
GATGAAATGACAAAAGACTGCATGTTGGCTAATGGCAAACTGGACGATGACTTCGAGGAG
GAGGAAGAGGAGGAGGAGGACCTGATGTGGAGGGCTCACAAGGAGGATGCGGACGATGAG
GACGACTTCCTGGAATACGATCAGGAGCACATCAAGTTCATAGATAACATGCTGATGGGG
TCAGGGGCTTTCGTCAAGAAAATCTCTCTTTCTCCTTTTTCTGCCACCGATTCTGCATAC
GAGTGGAAAATGCCCAAAAAGTCCTCCCTTGGTAGTCTGCCATTCTCATCCGATTTTGAG
GATTTCGACTACAGCTCCTGGGATGCGATGTGCTATCTGGATCCGAGCAAAGCCGTTGAA
GAGGATGACTTTGTGGTGGGGTTCTGGAATCCATCAGAAGAAAACTGTGGTGTGGACACA
GGGAAGCAGTCCATCTCTTACGACCTGCACACCGAGCAGTGCATTGCCGACAAAAGCATA
GCCGACTGTGTGGAAGCCCTGCTGGGCTGCTATTTAACCAGCTGTGGCGAGAGGGCTGCT
CAGCTTTTCCTCTGTTCGCTGGGGCTGAAGGTGCTCCCGGTAATTAAAAGGACTGATCGG
GAAAAGGCCATGTGCCCGACCAGGGAGAATTTCACCAGCCAACAAAAGAACCTTTCAGGG
AGCCGTGCGGCTGCCTCTGGAGCCGGCTACCGAGCCTCTGTGTTGAAAGACTTGGAGTAT
GGGTGTTTGAAGATCCCCCCGAGGTGTATGTTTGATCACCCCGAGGCAGACCGGACACTG
CGTCACCTGATCTCGGGTTTTGAAAATTTCGAAAAGAAAATCAACTACAGATTCAAGAAT
AAGGCTTACCTTCTACAGGCTTTTACACACGCCTCCTACCACTACAATACGATCACGGAT
TGTTACCAGCGCTTAGAATTCCTGGGAGATGCAATTTTGGACTACCTCATAACTAAGCAC
CTTTATGAAGACCCACGGCAGCACTCCCCAGGGGTCCTGACTGACCTGCGCTCTGCTCTG
GTCAACAATACCATCTTCGCGTCTTTGGCTGTGAAGTATGACTACCACAAGTACTTTAAG
GCCGTTTCTCCCGAGCTCTTCCATGTCATCGACGATTTCGTGCAGTTTCAGCTCGAGAAG
AACGAAATGCAAGGAATGGATTCTGAGCTTAGGAGATCCGAGGAGGATGAAGAGAAGGAA
GAGGATATTGAAGTTCCAAAGGCCATGGGGGATATTTTCGAGTCACTCGCGGGCGCCATT
TACATGGACAGCGGGATGTCGCTGGAGACGGTCTGGCAGGTGTACTATCCCATGATGCGG
CCGCTGATCGAAAAATTTTCTGCAAATGTGCCCCGTTCCCCTGTGCGAGAATTGCTTGAA
ATGGAACCAGAAATTACCAAATTCAGCCCAGCTGAGAGAACCTACGATGGCAAGGTCAGA
GTCACCGTGGAAGTGGTCGGGAAGGGGAAGTTCAAAGGCGTTGGCCGAAGTTACAGGATT
GCCAAGTCTGCAGCAGCAAGAAGAGCCCTGCGAAGCCTCAAAGCTAATCAACCTCAGGTT
CCCAATAGCTGA
Enzyme 82 GenBank Gene ID AY386968 Link Image
Enzyme 82 GeneCard ID DICER1 Link Image
Enzyme 82 GenAtlas ID Not Available
Enzyme 82 HGNC ID Not Available
Enzyme 82 Chromosome Location Chromosome:1
Enzyme 82 Locus 14q32.13
Enzyme 82 SNPs SNPJam Report Link Image
Enzyme 82 General References Not Available
Enzyme 82 Metabolite References Not Available
Enzyme 83 [top]
Enzyme 83 ID 485
Enzyme 83 Name Phosphoserine phosphatase
Enzyme 83 Synonyms
  1. PSPase
  2. PSP
  3. O-phosphoserine phosphohydrolase
  4. L-3-phosphoserine phosphatase
Enzyme 83 Gene Name PSPH
Enzyme 83 Protein Sequence >Phosphoserine phosphatase
MVSHSELRNLFCSADAVCFDVDSTVIQEEGIDELAKFCGVEDAVSEMTRQAMGGAVPFKA
ALTQRLALIQPSREQVQRLLAEHPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA
SKLNIPSTNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIVMVGDG
ATDMEACPPADAFIGFGGNVIRQQVKDNAEWYITDFVELLGALEE
Enzyme 83 Number of Residues 225
Enzyme 83 Molecular Weight 24850.2
Enzyme 83 Theoretical pI 4.99
Enzyme 83 GO Classification
Function
Process
Component
Enzyme 83 General Function Amino acid transport and metabolism
Enzyme 83 Specific Function Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates
Enzyme 83 Pathways
  • Amino-acid biosynthesis
  • L-serine biosynthesis
  • L-serine from 3-phospho-D-glycerate:step 3/3
Enzyme 83 Reactions Not Available
Enzyme 83 Pfam Domain Function
Enzyme 83 Signals
  • None
Enzyme 83 Transmembrane Regions
  • None
Enzyme 83 Essentiality Not Available
Enzyme 83 GenBank ID Protein 86438405 Link Image
Enzyme 83 UniProtKB/Swiss-Prot ID Q2KHU0 Link Image
Enzyme 83 UniProtKB/Swiss-Prot Entry Name SERB_BOVIN Link Image
Enzyme 83 PDB ID 1NNL Link Image
Enzyme 83 PDB File Show
Enzyme 83 3D Structure
Enzyme 83 Cellular Location Not Available
Enzyme 83 Gene Sequence >678 bp
ATGGTCTCCCATTCAGAGTTGAGGAATCTTTTCTGTTCAGCTGATGCAGTGTGCTTTGAT
GTCGATAGCACCGTCATCCAAGAAGAAGGAATTGATGAGCTGGCCAAATTCTGTGGAGTT
GAGGATGCCGTGTCAGAAATGACACGGCAAGCCATGGGCGGAGCAGTGCCTTTCAAGGCT
GCCCTCACACAGCGCTTAGCTCTGATCCAGCCCTCCAGGGAACAGGTGCAGAGGCTCCTA
GCAGAGCACCCCCCGCACCTGACCCCTGGCATAAGGGAGCTAGTAAGTCGCCTACAAGAA
CGAAATGTTCAGGTTTTCCTGATATCTGGTGGCTTTAGGAGCATTGTGGAGCATGTTGCT
TCAAAGCTCAACATTCCATCAACCAATGTATTTGCCAATAGGCTGAAGTTCTACTTTAAT
GGTGAATATGCAGGTTTTGATGAGACGCAGCCAACAGCTGAATCTGGTGGAAAAGGAAAA
GTTATTAAATTGTTAAAGGAAAAATTTCACTTTAAGAAGATCGTCATGGTTGGAGATGGA
GCCACAGACATGGAAGCCTGTCCTCCTGCTGATGCTTTCATTGGATTCGGAGGAAATGTG
ATCAGGCAGCAAGTAAAGGATAACGCGGAATGGTACATCACTGATTTTGTAGAGCTTCTG
GGAGCACTGGAAGAATAA
Enzyme 83 GenBank Gene ID BC112884 Link Image
Enzyme 83 GeneCard ID PSPH Link Image
Enzyme 83 GenAtlas ID Not Available
Enzyme 83 HGNC ID Not Available
Enzyme 83 Chromosome Location Chromosome:7
Enzyme 83 Locus 7p15.2-p15.1
Enzyme 83 SNPs SNPJam Report Link Image
Enzyme 83 General References Not Available
Enzyme 83 Metabolite References Not Available
Enzyme 84 [top]
Enzyme 84 ID 486
Enzyme 84 Name Nucleoside diphosphate kinase 7
Enzyme 84 Synonyms
  1. NDP kinase 7
  2. NDK 7
Enzyme 84 Gene Name NME7
Enzyme 84 Protein Sequence >Nucleoside diphosphate kinase 7
MNHSERFVFIAEWFDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYEDLHLEDL
FIGNKVNIFSRQLVLLDYGDQYTARQLGSKKEKTLALIKPDAVSKAGEIIEIINKAGFTL
TKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAVCEWKRLLGPAN
SGLARTDAPESIRALFGTDGIKNAAHGPDSFACAAREMELFFPSSGVCGPANTAKFTNCT
TCCIVKPHAVSEGLLGKILMTIRDAGFEISAMQMFNMDRINVEEFYEVYKGVVSEYNEMV
TEMYSGPCVAMEIQQTNPTMTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDL
PEDGLLEVQYFFKILDN
Enzyme 84 Number of Residues 377
Enzyme 84 Molecular Weight 42598.6
Enzyme 84 Theoretical pI 6.02
Enzyme 84 GO Classification
Function
Process
Component
Enzyme 84 General Function Nucleotide transport and metabolism
Enzyme 84 Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate
Enzyme 84 Pathways Not Available
Enzyme 84 Reactions Not Available
Enzyme 84 Pfam Domain Function
Enzyme 84 Signals
  • None
Enzyme 84 Transmembrane Regions
  • None
Enzyme 84 Essentiality Not Available
Enzyme 84 GenBank ID Protein 59857925 Link Image
Enzyme 84 UniProtKB/Swiss-Prot ID Q5E9Y9 Link Image
Enzyme 84 UniProtKB/Swiss-Prot Entry Name NDK7_BOVIN Link Image
Enzyme 84 PDB ID Not Available
Enzyme 84 Cellular Location Not Available
Enzyme 84 Gene Sequence >1134 bp
ATGAATCATAGTGAGAGGTTCGTTTTCATCGCAGAGTGGTTTGATCCAAATGCTTCACTA
TTTCGACGTTATGAACTTTTATTTTACCCCGGGGATGGATCTGTTGAAATGCATGATGTA
AAGAATCATCGCACCTTTTTAAAGCGGACAAAATATGAAGATCTTCACCTGGAAGATTTA
TTTATAGGCAACAAAGTGAACATCTTTTCTCGACAACTGGTGCTGCTTGACTATGGAGAT
CAATACACAGCTCGTCAACTGGGCAGTAAGAAAGAAAAAACATTAGCCCTGATTAAACCA
GATGCAGTATCAAAAGCTGGAGAAATAATTGAAATAATAAACAAAGCTGGATTTACTCTA
ACCAAACTCAAAATGATGACGCTATCAAGGAAAGAAGCAACAGATTTTCATATAGACCAT
CAGTCAAGGCCCTTTTTAAATGAGCTGATCCAGTTTATTACAAGTGGACCTATAATTGCC
ATGGAGATTTTACGAGATGATGCTGTATGTGAATGGAAGAGACTTCTTGGACCTGCGAAC
TCTGGACTGGCACGTACAGATGCTCCTGAAAGCATTAGAGCCCTCTTTGGAACAGATGGC
ATAAAGAATGCAGCTCATGGCCCCGATTCTTTTGCTTGTGCTGCCAGAGAAATGGAGTTA
TTTTTTCCTTCAAGTGGAGTGTGTGGGCCAGCAAACACTGCTAAATTTACTAATTGTACT
ACTTGTTGCATTGTTAAGCCCCATGCTGTCAGCGAAGGACTTCTGGGAAAGATCCTGATG
ACTATCCGAGATGCAGGTTTTGAAATCTCAGCTATGCAGATGTTTAACATGGATCGGATT
AATGTTGAAGAGTTTTATGAAGTTTATAAAGGAGTAGTGTCTGAGTATAATGAAATGGTG
ACAGAAATGTATTCTGGGCCTTGTGTAGCAATGGAGATTCAACAAACTAATCCTACAATG
ACATTTCGAGAATTCTGTGGACCTGCTGATCCTGAAATTGCCCGACATTTACGCCCTGGA
ACCCTCCGAGCAATCTTTGGTAAAACTAAGATCCAGAATGCTGTTCACTGTACGGATCTG
CCAGAAGATGGTCTATTAGAGGTTCAGTATTTCTTCAAAATCTTGGATAACTAG
Enzyme 84 GenBank Gene ID BT020780 Link Image
Enzyme 84 GeneCard ID NME7 Link Image
Enzyme 84 GenAtlas ID Not Available
Enzyme 84 HGNC ID Not Available
Enzyme 84 Chromosome Location Chromosome:1
Enzyme 84 Locus 1q24
Enzyme 84 SNPs SNPJam Report Link Image
Enzyme 84 General References
  1. [PubMed Link Image]
Enzyme 84 Metabolite References Not Available
Enzyme 85 [top]
Enzyme 85 ID 487
Enzyme 85 Name Inositol monophosphatase 3
Enzyme 85 Synonyms
  1. Inositol-1(or 4)-monophosphatase 3
  2. IMPase 3
  3. IMP 3
  4. Myo-inositol monophosphatase A3
  5. Inositol monophosphatase domain-containing protein 1
Enzyme 85 Gene Name IMPAD1
Enzyme 85 Protein Sequence >Inositol monophosphatase 3
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAGPAASAD
GGTVDLREMLAVSVLAAVRGGEEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKM
FYLLKTAFPSVQINTEEHVDASDQEVILWDRKIPEDILKEIATPQEVPAESVTVWIDPLD
ATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARTSYNEKTP
RIVVSRSHSGMVKQVALQTFGNQTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIK
KWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTG
HK
Enzyme 85 Number of Residues 362
Enzyme 85 Molecular Weight 38923.4
Enzyme 85 Theoretical pI 6.80
Enzyme 85 GO Classification
Function
Process
Component
Enzyme 85 General Function Carbohydrate transport and metabolism
Enzyme 85 Specific Function Myo-inositol phosphate + H(2)O = myo-inositol + phosphate
Enzyme 85 Pathways
  • Polyol metabolism
  • myo-inositol biosynthesis
  • myo- inositol from D-glucose 6-phosphate:step 2/2
Enzyme 85 Reactions Not Available
Enzyme 85 Pfam Domain Function
Enzyme 85 Signals
  • None
Enzyme 85 Transmembrane Regions
  • 13-33
Enzyme 85 Essentiality Not Available
Enzyme 85 GenBank ID Protein 86827736 Link Image
Enzyme 85 UniProtKB/Swiss-Prot ID Q2KJ53 Link Image
Enzyme 85 UniProtKB/Swiss-Prot Entry Name IMPA3_BOVIN Link Image
Enzyme 85 PDB ID Not Available
Enzyme 85 Cellular Location Not Available
Enzyme 85 Gene Sequence >1089 bp
ATGGCCCCCATGGGCATCCGCCTGTCCCCGCTGGGGGTGGCCGTGTTCTGCCTGCTGGGG
CTCGGCGTGCTCTACCACCTCTATTCAGGCTTCCTGGCCGGCCGCTTCAGCCTCTTTGGC
CTGGGCGGCGAGCCGGGCGGCGGGGCGGCGGGGCCCGCGGGGCCCGCGGCCTCGGCCGAC
GGGGGCACGGTGGACCTGCGCGAGATGCTGGCCGTATCGGTGCTGGCGGCCGTGCGCGGC
GGCGAGGAGGTGCGGCGCGTACGCGAGAGCAACGTCCTCCACGAGAAGTCCAAGGGGAAG
ACGCGCGAGGGAGCGGACGACAAGATGACCAGTGGAGACGTGTTGTCCAACCGCAAGATG
TTCTACCTACTCAAGACCGCCTTCCCCAGCGTGCAGATCAATACGGAGGAACATGTGGAT
GCATCTGATCAAGAGGTGATCTTGTGGGATCGGAAGATTCCTGAGGACATCCTAAAGGAA
ATAGCCACTCCCCAGGAAGTGCCGGCAGAGAGCGTCACCGTCTGGATTGACCCACTGGAT
GCCACACAGGAGTACACGGAGGATCTTCGGAAGTATGTTACTACTATGGTGTGTGTGGCT
GTAAATGGTAAACCTGTGCTAGGAGTAATACATAAACCATTTTCTGAATATACAGCCTGG
GCGATGGTAGACGGTGGATCAAATGTGAAAGCCCGCACTTCTTACAATGAGAAGACCCCA
AGGATTGTCGTGTCTCGCTCGCATTCAGGAATGGTCAAACAGGTTGCTCTTCAGACTTTC
GGAAACCAGACTACGATCATCCCAGCGGGCGGTGCTGGTTATAAAGTTTTAGCACTCTTG
GATGTGCCTGATAAGAGTCAAGAAAAAGCTGATCTATATATCCATGTGACATACATCAAA
AAGTGGGATATCTGTGCTGGCAACGCCATCTTGAAAGCCCTCGGGGGGCACATGACCACC
CTGAGTGGTGAAGAAATTAGCTACACTGGTTCCGACGGCATTGAAGGGGGGCTCCTGGCC
AGCATCAGGATGAACCATCAGGCTCTGGTCAGAAAGCTCCCGGATCTGGAGAAGACGGGA
CATAAGTAA
Enzyme 85 GenBank Gene ID BC105514 Link Image
Enzyme 85 GeneCard ID IMPAD1 Link Image
Enzyme 85 GenAtlas ID Not Available
Enzyme 85 HGNC ID Not Available
Enzyme 85 Chromosome Location Chromosome:8
Enzyme 85 Locus 8q12.1
Enzyme 85 SNPs SNPJam Report Link Image
Enzyme 85 General References Not Available
Enzyme 85 Metabolite References Not Available
Enzyme 86 [top]
Enzyme 86 ID 488
Enzyme 86 Name Acetolactate synthase-like protein
Enzyme 86 Synonyms
  1. IlvB-like protein
Enzyme 86 Gene Name ILVBL
Enzyme 86 Protein Sequence >Acetolactate synthase-like protein
METAVAAAPAWGFFSSFLLLAFGTLVAALLGAAHRLGLFYQLMHKVDTASTRHGGENVAA
VLKAHGVRFLFTLVGGHISPLLVACEKLGIRVVDTRHEVTAVFAADAVARLTGTVGVAAV
TAGPGLTNTVTAVKNAQIAQSPVLLLGGAASTLLQNRGALQAIDQIALFRPLCKFCASVR
RVRDIIPTLRAAMAAAQSGTPGPVFVELPLDVLYPYFMVQKEMVPAKPPKGLMSRAVHWY
LANSLANLFAGAWEPQPEGPLPLDIPQASPQQVQRCVEILSRAKKPLMLIGSQALLPPTS
SDKLRVAVETLGIPCFLAGMARGLLGRNHPLHFRQNRRAALKKADVVVLAGAVCDFRLSY
GRVLSRSSKIIVVNRDRKEMLINSDIFWKPQEAVQGDVGSFVVKLVEGLRGQMWASDWAE
ELRQADQQKEQAFREKALMPVAQHLNPVRVLQLVEDTLPDNSILVVDGGDFVGTAAYLVQ
PRGPLRWLDPGAFGTLGVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIP
VMALIGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAQGLGAQGLLLSRENEDQVVKV
LRDAQQWCQDGHPVVVNILIGRTDFRDGSIAM
Enzyme 86 Number of Residues 632
Enzyme 86 Molecular Weight 68109.6
Enzyme 86 Theoretical pI 8.96
Enzyme 86 GO Classification
Function
Process
Component
Enzyme 86 General Function Amino acid transport and metabolism
Enzyme 86 Specific Function Not Available
Enzyme 86 Pathways Not Available
Enzyme 86 Reactions Not Available
Enzyme 86 Pfam Domain Function
Enzyme 86 Signals
  • None
Enzyme 86 Transmembrane Regions
  • 10-30
Enzyme 86 Essentiality Not Available
Enzyme 86 GenBank ID Protein 59857973 Link Image
Enzyme 86 UniProtKB/Swiss-Prot ID A6QQT9 Link Image
Enzyme 86 UniProtKB/Swiss-Prot Entry Name ILVBL_BOVIN Link Image
Enzyme 86 PDB ID Not Available
Enzyme 86 Cellular Location Not Available
Enzyme 86 Gene Sequence >1920 bp
ATGAGAAGCAGGTGTCAGCTCATGGAGACCGCGGTGGCTGCCGCCCCAGTTTGGGGCTTC
TTCTCCTCTTTTCTGCTCCTGGCCTTTGGGACGCTAGTGGCCGCCTTGCTGGGCGCCGCT
CACCGCCTGGGGCTCTTCTATCAGTTGATGCACAAGGTGGACACGGCAAGCACCCGGCAT
GGTGGGGAAAATGTGGCAGCCGTGCTGAAGGCCCACGGTGTGCGCTTCCTTTTCACACTG
GTCGGCGGGCACATTTCGCCACTGCTGGTGGCCTGTGAGAAGTTGGGCATCCGCGTGGTG
GACACCCGCCACGAAGTCACAGCTGTCTTTGCCGCTGATGCTGTAGCCCGCCTGACCGGG
ACAGTGGGCGTGGCTGCAGTGACGGCCGGTCCCGGCCTCACCAACACAGTGACTGCGGTG
AAGAATGCCCAGATAGCCCAGTCCCCAGTCCTGCTCCTGGGTGGGGCTGCCAGCACCCTG
CTGCAGAATCGGGGTGCACTCCAGGCAATTGATCAGATAGCCCTGTTCCGGCCGCTCTGC
AAGTTTTGTGCTTCTGTGCGGAGAGTGCGGGATATCATCCCCACCCTGAGGGCTGCGATG
GCCGCTGCACAGTCGGGCACCCCCGGCCCGGTGTTTGTGGAACTGCCTCTGGACGTGCTG
TACCCCTACTTCATGGTTCAGAAGGAGATGGTGCCAGCTAAGCCGCCCAAGGGCCTCATG
AGTCGAGCGGTCCACTGGTACTTGGCGAATTCCCTGGCCAACCTCTTTGCAGGAGCTTGG
GAGCCTCAGCCTGAGGGGCCTCTGCCCCTGGACATTCCCCAGGCCTCCCCCCAGCAGGTT
CAGCGATGTGTGGAGATCTTGAGTCGGGCCAAAAAGCCCCTCATGCTAATTGGGAGCCAG
GCCCTGCTGCCTCCGACATCCTCAGACAAGCTTCGGGTTGCCGTGGAGACCCTGGGCATC
CCTTGCTTCCTGGCGGGGATGGCACGGGGACTGCTGGGCCGCAACCACCCCCTCCATTTC
CGGCAGAACCGCAGGGCTGCCCTGAAGAAGGCAGACGTGGTCGTCCTGGCAGGAGCAGTG
TGTGACTTCCGCCTGTCCTATGGGCGTGTCCTCAGCCGCAGCAGCAAAATCATTGTTGTC
AACCGTGACCGGAAGGAGATGCTGATCAACTCAGACATTTTCTGGAAGCCCCAAGAGGCT
GTGCAGGGAGATGTGGGCTCCTTCGTGGTGAAGCTGGTGGAGGGCCTCCGGGGTCAGATG
TGGGCCTCAGACTGGGCAGAGGAGCTTCGGCAAGCCGACCAACAGAAGGAGCAGGCCTTT
CGGGAGAAGGCACTGATGCCCGTAGCCCAGCATCTTAACCCGGTGCGGGTCCTGCAGCTG
GTGGAGGACACTCTGCCTGACAACTCCATCCTGGTGGTTGATGGCGGGGACTTCGTGGGC
ACAGCTGCCTACCTGGTGCAGCCCCGTGGGCCCTTGCGTTGGCTTGATCCTGGGGCCTTT
GGGACTCTGGGGGTTGGTGCCGGATTTGCACTTGGGGCCAAACTGTGTCGGCCGGATGCG
GAGGTCTGGTGCTTGTTTGGGGATGGAGCGTTTGGCTATAGCCTCATCGAATTTGACACC
TTCGTCAGACACAAGATCCCAGTGATGGCCTTGATAGGAAATGATGCTGGCTGGACCCAG
ATTTCCAGGGAGCAGGTGCCCTCTCTGGGCAGCAATGTGGCCTGTGGCTTGGCTTACACT
GATTATCACAAGGCAGCCCAGGGACTGGGGGCCCAGGGCTTGCTGCTGTCACGCGAGAAT
GAGGATCAGGTGGTCAAGGTGCTGCGTGACGCCCAGCAGTGGTGCCAGGATGGCCACCCG
GTTGTGGTCAACATTCTCATCGGGAGGACGGACTTCCGGGACGGCTCCATCGCCATGTAG
Enzyme 86 GenBank Gene ID BT020804 Link Image
Enzyme 86 GeneCard ID ILVBL Link Image
Enzyme 86 GenAtlas ID Not Available
Enzyme 86 HGNC ID Not Available
Enzyme 86 Chromosome Location Chromosome:1
Enzyme 86 Locus 19p13.1
Enzyme 86 SNPs SNPJam Report Link Image
Enzyme 86 General References
  1. [PubMed Link Image]
Enzyme 86 Metabolite References Not Available
Enzyme 87 [top]
Enzyme 87 ID 489
Enzyme 87 Name Nucleoside diphosphate-linked moiety X motif 17
Enzyme 87 Synonyms
  1. Nudix motif 17
Enzyme 87 Gene Name NUDT17
Enzyme 87 Protein Sequence >Nucleoside diphosphate-linked moiety X motif 17
MAAARVLLLLSGRPESVSFAQSVCGLLGAGSGLGPWPTHCGLKRGQLVLSDKPFPGASAR
LPLQRPPFCPFAALDQQPRAPGVELPPKGRGVDLGVAVILQSSDQTVLLTRRTSTLNISP
NLWVPPGGHVEPDEELLDGGLRELWEESGLQLPQGQFSWVPLGLWESAYPPKLSWGLPKY
HHIVLYLLVISQESQQQLQARIQPNAGEVSAFMWLGPDIAAAVAATEDGTETPKHLPQDL
PSSVPTVELKENGGAQPLALPTSTLLRTTPGTADSRERVSTGTKFALTLWLQHLGRKSRD
GS
Enzyme 87 Number of Residues 302
Enzyme 87 Molecular Weight 32388.7
Enzyme 87 Theoretical pI 6.79
Enzyme 87 GO Classification
Function
Process
Component
Enzyme 87 General Function Involved in hydrolase activity
Enzyme 87 Specific Function Probably mediates the hydrolysis of some nucleoside diphosphate derivatives
Enzyme 87 Pathways Not Available
Enzyme 87 Reactions Not Available
Enzyme 87 Pfam Domain Function
Enzyme 87 Signals
  • None
Enzyme 87 Transmembrane Regions
  • None
Enzyme 87 Essentiality Not Available
Enzyme 87 GenBank ID Protein 133777807 Link Image
Enzyme 87 UniProtKB/Swiss-Prot ID A4FUG7 Link Image
Enzyme 87 UniProtKB/Swiss-Prot Entry Name NUD17_BOVIN Link Image
Enzyme 87 PDB ID Not Available
Enzyme 87 Cellular Location Not Available
Enzyme 87 Gene Sequence >909 bp
ATGGCGGCGGCACGGGTGCTGCTACTCCTCTCCGGGCGCCCGGAGTCGGTGAGCTTCGCG
CAGAGTGTGTGCGGCCTCCTGGGCGCCGGGTCGGGGCTCGGGCCGTGGCCCACGCACTGC
GGCCTGAAGCGGGGACAACTGGTCCTCTCGGACAAGCCTTTCCCAGGCGCGTCGGCCAGG
CTTCCGCTCCAGCGACCGCCTTTCTGCCCTTTTGCGGCCCTGGACCAACAGCCCAGGGCT
CCGGGGGTTGAGCTGCCCCCGAAAGGTCGAGGTGTGGATCTGGGTGTGGCGGTCATTCTG
CAGTCCAGCGACCAGACTGTCTTGTTGACGCGAAGGACAAGCACCCTCAACATTTCGCCC
AACCTCTGGGTACCCCCAGGTGGGCATGTGGAACCTGATGAAGAGCTGCTGGATGGGGGG
CTTCGAGAGCTTTGGGAGGAGAGTGGACTCCAGCTGCCCCAGGGCCAGTTCTCCTGGGTC
CCTCTGGGGTTATGGGAGTCTGCCTACCCCCCTAAGCTGAGCTGGGGTCTCCCCAAATAC
CATCACATCGTTCTCTACCTACTTGTCATCTCCCAGGAGTCACAGCAGCAGCTCCAGGCC
CGGATTCAACCAAATGCAGGAGAGGTGAGTGCCTTCATGTGGCTGGGACCAGACATAGCA
GCTGCAGTGGCTGCCACAGAGGATGGGACAGAGACCCCCAAACATCTTCCCCAGGACCTA
CCATCTTCTGTACCTACAGTGGAACTAAAAGAGAATGGAGGAGCCCAGCCTCTGGCCTTG
CCCACATCCACCCTGCTGCGGACAACCCCGGGCACGGCAGACAGCAGAGAGAGGGTCAGC
ACTGGCACCAAGTTTGCCCTCACGCTTTGGCTGCAACATCTGGGCAGGAAGAGCCGGGAT
GGCAGCTGA
Enzyme 87 GenBank Gene ID BC114872 Link Image
Enzyme 87 GeneCard ID NUDT17 Link Image
Enzyme 87 GenAtlas ID Not Available
Enzyme 87 HGNC ID Not Available
Enzyme 87 Chromosome Location Chromosome:1
Enzyme 87 Locus 1q21.1
Enzyme 87 SNPs SNPJam Report Link Image
Enzyme 87 General References Not Available
Enzyme 87 Metabolite References Not Available
Enzyme 88 [top]
Enzyme 88 ID 490
Enzyme 88 Name Inorganic pyrophosphatase
Enzyme 88 Synonyms
  1. Pyrophosphate phospho-hydrolase
  2. PPase
Enzyme 88 Gene Name PPA1
Enzyme 88 Protein Sequence >Inorganic pyrophosphatase
MSGFSSEERAAPFTLEYRVFLKNEKGQYISPFHDIPIYADKEVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVEDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKNFAIDIIESTHDYWRALVTKKTDGKGI
SCMNTTVSESPFQCDPDAAKAIVDALPPPCESACTIPTDVDKWFHHQKN
Enzyme 88 Number of Residues 289
Enzyme 88 Molecular Weight 32813.9
Enzyme 88 Theoretical pI 5.12
Enzyme 88 GO Classification
Function
Process
Component
Enzyme 88 General Function Energy production and conversion
Enzyme 88 Specific Function Diphosphate + H(2)O = 2 phosphate
Enzyme 88 Pathways Not Available
Enzyme 88 Reactions Not Available
Enzyme 88 Pfam Domain Function
Enzyme 88 Signals
  • None
Enzyme 88 Transmembrane Regions
  • None
Enzyme 88 Essentiality Not Available
Enzyme 88 GenBank ID Protein Not Available
Enzyme 88 UniProtKB/Swiss-Prot ID P37980 Link Image
Enzyme 88 UniProtKB/Swiss-Prot Entry Name IPYR_BOVIN Link Image
Enzyme 88 PDB ID Not Available
Enzyme 88 Cellular Location Not Available
Enzyme 88 Gene Sequence Not Available
Enzyme 88 GenBank Gene ID M95283 Link Image
Enzyme 88 GeneCard ID PPA1 Link Image
Enzyme 88 GenAtlas ID Not Available
Enzyme 88 HGNC ID Not Available
Enzyme 88 Chromosome Location Chromosome:1
Enzyme 88 Locus 10q11.1-q24
Enzyme 88 SNPs SNPJam Report Link Image
Enzyme 88 General References
  1. [PubMed Link Image]
Enzyme 88 Metabolite References Not Available
Enzyme 89 [top]
Enzyme 89 ID 491
Enzyme 89 Name Enolase
Enzyme 89 Synonyms Not Available
Enzyme 89 Gene Name ENO2
Enzyme 89 Protein Sequence >Enolase
MSIEKIWAREILDSRGNPTVEVDLHTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINTTIAPVLISSGLSVVEQEKLDNLMLDLDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACRLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
Enzyme 89 Number of Residues 434
Enzyme 89 Molecular Weight 47268.1
Enzyme 89 Theoretical pI 4.69
Enzyme 89 GO Classification
Function
Process
Component
Enzyme 89 General Function Carbohydrate transport and metabolism
Enzyme 89 Specific Function 2-phospho-D-glycerate = phosphoenolpyruvate + H(2)O
Enzyme 89 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 4/5
Enzyme 89 Reactions Not Available
Enzyme 89 Pfam Domain Function
Enzyme 89 Signals
  • None
Enzyme 89 Transmembrane Regions
  • None
Enzyme 89 Essentiality Not Available
Enzyme 89 GenBank ID Protein 151557113 Link Image
Enzyme 89 UniProtKB/Swiss-Prot ID A6QR19 Link Image
Enzyme 89 UniProtKB/Swiss-Prot Entry Name A6QR19_BOVIN Link Image
Enzyme 89 PDB ID 1TE6 Link Image
Enzyme 89 PDB File Show
Enzyme 89 3D Structure
Enzyme 89 Cellular Location Not Available
Enzyme 89 Gene Sequence >1305 bp
ATGTCCATAGAGAAGATTTGGGCCCGGGAAATCCTGGACTCCCGTGGGAATCCCACGGTG
GAGGTGGATCTCCACACTGCCAAAGGTCTTTTCCGGGCTGCCGTGCCCAGTGGAGCCTCC
ACCGGTATCTACGAGGCCCTGGAGCTAAGGGATGGGGACAAACAGCGTTACTTGGGCAAA
GGTGTCCTGAAGGCCGTGGACCACATCAACACCACCATTGCCCCAGTCCTCATCAGCTCA
GGTCTGTCTGTGGTAGAACAAGAGAAGCTGGACAACCTGATGTTGGACTTGGATGGGACT
GAGAACAAGTCCAAGTTTGGGGCCAATGCCATCCTGGGTGTGTCCCTGGCTGTGTGTAAG
GCAGGGGCTGCCGAGCGGGAACTGCCCCTCTACCGACATATTGCCCAGCTGGCCGGGAAC
TCAGACCTCATCCTGCCTGTGCCGGCCTTCAACGTGATCAATGGTGGCTCTCATGCTGGG
AACAAGCTGGCCATGCAGGAATTCATGATCCTCCCAGTGGGGGCCGAGAGCTTCCGGGAT
GCCATGCGACTTGGGGCAGAGGTCTACCACACACTCAAGGGCGTCATCAAGGACAAGTAT
GGCAAGGACGCCACCAACGTGGGGGATGAAGGTGGCTTTGCCCCCAACATCCTGGAGAAC
AGTGAGGCCTTGGAACTGGTGAAGGAAGCCATTGACAAGGCTGGCTACACAGAGAAGATC
GTCATTGGCATGGATGTTGCCGCCTCGGAGTTTTACCGCGATGGCAAATATGACTTGGAT
TTCAAGTCTCCTGCTGATCCTTCCCGATACATCACCGGGGACCAGCTGGGGGCCCTCTAC
CAGGACTTTGTCAGGGACTATCCTGTGGTCTCCATTGAGGACCCCTTTGACCAGGACGAT
TGGGCGGCCTGGTCCAAGTTCACAGCCAATGTGGGGATCCAGATTGTGGGTGATGACCTG
ACAGTGACCAACCCCAAGCGAATTGAGCGGGCGGTGGAGGAGAAGGCCTGCAACTGTCTG
CTGCTGAAGGTCAACCAGATCGGTTCAGTCACCGAAGCCATCCAAGCGTGCAGGCTGGCC
CAGGAGAACGGCTGGGGGGTCATGGTGAGTCACCGCTCCGGAGAGACTGAGGACACGTTC
ATCGCTGACCTGGTGGTGGGGCTGTGCACAGGCCAGATCAAGACTGGTGCCCCATGCCGT
TCTGAGCGTCTGGCTAAGTACAACCAGCTCATGAGAATTGAAGAAGAACTAGGGGATGAA
GCTCGCTTTGCGGGACATAACTTCCGCAACCCCAGTGTGCTGTGA
Enzyme 89 GenBank Gene ID BC150078 Link Image
Enzyme 89 GeneCard ID ENO2 Link Image
Enzyme 89 GenAtlas ID Not Available
Enzyme 89 HGNC ID Not Available
Enzyme 89 Chromosome Location Chromosome:1
Enzyme 89 Locus 12p13
Enzyme 89 SNPs SNPJam Report Link Image
Enzyme 89 General References Not Available
Enzyme 89 Metabolite References Not Available
Enzyme 90 [top]
Enzyme 90 ID 492
Enzyme 90 Name TFIIH basal transcription factor complex helicase subunit
Enzyme 90 Synonyms
  1. DNA repair protein complementing XP-D cells
  2. Xeroderma pigmentosum group D-complementing protein
  3. CXPD
  4. DNA excision repair protein ERCC-2
Enzyme 90 Gene Name ERCC2
Enzyme 90 Protein Sequence >TFIIH basal transcription factor complex helicase subunit
MKLNVDGLLVYFPYDYIYPEQFSYMLELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ
RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLSFYEKQEGEKLPFLGLALSSRKNLCIHPE
VTPLRFGKDVDGKCHSLTASYVRAQYQRDSSLPHCRFYEEFDVHGRQVPLPTGIYNLDDL
KAVGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQANLETLQKTVLRIKETDEQRLREEYRRLVEGLREASAARE
TDAHLANPVLPDEVLKEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
LAQRVCIQRKPLRFCAERLRSLLYTLEISDLTDFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
AQCVGRAIRGKTDYGLMVFADKRFARADKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLRRIEQIAQQL
Enzyme 90 Number of Residues 760
Enzyme 90 Molecular Weight 86998.5
Enzyme 90 Theoretical pI 7.38
Enzyme 90 GO Classification
Function
Process
Component
Enzyme 90 General Function Transcription
Enzyme 90 Specific Function ATP-dependent 5'-3' DNA helicase, component of the core- TFIIH basal transcription factor. Involved in nucleotide excision repair (NER) of DNA by opening DNA around the damage, and in RNA transcription by RNA polymerase II by anchoring the CDK-activating kinase (CAK) complex, composed of CDK7, cyclin H and MAT1, to the core-TFIIH complex. Might also have a role in aging process and could play a causative role in the generation of skin cancers
Enzyme 90 Pathways Not Available
Enzyme 90 Reactions Not Available
Enzyme 90 Pfam Domain Function
Enzyme 90 Signals
  • None
Enzyme 90 Transmembrane Regions
  • None
Enzyme 90 Essentiality Not Available
Enzyme 90 GenBank ID Protein 151556394 Link Image
Enzyme 90 UniProtKB/Swiss-Prot ID A6QLJ0 Link Image
Enzyme 90 UniProtKB/Swiss-Prot Entry Name ERCC2_BOVIN Link Image
Enzyme 90 PDB ID Not Available
Enzyme 90 Cellular Location Not Available
Enzyme 90 Gene Sequence >2283 bp
ATGAAGCTCAACGTGGACGGGCTGCTGGTCTACTTCCCCTACGACTACATCTACCCGGAG
CAGTTCTCGTACATGCTGGAGCTCAAACGCACGCTGGATGCCAAGGGTCATGGAGTCCTG
GAGATGCCCTCAGGCACTGGGAAGACAGTGTCCCTGTTGGCCCTGATCATGGCGTACCAG
CGGGCGTATCCCCTGGAGGTGACTAAACTCATCTACTGCTCGAGGACTGTGCCTGAGATT
GAAAAGGTGATTGAAGAACTTCGAAAGTTACTCAGCTTCTATGAGAAACAGGAGGGCGAG
AAGCTGCCATTTTTGGGGCTGGCTCTGAGCTCCCGGAAGAACCTGTGTATTCATCCCGAG
GTGACGCCCCTGCGCTTTGGGAAGGACGTGGACGGGAAATGCCACAGCCTCACGGCATCG
TACGTGCGGGCACAGTACCAGCGGGACTCCAGCCTGCCCCACTGCCGCTTCTACGAGGAA
TTTGATGTCCACGGGCGCCAGGTGCCCCTCCCCACGGGCATCTACAACCTAGATGACCTG
AAGGCTGTGGGACGGCGCCAGGGCTGGTGCCCGTACTTCCTGGCCCGATACTCAATCCTG
CACGCCAACGTGGTGGTCTACAGCTACCACTACCTGCTGGACCCCAAGATTGCTGACCTG
GTGTCCAAGGAGCTGGCCCGCAAGGCCGTGGTCGTCTTTGATGAGGCCCACAACATCGAC
AACGTCTGCATCGACTCCATGAGCGTCAACCTCACCCGCCGCACCCTGGATCGGTGCCAG
GCCAACCTGGAGACCCTGCAGAAGACGGTGCTCAGAATCAAGGAGACGGACGAGCAGCGA
CTGCGAGAGGAGTACCGCCGCCTGGTGGAGGGGCTGCGGGAGGCCAGCGCTGCCCGGGAG
ACCGATGCCCACCTGGCCAACCCCGTGCTGCCTGACGAAGTGCTAAAGGAGGCGGTGCCT
GGCTCCATCCGCACGGCCGAGCACTTCCTGGGCTTCCTGCGCCGCCTGTTGGAGTACGTC
AAGTGGCGCCTGCGGGTGCAGCATGTGGTCCAGGAGAGCCCGCCCGCCTTCCTCAGTGGC
CTGGCCCAGCGCGTCTGCATCCAGCGCAAGCCCCTCAGGTTCTGCGCCGAGCGCCTCCGC
TCCCTCCTGTACACCTTGGAGATCTCGGACCTCACTGACTTCTCCCCACTCACCCTCCTC
GCTAACTTCGCCACGCTCGTCAGCACCTATGCCAAGGGTTTCACCATCATCATCGAGCCG
TTCGATGACAGGACCCCGACCATTGCCAACCCCATCCTGCACTTCAGCTGCATGGACGCC
TCACTGGCCATCAAACCTGTGTTTGAGCGCTTCCAGTCCGTCATCATCACATCTGGGACA
CTGTCCCCACTGGACATCTACCCCAAGATCCTGGACTTCCACCCTGTCACCATGGCAACC
TTCACCATGACGTTGGCCCGGGTCTGCCTCTGCCCCATGATCATCGGCCGTGGCAATGAC
CAGGTGGCCATCAGCTCCAAGTTTGAGACCCGGGAAGATATTGCGGTGATCCGGAACTAT
GGAAATCTCCTGCTGGAGATGTCTGCCGTGGTCCCTGACGGCATCGTGGCCTTCTTCACC
AGCTACCAATACATGGAGAGCACTGTGGCCTCCTGGTACGAGCAGGGCATCCTGGAGAAC
ATCCAGAGGAACAAGCTGCTCTTCATCGAGACCCAGGATGGGGCTGAGACCAGCGTCGCC
CTAGAGAAGTACCAGGAGGCCTGCGAGAACGGCCGCGGGGCCATCCTGCTCTCGGTGGCC
CGAGGCAAGGTGTCCGAGGGAATCGACTTTGTGCACCACTACGGGCGGGCCGTCATCATG
TTCGGGGTGCCCTACGTGTACACCCAGAGCCGCATTCTCAAGGCACGGCTGGAATACCTT
CGGGACCAGTTCCAGATTCGTGAGAATGACTTTCTCACCTTTGATGCCATGCGCCATGCT
GCCCAGTGTGTGGGTCGGGCCATCAGGGGCAAGACGGACTATGGCCTGATGGTCTTTGCC
GACAAGCGGTTTGCTCGGGCTGACAAGCGGGGGAAGCTACCCCGGTGGATCCAGGAGCAC
CTCACGGACGCCAACCTCAACCTGACCGTCGACGAGGGGGTCCAAGTCGCCAAGTACTTC
CTGAGGCAGATGGCACAGCCCTTCCACCGGGAGGACCAGCTGGGCCTGTCCCTGCTCAGC
CTGGAGCAGCTGGAGTCAGAGGAGACGCTGCGGAGGATCGAGCAGATTGCCCAGCAGCTA
TAG
Enzyme 90 GenBank Gene ID BC147982 Link Image
Enzyme 90 GeneCard ID ERCC2 Link Image
Enzyme 90 GenAtlas ID Not Available
Enzyme 90 HGNC ID Not Available
Enzyme 90 Chromosome Location Chromosome:1
Enzyme 90 Locus 19q13.3
Enzyme 90 SNPs SNPJam Report Link Image
Enzyme 90 General References Not Available
Enzyme 90 Metabolite References Not Available
Enzyme 91 [top]
Enzyme 91 ID 493
Enzyme 91 Name Alkaline phosphatase
Enzyme 91 Synonyms Not Available
Enzyme 91 Gene Name Not Available
Enzyme 91 Protein Sequence >Alkaline phosphatase
MQWACVLLLLGLWLQLSLTFIPAEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYKTIGVSAAARYNQCNTTSGNEVTSVMNRAKKAGKSVGVVTTSRVQHASPAGAYA
HTVNRNWYSDADLPADAQTYGCQDIATQLVNNMDIDVILGGGRMYMFPEGTPDPEYPYDV
NQTGVRKDKRNLVQEWQAKHQGAQYVWNRTELLQAANDPSVTHLMGLFEPADMKYNVQQD
PTKDPTLEEMTEAALQVLSRNPQGFYLFVEGGRIDHGHHEGKAYMALTDTVMFDNAIAKA
NELTSELDTLILATADHSHVFSFGGYTLRGTSIFGLAPSKASDNKSYTSILYGNGPGYVL
GGGLRPDVNDSISEDPSYRQQAAVPLSSESHGGEDVAVFARGPQAHLVHGVQEETFVAHV
MAFAGCVEPYTDCNLPAPSGLSDAAHLAASPPSLALLAGAMLLLLAPALY
Enzyme 91 Number of Residues 530
Enzyme 91 Molecular Weight 57106.0
Enzyme 91 Theoretical pI 5.14
Enzyme 91 GO Classification
Function
Process
Component
Enzyme 91 General Function Inorganic ion transport and metabolism
Enzyme 91 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 91 Pathways Not Available
Enzyme 91 Reactions Not Available
Enzyme 91 Pfam Domain Function
Enzyme 91 Signals
  • None
Enzyme 91 Transmembrane Regions
  • None
Enzyme 91 Essentiality Not Available
Enzyme 91 GenBank ID Protein 3510653 Link Image
Enzyme 91 UniProtKB/Swiss-Prot ID O77579 Link Image
Enzyme 91 UniProtKB/Swiss-Prot Entry Name O77579_BOVIN Link Image
Enzyme 91 PDB ID Not Available
Enzyme 91 Cellular Location Not Available
Enzyme 91 Gene Sequence >1593 bp
ATGCAGTGGGCCTGTGTGCTGCTGCTGCTGGGCCTGTGGCTACAGCTCTCCCTCACCTTC
ATCCCAGCTGAGGAGGAAGACCCCGCCTTCTGGAACCGCCAGGCAGCCCAGGCCCTTGAT
GTAGCCAAGAAGTTGCAGCCGATCCAGACAGCTGCCAAGAATGTCATCCTCTTCTTGGGG
GATGGGATGGGGGTGCCTACGGTGACAGCCACTCGGATCCTAAAGGGGCAGATGAATGGT
AAGCTGGGACCTGAGACACCCCTGGCCATGGACCAGTTCCCATACGTGGCTCTGTCCAAG
ACATACAACGTGGACAGACAGGTGCCAGACAGCGCAGGCACTGCCACTGCCTACCTGTGT
GGGGTCAAGGGCAACTACAAAACCATTGGTGTAAGTGCAGCCGCCCGCTACAACCAGTGC
AACACAACAAGTGGCAATGAGGTCACGTCTGTGATGAACCGGGCCAAGAAAGCAGGAAAG
TCAGTGGGAGTGGTGACCACCTCCAGGGTGCAGCATGCCTCCCCAGCCGGTGCTTATGCA
CACACGGTGAACCGAAACTGGTACTCAGATGCCGACCTGCCTGCCGATGCACAGACGTAT
GGCTGCCAGGACATCGCCACACAACTGGTCAACAACATGGATATTGACGTGATCCTGGGT
GGAGGCCGAATGTACATGTTTCCTGAGGGGACCCCGGATCCTGAATACCCATACGATGTC
AATCAGACTGGAGTCCGGAAGGACAAGCGGAATCTGGTGCAGGAGTGGCAGGCCAAGCAC
CAGGGAGCCCAGTATGTGTGGAACCGCACGGAGCTCCTTCAGGCAGCCAATGACCCCAGT
GTAACACACCTCATGGGCCTCTTTGAGCCGGCAGACATGAAGTATAATGTTCAGCAAGAC
CCCACCAAGGACCCGACCCTGGAGGAGATGACGGAGGCGGCCCTGCAAGTGCTGAGCAGG
AACCCCCAGGGCTTCTACCTCTTCGTGGAGGGAGGCCGCATTGACCACGGTCACCATGAA
GGCAAAGCTTATATGGCACTGACTGATACAGTCATGTTTGACAATGCCATCGCCAAGGCT
AACGAGCTCACTAGCGAACTGGACACGCTGATCCTTGCCACTGCAGACCACTCCCATGTC
TTCTCTTTTGGTGGCTACACACTGCGTGGGACCTCCATTTTCGGTCTGGCCCCCAGCAAG
GCCTCAGACAACAAGTCCTACACCTCCATCCTCTATGGCAATGGCCCTGGCTACGTGCTT
GGTGGGGGCTTAAGGCCCGATGTTAATGACAGCATAAGCGAGGACCCCTCGTACCGGCAG
CAGGCGGCCGTGCCCCTGTCTAGTGAGTCCCACGGGGGCGAGGACGTGGCGGTGTTCGCG
CGAGGCCCGCAGGCGCACCTGGTGCACGGCGTGCAGGAGGAGACCTTCGTGGCGCACGTC
ATGGCCTTTGCGGGCTGCGTGGAGCCCTACACCGACTGCAATCTGCCGGCCCCCTCTGGC
CTCTCCGACGCCGCGCACCTGGCGGCCAGCCCGCCTTCGCTGGCGCTGCTGGCCGGGGCG
ATGCTGCTGCTGCTGGCGCCTGCCTTGTACTGA
Enzyme 91 GenBank Gene ID AF052227 Link Image
Enzyme 91 GeneCard ID Not Available
Enzyme 91 GenAtlas ID Not Available
Enzyme 91 HGNC ID Not Available
Enzyme 91 Chromosome Location Not Available
Enzyme 91 Locus Not Available
Enzyme 91 SNPs SNPJam Report Link Image
Enzyme 91 General References Not Available
Enzyme 91 Metabolite References Not Available
Enzyme 92 [top]
Enzyme 92 ID 494
Enzyme 92 Name Protein phosphatase 1K, mitochondrial
Enzyme 92 Synonyms
  1. Protein phosphatase 2C isoform kappa
  2. PP2C-kappa
Enzyme 92 Gene Name PPM1K
Enzyme 92 Protein Sequence >Protein phosphatase 1K, mitochondrial
MSTAALLTLVRSGGNQVRRRVLLRARGLQDDRWVMPTCHSSTSEPKWSRFDPDGSGRPAT
WDNFGIWDNRLEEPILLPPSIKYGKPIPKVSLQNVGSASQIGKRKENEDRFGFAQLTNEV
LYFAVYDGHGGPAAADFCHTHMEKCILDLLPKEENLETVLTLAFLEIDKTFARHAHLSAD
ATLLTSGTTATVALLRDGIELVIASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKC
GGFVAWNSLGQPHVNGRLAMTRSLGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI
NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNTTAVVVPFGAWGKYKNSEITFS
FSRSFASSGRWA
Enzyme 92 Number of Residues 372
Enzyme 92 Molecular Weight 41150.3
Enzyme 92 Theoretical pI 7.13
Enzyme 92 GO Classification
Function
Process
Component
Enzyme 92 General Function Signal transduction mechanisms
Enzyme 92 Specific Function Regulates the mitochondrial permeability transition pore and is essential for cellular survival and development
Enzyme 92 Pathways Not Available
Enzyme 92 Reactions Not Available
Enzyme 92 Pfam Domain Function
Enzyme 92 Signals
  • None
Enzyme 92 Transmembrane Regions
  • None
Enzyme 92 Essentiality Not Available
Enzyme 92 GenBank ID Protein 84617514 Link Image
Enzyme 92 UniProtKB/Swiss-Prot ID Q2PC20 Link Image
Enzyme 92 UniProtKB/Swiss-Prot Entry Name PPM1K_BOVIN Link Image
Enzyme 92 PDB ID Not Available
Enzyme 92 Cellular Location Not Available
Enzyme 92 Gene Sequence >1119 bp
ATGTCAACAGCTGCCTTACTTACTTTGGTAAGAAGTGGTGGGAACCAGGTGAGGAGGAGA
GTGCTGCTCAGAGCCCGCGGTCTGCAGGATGACAGGTGGGTGATGCCCACGTGCCACAGC
TCCACTTCAGAGCCGAAATGGTCTCGCTTTGATCCTGATGGTAGTGGCCGACCAGCTACC
TGGGATAATTTTGGCATCTGGGATAACCGCCTGGAGGAGCCAATTCTGCTGCCGCCCAGC
ATTAAGTATGGCAAGCCAATTCCCAAAGTCAGCTTGCAGAATGTGGGCAGCGCATCACAG
ATTGGCAAACGGAAAGAGAATGAAGACCGGTTTGGCTTTGCTCAGCTGACCAATGAGGTC
CTGTACTTTGCGGTGTATGATGGCCACGGTGGACCTGCAGCGGCCGATTTCTGTCATACC
CACATGGAGAAATGCATCCTGGATTTGCTTCCTAAGGAGGAGAACTTGGAAACTGTGTTG
ACCTTGGCTTTTCTTGAAATAGATAAAACCTTTGCAAGGCACGCCCACCTATCTGCTGAT
GCAACGCTTCTGACCTCTGGGACTACTGCAACAGTAGCCCTATTGAGAGATGGTATTGAA
CTGGTTATAGCTAGTGTTGGGGACAGCCGAGCTATTTTGTGCAGAAAAGGAAAACCCATG
AAGCTGACCATCGACCACACTCCAGAAAGAAAAGACGAGAAAGAAAGGATTAAGAAATGT
GGGGGGTTTGTAGCTTGGAATAGTTTGGGACAGCCTCACGTGAACGGAAGACTTGCAATG
ACAAGGAGTCTCGGAGATTTGGATCTTAAAACCAGTGGTGTGATAGCAGAACCTGAAACA
AAGAGGATTAAGCTACATCATGCTGATGACAGCTTCCTGGTCCTCACTACAGATGGAATT
AACTTCATGGTGAACAGTCAAGAGATTTGTGACTTTGTCAATCAGTGCCACGATCCCAAT
GAAGCAGCCCATGCAGTGACTGAACAGGCAATACAATATGGTACTGAAGATAACACGACT
GCAGTAGTAGTGCCTTTTGGTGCCTGGGGAAAATACAAGAACTCTGAAATCACCTTCTCA
TTCAGCAGAAGCTTCGCCTCTAGTGGACGATGGGCCTGA
Enzyme 92 GenBank Gene ID AJ871967 Link Image
Enzyme 92 GeneCard ID PPM1K Link Image
Enzyme 92 GenAtlas ID Not Available
Enzyme 92 HGNC ID Not Available
Enzyme 92 Chromosome Location Chromosome:4
Enzyme 92 Locus 4q22.1
Enzyme 92 SNPs SNPJam Report Link Image
Enzyme 92 General References Not Available
Enzyme 92 Metabolite References Not Available
Enzyme 93 [top]
Enzyme 93 ID 495
Enzyme 93 Name Adenylosuccinate synthetase isozyme 1
Enzyme 93 Synonyms
  1. AMPSase 1
  2. AdSS 1
  3. IMP--aspartate ligase 1
Enzyme 93 Gene Name ADSSL1
Enzyme 93 Protein Sequence >Adenylosuccinate synthetase isozyme 1
MSGTRASNDRPPSAGGVKRGRLQHEAATTGSRVTVVLGAQWGDEGKGKVVDLLATDADVV
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINPKAVSFIGNGVVVHLPGLFEEAEKNEKKG
LKDWEKRLVISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTRKGIGPAYSSKAARTGL
RICDLLSDFDEFSSRFKNLARQHQSMFPSLEVDVEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGEVYGVVKA
YTTRVGIGAFPTEQINEIGDLLQSRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDALDEIKVGVAYKLGGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWE
DLPPQAQSYIRFVENHVGVAVKWVGVGKSRDSMIQLF
Enzyme 93 Number of Residues 457
Enzyme 93 Molecular Weight 50134.0
Enzyme 93 Theoretical pI 8.65
Enzyme 93 GO Classification
Function
Process
Component
Enzyme 93 General Function Nucleotide transport and metabolism
Enzyme 93 Specific Function Plays an important role in the de novo pathway of purine nucleotide biosynthesis
Enzyme 93 Pathways
  • Purine metabolism
  • AMP biosynthesis via de novo pathway
  • AMP from IMP:step 1/2
Enzyme 93 Reactions Not Available
Enzyme 93 Pfam Domain Function
Enzyme 93 Signals
  • None
Enzyme 93 Transmembrane Regions
  • None
Enzyme 93 Essentiality Not Available
Enzyme 93 GenBank ID Protein 148743868 Link Image
Enzyme 93 UniProtKB/Swiss-Prot ID A5PJR4 Link Image
Enzyme 93 UniProtKB/Swiss-Prot Entry Name PURA1_BOVIN Link Image
Enzyme 93 PDB ID 1MF1 Link Image
Enzyme 93 PDB File Show
Enzyme 93 3D Structure
Enzyme 93 Cellular Location Not Available
Enzyme 93 Gene Sequence >1374 bp
ATGTCCGGGACCCGAGCCTCTAACGATCGGCCCCCCAGCGCGGGCGGCGTCAAGCGGGGG
CGGCTACAGCACGAGGCGGCGACCACCGGCTCCCGGGTGACCGTGGTGCTGGGCGCGCAG
TGGGGGGACGAGGGCAAAGGCAAGGTGGTGGACCTGCTGGCCACGGACGCCGACGTCGTC
AGCCGCTGCCAGGGAGGCAACAATGCTGGCCACACCGTGGTGGTGGATGGCAAGGAGTAC
GACTTCCACCTGCTGCCCAGTGGCATCATCAACCCCAAGGCCGTGTCCTTCATCGGCAAT
GGAGTGGTCGTCCACTTGCCGGGCTTGTTTGAAGAGGCAGAGAAGAACGAGAAGAAAGGC
CTGAAGGACTGGGAGAAGAGGCTCGTCATCTCTGACCGGGCCCACCTTGTGTTTGACTTT
CACCAGGCGGTGGACGGGCTCCAGGAGGTGCAGCGGCAGGCCCAGGAGGGCAAGAACATC
GGCACGACCCGGAAGGGGATCGGGCCGGCCTACTCGTCCAAGGCCGCCCGCACCGGCCTC
CGCATCTGCGACCTCCTGTCTGACTTCGACGAGTTCTCCTCCCGATTCAAGAACCTGGCA
CGCCAGCACCAGTCCATGTTCCCCAGTTTGGAAGTGGACGTTGAAGGTCAACTCAAAAGG
CTCAAGGGCTTCGCCGAGCGGATCCGCCCCATGGTCCGAGATGGCGTTTATTTCATGTAT
GAGGCGCTCCATGGCCCCCCTAAGAAGATCCTCGTGGAGGGTGCCAACGCAGCCCTCCTT
GACATTGACTTCGGGACCTACCCCTTCGTGACGTCCTCCAACTGCACGGTGGGCGGCGTG
TGCACCGGCCTGGGCATCCCGCCCCAGAACATAGGCGAGGTCTACGGTGTGGTCAAGGCC
TACACCACACGCGTGGGCATCGGCGCCTTCCCCACCGAGCAGATCAACGAGATCGGGGAC
CTGCTGCAGAGCCGCGGCCACGAGTGGGGCGTGACCACGGGCAGGAAGCGGCGCTGCGGC
TGGCTGGATCTGATGATCCTGAGATATGCCCACATGGTCAACGGATTCACCGCGCTGGCC
TTGACGAAACTGGACATCCTGGACGCCCTGGACGAGATCAAGGTCGGCGTGGCGTACAAG
CTTGGCGGGAAGCGGATCCCCTACTTCCCAGCCAACCAGGAGATCCTGCAGAAGGTGGAG
GTGGAATACGAGACGCTGCCAGGGTGGAAGGCGGACACCACGGGCGCCCGGAAGTGGGAG
GACCTCCCCCCGCAGGCCCAGAGCTACATCCGGTTCGTGGAGAACCACGTCGGCGTGGCA
GTGAAATGGGTTGGTGTCGGCAAGTCCAGAGATTCGATGATCCAGCTGTTTTAG
Enzyme 93 GenBank Gene ID BC142211 Link Image
Enzyme 93 GeneCard ID ADSSL1 Link Image
Enzyme 93 GenAtlas ID Not Available
Enzyme 93 HGNC ID Not Available
Enzyme 93 Chromosome Location Chromosome:1
Enzyme 93 Locus 14q32.33
Enzyme 93 SNPs SNPJam Report Link Image
Enzyme 93 General References Not Available
Enzyme 93 Metabolite References Not Available
Enzyme 94 [top]
Enzyme 94 ID 496
Enzyme 94 Name Glycerophosphodiester phosphodiesterase 1
Enzyme 94 Synonyms
  1. Membrane interacting protein of RGS16
Enzyme 94 Gene Name GDE1
Enzyme 94 Protein Sequence >Glycerophosphodiester phosphodiesterase 1
MWLWEEQGGLMGPFSFLLLVLLLLTRSPFNACLFTGSLYLLLRLFSFEPVPSRRAMQVLK
PRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGAAGVELDLEFTADGIPVLMHDSTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREAVAECLNHNLTIFFDVKGHAY
KATDALKKVYMEFPKLYNNSIVCSFLPEVIYKMRQTDQNVVTALIHRPWSLSHTGDGKPR
FESFWKQSMFVALDILLDWSMHNILWYLCGVSAFLAQKDFISPDYVKKWSAKGIQVVAWT
VNTFDEKSYYESHLGSSYITDSMLEDCTPEF
Enzyme 94 Number of Residues 331
Enzyme 94 Molecular Weight 37652.9
Enzyme 94 Theoretical pI 6.85
Enzyme 94 GO Classification
Function
Process
Component
Enzyme 94 General Function Energy production and conversion
Enzyme 94 Specific Function Has glycerophosphoinositol phosphodiesterase activity. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways
Enzyme 94 Pathways Not Available
Enzyme 94 Reactions Not Available
Enzyme 94 Pfam Domain Function
Enzyme 94 Signals
  • None
Enzyme 94 Transmembrane Regions
  • 3-23 255-275
Enzyme 94 Essentiality Not Available
Enzyme 94 GenBank ID Protein 74354565 Link Image
Enzyme 94 UniProtKB/Swiss-Prot ID Q3T0T0 Link Image
Enzyme 94 UniProtKB/Swiss-Prot Entry Name GDE1_BOVIN Link Image
Enzyme 94 PDB ID Not Available
Enzyme 94 Cellular Location Not Available
Enzyme 94 Gene Sequence >996 bp
ATGTGGCTGTGGGAGGAACAGGGGGGCCTCATGGGCCCCTTCTCCTTCCTGCTGCTGGTG
CTGCTGCTGCTAACGCGCAGTCCCTTCAATGCCTGCCTCTTCACTGGCAGCCTCTACCTC
CTGTTGCGCCTCTTCAGCTTTGAGCCAGTGCCCTCCCGCAGGGCTATGCAGGTGCTCAAG
CCCCGGGACCGCGTTTCCGCTATCGCCCACCGGGGAGGCAGCCACGACGCTCCCGAGAAC
ACGCTGGCGGCCATTCGGCAGGCAGCTAAGAACGGAGCAGCAGGCGTGGAACTGGACCTT
GAGTTTACTGCTGACGGGATTCCTGTCTTAATGCACGATAGCACAGTAGATAGGACGACT
GACGGCACCGGTCGATTGTGTGATTTGACATTTGAACAAATTAGGAAGCTTAATCCTGCA
GCAAATCACAGATTAAGGAATGATTTCCCTAATGAAAAGATCCCTACCCTAAGAGAAGCC
GTTGCAGAGTGCCTAAACCATAACCTCACAATCTTCTTTGATGTCAAGGGCCATGCATAT
AAGGCTACTGATGCTCTAAAAAAAGTATATATGGAATTTCCTAAACTATACAATAATAGT
ATCGTCTGCTCTTTCTTGCCAGAAGTTATCTATAAGATGAGACAAACAGATCAGAATGTA
GTAACGGCTTTAATTCATAGACCCTGGAGCCTTAGCCACACAGGAGATGGGAAACCACGC
TTTGAATCTTTCTGGAAACAGTCCATGTTTGTGGCCTTGGACATTTTGCTCGATTGGAGT
ATGCATAATATCTTGTGGTACCTGTGTGGAGTTTCAGCTTTCCTCGCACAAAAGGACTTT
ATATCCCCGGACTATGTGAAGAAGTGGTCAGCTAAAGGCATTCAGGTTGTTGCTTGGACT
GTTAATACTTTTGATGAAAAAAGTTACTACGAATCTCATCTTGGTTCCAGCTATATCACT
GACAGCATGTTGGAAGACTGCACACCTGAATTCTAG
Enzyme 94 GenBank Gene ID BC102273 Link Image
Enzyme 94 GeneCard ID GDE1 Link Image
Enzyme 94 GenAtlas ID Not Available
Enzyme 94 HGNC ID Not Available
Enzyme 94 Chromosome Location Chromosome:1
Enzyme 94 Locus 16p12-p11.2
Enzyme 94 SNPs SNPJam Report Link Image
Enzyme 94 General References Not Available
Enzyme 94 Metabolite References Not Available
Enzyme 95 [top]
Enzyme 95 ID 497
Enzyme 95 Name Pyruvate kinase
Enzyme 95 Synonyms Not Available
Enzyme 95 Gene Name PKM2
Enzyme 95 Protein Sequence >Pyruvate kinase
MSKHHSDAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRAVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKIYVDDGL
ISLLVKQKGPDFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLSPITSDPTEAAAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQE
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Enzyme 95 Number of Residues 531
Enzyme 95 Molecular Weight 57948.4
Enzyme 95 Theoretical pI 7.95
Enzyme 95 GO Classification
Function
Process
Component
Enzyme 95 General Function Carbohydrate transport and metabolism
Enzyme 95 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 95 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 95 Reactions Not Available
Enzyme 95 Pfam Domain Function
Enzyme 95 Signals
  • None
Enzyme 95 Transmembrane Regions
  • None
Enzyme 95 Essentiality Not Available
Enzyme 95 GenBank ID Protein 146231736 Link Image
Enzyme 95 UniProtKB/Swiss-Prot ID A5D984 Link Image
Enzyme 95 UniProtKB/Swiss-Prot Entry Name A5D984_BOVIN Link Image
Enzyme 95 PDB ID 1F3X Link Image
Enzyme 95 PDB File Show
Enzyme 95 3D Structure
Enzyme 95 Cellular Location Not Available
Enzyme 95 Gene Sequence >1596 bp
ATGTCGAAGCACCACAGCGACGCCGGGACGGCCTTCATTCAGACTCAGCAGCTGCACGCA
GCCATGGCCGACACATTCCTGGAGCACATGTGCCGCCTGGACATCGACTCACCGCCCATT
ACGGCCCGAAACACCGGCATCATCTGTACCATCGGCCCAGCTTCACGAGCAGTGGAGACA
TTGAAGGAGATGATTAAGTCTGGAATGAATGTGGCTCGTTTGAACTTCTCTCATGGAACC
CACGAGTACCACGCAGAGACCATCAAGAATGTACGTGAAGCCACGGAGAGCTTTGCTTCA
GACCCCATTCTCTATCGGCCAGTGGCAGTGGCCCTGGACACTAAAGGACCTGAGATCCGA
ACTGGGCTCATCAAGGGCAGCGGCACCGCTGAGGTGGAGCTGAAGAAGGGAGCCACACTG
AAGATCACCCTGGACAATGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGAC
TACAAGAACATTTGCAAGGTGGTGGATGTGGGCAGCAAGATCTACGTGGATGATGGGCTT
ATTTCTCTGCTGGTGAAGCAGAAAGGTCCTGACTTCCTGGTGACGGAGGTGGAGAACGGT
GGCTCCTTGGGCAGCAAGAAGGGTGTGAACCTCCCTGGGGCTGCCGTGGACCTGCCTGCT
GTGTCAGAAAAGGACATCCAGGATCTAAAGTTTGGGGTGGAGCAGAACGTGGATATGGTG
TTTGCGTCTTTCATCCGCAAGGCTTCTGATGTCCATGAAGTCAGGAAGGTCCTGGGAGAG
AAAGGAAAGAACATCAAGATAATCAGCAAAATCGAGAATCATGAGGGAGTTCGGAGGTTT
GACGAGATCCTGGAAGCCAGTGATGGGATCATGGTGGCTCGTGGTGATCTGGGCATTGAG
ATCCCTGCAGAGAAGGTCTTCCTTGCCCAGAAGATGATGATTGGTCGGTGCAACCGAGCT
GGGAAGCCCGTCATCTGTGCCACACAGATGCTGGAGAGCATGATCAAGAAGCCTCGCCCT
ACCCGGGCGGAGGGCAGTGACGTGGCCAATGCCGTCTTGGATGGAGCCGACTGCATCATG
CTGTCCGGAGAGACGGCCAAAGGGGACTACCCCCTGGAAGCTGTCCGCATGCAGCACCTG
ATTGCCCGTGAGGCAGAGGCTGCCATCTACCATTTGCAATTGTTCGAGGAGCTCCGTCGC
CTGTCACCCATTACCAGCGACCCCACCGAAGCTGCCGCTGTGGGGGCCGTGGAGGCGTCC
TTCAAGTGCTGCAGTGGGGCCATAATCGTCCTCACCAAGTCTGGCAGGTCTGCACATCAG
GTGGCCAGATACCGCCCCCGGGCCCCCATCATTGCTGTGACTCGGAATCACCAGACAGCT
CGCCAGGCCCACCTATACCGCGGCATCTTCCCTGTGGTGTGTAAGGACCCAGTGCAGGAG
GCCTGGGCTGAGGACGTGGATCTCCGGGTGAACTTGGCCATGAATGTCGGAAAGGCCCGA
GGCTTCTTCAAGAAGGGAGACGTGGTCATTGTGCTGACCGGGTGGCGCCCTGGTTCCGGC
TTCACCAACACCATGCGTGTAGTTCCTGTGCCATGA
Enzyme 95 GenBank Gene ID BT030503 Link Image
Enzyme 95 GeneCard ID PKM2 Link Image
Enzyme 95 GenAtlas ID Not Available
Enzyme 95 HGNC ID Not Available
Enzyme 95 Chromosome Location Chromosome:1
Enzyme 95 Locus 15q22
Enzyme 95 SNPs SNPJam Report Link Image
Enzyme 95 General References
  1. [PubMed Link Image]
Enzyme 95 Metabolite References Not Available
Enzyme 96 [top]
Enzyme 96 ID 498
Enzyme 96 Name [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
Enzyme 96 Synonyms
  1. PDP 1
  2. Pyruvate dehydrogenase phosphatase, catalytic subunit 1
  3. PDPC 1
  4. Protein phosphatase 2C
Enzyme 96 Gene Name PDP1
Enzyme 96 Protein Sequence >[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSPPYIPQSRPRYTPHPAYATFYRPKE
SWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSVLGFDSNQLPAN
APIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAV
ESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAF
KRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVDGVDLHVANTGDSRAMLGVQE
EDGSWSAVTLSNDHNAQNEREVERLKLEHPKNEAKSVVKQDRLLGLLMPFRAFGDVKFKW
SIDLQKRVIESGPDQLNDNEYTKFIPPNYYTPPYLTAEPEVTYHRLRPQDKFLVLATDGL
WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRAKMSSVFEDQNAAT
HLIRHAVGNNEFGAVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQEQ
Enzyme 96 Number of Residues 538
Enzyme 96 Molecular Weight 61183.8
Enzyme 96 Theoretical pI 6.63
Enzyme 96 GO Classification
Function
Process
Component
Enzyme 96 General Function Signal transduction mechanisms
Enzyme 96 Specific Function Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex
Enzyme 96 Pathways Not Available
Enzyme 96 Reactions Not Available
Enzyme 96 Pfam Domain Function
Enzyme 96 Signals
  • None
Enzyme 96 Transmembrane Regions
  • None
Enzyme 96 Essentiality Not Available
Enzyme 96 GenBank ID Protein 414797 Link Image
Enzyme 96 UniProtKB/Swiss-Prot ID P35816 Link Image
Enzyme 96 UniProtKB/Swiss-Prot Entry Name PDP1_BOVIN Link Image
Enzyme 96 PDB ID Not Available
Enzyme 96 Cellular Location Not Available
Enzyme 96 Gene Sequence >1779 bp
ATGTGGCGTACGGAAGACCCACCCCAGCGCCGAACCGCCGTCGGAATCCTCCTCCGCCCG
CCCGAAGTTGTGAGGCGGGCGGCCGGCACGCGTGAGGAGACGAGCCTGGTGGCGCCAGGA
ATCCCGGTCAGAAGTTCCAGCCTGCCACTGTTCTCTGATGCTATGCCAGCACCAACTCAA
CTGTTTTTCCCTCTGATTCGTAACTGTGAACTGAGCAGAATCTATGGCACTGCATGTTAC
TGCCACCACAAACATCTCTGCTGCTCACCCCCTTATATTCCGCAGAGTCGCCCGAGATAC
ACACCCCATCCGGCGTATGCTACCTTTTACAGGCCAAAGGAGAGCTGGTGGCAGTACACC
CAAGGAAGGAGATACGCTTCCACACCGCAGAAGTTTTACCTCACACCTCCCCAAGTCAAT
AGCATCCTGAAAGCTAATGAGTACAGTTTCAAAGTGCCAGAATTTGATGGCAAAAATGTA
AGTTCTGTCCTTGGATTTGACAGCAATCAGCTGCCGGCAAACGCACCCATTGAGGACCGG
AGGAGTGCAGCAACCTGCTTGCAGACCAGAGGGATGCTTTTGGGGGTTTTTGATGGCCAC
GCAGGCTGTGCTTGTTCCCAGGCAGTTAGTGAAAGACTCTTTTATTATATTGCTGTCTCT
TTGTTACCCCACGAGACTTTGCTGGAGATCGAAAATGCTGTAGAGAGTGGTCGAGCCCTG
CTGCCCATTCTCCAGTGGCACAAGCACCCCAACGATTACTTCAGTAAGGAGGCATCCAAG
TTATATTTCAACAGCTTGAGGACTTACTGGCAAGAGCTTATTGACCTCAACACTGGGGAG
TCGACTGATATTGATGTTAAGGAGGCTTTGATTAATGCTTTCAAGAGGCTTGATAATGAC
ATCTCCTTGGAGGCTCAAGTTGGTGATCCCAATTCTTTCCTCAACTACCTAGTGCTTCGA
GTGGCATTTTCTGGGGCCACAGCTTGCGTGGCCCACGTGGATGGCGTTGACCTTCACGTG
GCCAACACTGGCGATAGCAGAGCCATGCTGGGAGTGCAGGAAGAGGACGGCTCTTGGTCA
GCAGTCACGCTGTCTAATGACCACAACGCTCAGAATGAGAGAGAAGTGGAACGGCTGAAA
CTGGAGCACCCAAAGAACGAGGCCAAGAGTGTGGTGAAACAGGATCGGCTGCTTGGCTTG
CTGATGCCTTTTCGGGCTTTTGGAGACGTCAAGTTCAAATGGAGCATTGACCTTCAGAAG
AGAGTGATAGAATCTGGCCCAGACCAGTTGAATGACAATGAATACACCAAGTTCATCCCT
CCTAATTATTACACACCTCCTTATCTCACTGCTGAACCAGAAGTAACTTACCACCGATTA
AGGCCACAGGATAAATTTCTGGTACTGGCGACTGATGGGCTGTGGGAGACAATGCACAGG
CAGGATGTGGTTAGGATTGTGGGTGAGTACCTAACAGGCATGCACCACCAGCAGCCAATA
GCCGTTGGTGGCTATAAGGTGACTCTGGGGCAGATGCATGGCCTTTTAACAGAACGGAGA
GCTAAGATGTCATCGGTGTTTGAGGACCAGAATGCAGCAACCCACCTTATTCGCCACGCT
GTGGGCAACAATGAGTTTGGGGCTGTTGATCATGAGCGCCTCTCCAAAATGCTTAGTCTT
CCTGAAGAGCTTGCTCGGATGTACAGAGATGACATTACAATCATTGTAGTTCAGTTCAAT
TCTCATGTTGTAGGGGCATATCAAAACCAGGAACAGTGA
Enzyme 96 GenBank Gene ID L18966 Link Image
Enzyme 96 GeneCard ID PDP1 Link Image
Enzyme 96 GenAtlas ID Not Available
Enzyme 96 HGNC ID Not Available
Enzyme 96 Chromosome Location Not Available
Enzyme 96 Locus Not Available
Enzyme 96 SNPs SNPJam Report Link Image
Enzyme 96 General References
  1. [PubMed Link Image]
Enzyme 96 Metabolite References Not Available
Enzyme 97 [top]
Enzyme 97 ID 499
Enzyme 97 Name Cytosol aminopeptidase
Enzyme 97 Synonyms
  1. Leucine aminopeptidase
  2. Leucyl aminopeptidase
  3. Leucine aminopeptidase 3
  4. LAP
  5. Proline aminopeptidase
  6. Prolyl aminopeptidase
  7. Peptidase S
Enzyme 97 Gene Name LAP3
Enzyme 97 Protein Sequence >Cytosol aminopeptidase
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
Enzyme 97 Number of Residues 519
Enzyme 97 Molecular Weight 56288.9
Enzyme 97 Theoretical pI 6.44
Enzyme 97 GO Classification
Function
Process
Component
Enzyme 97 General Function Amino acid transport and metabolism
Enzyme 97 Specific Function Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides
Enzyme 97 Pathways Not Available
Enzyme 97 Reactions Not Available
Enzyme 97 Pfam Domain Function
Enzyme 97 Signals
  • None
Enzyme 97 Transmembrane Regions
  • None
Enzyme 97 Essentiality Not Available
Enzyme 97 GenBank ID Protein 410689 Link Image
Enzyme 97 UniProtKB/Swiss-Prot ID P00727 Link Image
Enzyme 97 UniProtKB/Swiss-Prot Entry Name AMPL_BOVIN Link Image
Enzyme 97 PDB ID 1LAP Link Image
Enzyme 97 PDB File Show
Enzyme 97 3D Structure
Enzyme 97 Cellular Location Not Available
Enzyme 97 Gene Sequence >1542 bp
ATGCCACCACCTGGATCCCCTTGGCCTTCAGAGCGTCAGCCTGCTCCACGAACCCTGGCA
GGTGGGTGCTCAGACATGACGAAGGGCCTTGTTTTAGGAATCTATAGCAAAGAAAAAGAA
GAAGATGAGCCTCAGTTTACAAGTGCAGGAGAGAATTTTAATAAATTGGTGTCTGGAAAG
CTGAGAGAAATTTTGAACATATCTGGACCATCCCTGAAGGCAGGCAAAACCCGAACCTTT
TATGGTCTACATGAGGACTTCCCTAGCGTGGTGGTGGTTGGCCTTGGCAAAAAGACGGCT
GGAATTGATGAACAGGAGAACTGGCATGAAGGCAAAGAAAACATCAGAGCTGCTGTTGCA
GCGGGGTGCAGACAGATTCAGGACCTGGAGATCCCGTCGGTGGAGGTGGACCCCTGCGGA
GATGCCCAGGCGGCTGCGGAAGGAGCGGTGCTCGGGCTCTATGAATATGATGACCTGAAG
CAGAAAAGGAAGGTGGTGGTGTCGGCCAAACTCCATGGAAGTGAGGACCAGGAGGCCTGG
CAGAGAGGCGTCCTCTTTGCTTCTGGGCAGAACCTGGCACGCCGCTTGATGGAGACGCCT
GCCAACGAGATGACGCCAACCAAATTTGCCGAAATTGTTGAGGAGAATCTCAAAAGTGCT
AGTATTAAAACAGACGTCTTCATCAGACCCAAGTCTTGGATTGAGGAACAGGAAATGGGA
TCATTTCTAAGTGTGGCCAAAGGGTCCGAAGAGCCTCCAGTCTTCCTGGAAATTCACTAC
AAAGGCAGTCCCAATGCAAGTGAACCTCCCTTGGTGTTTGTTGGGAAGGGGATTACCTTT
GACAGTGGTGGCATCTCCATCAAGGCTGCTGCAAACATGGACCTCATGAGGGCCGACATG
GGAGGAGCTGCCACTATCTGTTCAGCCATCGTGTCTGCTGCCAAGCTCGACCTGCCCATC
AACATCGTAGGTTTGGCTCCTCTTTGTGAAAATATGCCCAGTGGGAAGGCCAACAAGCCT
GGGGATGTTGTTAGAGCCAGGAACGGGAAGACCATACAGGTGGATAACACCGATGCTGAG
GGGAGACTTATCCTGGCCGATGCGCTCTGCTACGCTCACACTTTTAACCCAAAGGTCATC
ATTAATGCCGCCACCCTGACAGGTGCCATGGACATAGCTTTGGGATCTGGTGCCACTGGG
GTCTTTACCAACTCTTCTTGGCTGTGGAACAAACTATTTGAGGCCAGCATTGAAACAGGA
GACCGTGTCTGGAGGATGCCTCTCTTTGAACATTACACAAGACAGGTTATAGATTGCCAA
CTTGCTGATGTTAATAACATTGGAAAATATAGATCTGCAGGAGCGTGTACAGCTGCAGCA
TTCCTGAAAGAATTTGTGACTCATCCTAAGTGGGCACATTTAGACATAGCAGGTGTGATG
ACCAACAAAGATGAGGTTCCTTATCTTCGCAAAGGCATGGCTGGGAGGCCCACGAGGACC
CTGATTGAATTCCTGTTTCGGTTCAGTCAAGACAGTGCTTAG
Enzyme 97 GenBank Gene ID S65367 Link Image
Enzyme 97 GeneCard ID LAP3 Link Image
Enzyme 97 GenAtlas ID Not Available
Enzyme 97 HGNC ID Not Available
Enzyme 97 Chromosome Location Chromosome:4
Enzyme 97 Locus 4p15.32
Enzyme 97 SNPs SNPJam Report Link Image
Enzyme 97 General References
  1. [PubMed Link Image]
Enzyme 97 Metabolite References Not Available
Enzyme 98 [top]
Enzyme 98 ID 500
Enzyme 98 Name Diphosphoinositol polyphosphate phosphohydrolase 1
Enzyme 98 Synonyms
  1. DIPP-1
  2. Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1
  3. Nucleoside diphosphate-linked moiety X motif 3
  4. Nudix motif 3
Enzyme 98 Gene Name NUDT3
Enzyme 98 Protein Sequence >Diphosphoinositol polyphosphate phosphohydrolase 1
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPG
TAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVSIGRKREWF
KIEDAINVLQCHKPVQASYFETLRQGYSANNGTPLVAPTYSVSAQSSMPGIR
Enzyme 98 Number of Residues 172
Enzyme 98 Molecular Weight 19361.7
Enzyme 98 Theoretical pI 5.77
Enzyme 98 GO Classification
Function
Process
Component
Enzyme 98 General Function Replication, recombination and repair
Enzyme 98 Specific Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Also able to catalyzes the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate
Enzyme 98 Pathways Not Available
Enzyme 98 Reactions Not Available
Enzyme 98 Pfam Domain Function
Enzyme 98 Signals
  • None
Enzyme 98 Transmembrane Regions
  • None
Enzyme 98 Essentiality Not Available
Enzyme 98 GenBank ID Protein 126010707 Link Image
Enzyme 98 UniProtKB/Swiss-Prot ID A2VE79 Link Image
Enzyme 98 UniProtKB/Swiss-Prot Entry Name NUDT3_BOVIN Link Image
Enzyme 98 PDB ID Not Available
Enzyme 98 Cellular Location Not Available
Enzyme 98 Gene Sequence >519 bp
ATGATGAAGCTCAAGTCGAACCAGACCCGCACCTATGACGGCGACGGCTACAAGAAGCGG
GCCGCGTGCCTGTGTTTCCGCAGCGAGAGTGAGGAGGAGGTGCTACTTGTGAGCAGCAGT
CGTCATCCAGACCGGTGGATCGTCCCTGGAGGGGGCATGGAGCCCGAGGAGGAGCCGGGC
ACCGCCGCAGTCCGTGAAGTCTGTGAGGAGGCTGGAGTAAAAGGGACATTGGGAAGATTA
GTTGGAATTTTTGAGAACCAGGAGAGGAAGCATAGAACGTATGTCTATGTGCTCATTGTC
ACAGAAGTGCTGGAAGACTGGGAAGACTCGGTCAGCATCGGAAGGAAGCGGGAATGGTTT
AAAATAGAAGATGCCATAAACGTGCTGCAGTGTCACAAACCGGTGCAGGCCTCGTATTTT
GAAACGTTGAGACAAGGCTACTCAGCCAACAACGGCACCCCGCTCGTGGCCCCCACATAC
TCAGTATCTGCTCAGAGCTCGATGCCAGGCATCAGATGA
Enzyme 98 GenBank Gene ID BC133614 Link Image
Enzyme 98 GeneCard ID NUDT3 Link Image
Enzyme 98 GenAtlas ID Not Available
Enzyme 98 HGNC ID Not Available
Enzyme 98 Chromosome Location Chromosome:6
Enzyme 98 Locus 6p21.2
Enzyme 98 SNPs SNPJam Report Link Image
Enzyme 98 General References Not Available
Enzyme 98 Metabolite References Not Available
Enzyme 99 [top]
Enzyme 99 ID 501
Enzyme 99 Name Thioredoxin reductase 2, mitochondrial
Enzyme 99 Synonyms
  1. Thioredoxin reductase TR3
Enzyme 99 Gene Name TXNRD2
Enzyme 99 Protein Sequence >Thioredoxin reductase 2, mitochondrial
MAALRGAAARFRGRAPGGARGAAGRQCYDLLVIGGGSGGLACAKEAAQLGKKVAVLDYVE
PSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAPHYGWGVAQAPHSWATLADAVQ
NHVKSLNWGHRIQLQDRKVKYFNVKASFVDTHTVCGVSKGGEETLLSAEHIVIATGGRPR
YPTHIEGALEYGITSDDLFWLKESPGKTLVVGASYVALECAGLLTGLGLDTTVMIRSVPL
RAFDQQMASLVTEHMAGHGTRILRGCAPEKVEKLPGQQLRVTWVDLTSDRKDAGTFDTVL
WAIGRVPETASLNLEKAGVHTNPVTGKILVDAQETTSVPHIYAIGDVAEGRPELTPTAIM
AGRLLAQRLSGRTSDLMDYSSVPTTVFTPLEYGCVGLSEEAAVARHGEEHVEVYHAFYKP
LEFTVPQRDASQCYIKMVCLREPPQLVLGLHFLGPNAGEVIQGFALGIKCGASYQQLMRT
VGIHPTCAEEVAKLRISKRSGLDPTVTGCUG
Enzyme 99 Number of Residues 511
Enzyme 99 Molecular Weight 54669.3
Enzyme 99 Theoretical pI 8.01
Enzyme 99 GO Classification
Function
Process
Component
Enzyme 99 General Function Energy production and conversion
Enzyme 99 Specific Function Maintains thioredoxin in a reduced state. Implicated in the defenses against oxidative stress. May play a role in redox- regulated cell signaling
Enzyme 99 Pathways Not Available
Enzyme 99 Reactions Not Available
Enzyme 99 Pfam Domain Function
Enzyme 99 Signals
  • None
Enzyme 99 Transmembrane Regions
  • None
Enzyme 99 Essentiality Not Available
Enzyme 99 GenBank ID Protein 5360756 Link Image
Enzyme 99 UniProtKB/Swiss-Prot ID Q9N2I8 Link Image
Enzyme 99 UniProtKB/Swiss-Prot Entry Name TRXR2_BOVIN Link Image
Enzyme 99 PDB ID Not Available
Enzyme 99 Cellular Location Not Available
Enzyme 99 Gene Sequence >1536 bp
ATGGCGGCGCTGCGCGGAGCGGCCGCGCGTTTCCGGGGCCGCGCGCCGGGAGGGGCGCGG
GGCGCCGCAGGCCGGCAGTGCTACGACCTCCTGGTGATCGGCGGCGGATCCGGCGGCCTG
GCCTGCGCCAAGGAAGCCGCCCAGCTGGGGAAGAAGGTGGCCGTGCTGGACTACGTGGAG
CCTTCCCCCCAAGGCACCAGGTGGGGCCTTGGCGGCACCTGCGTGAACGTCGGCTGCATC
CCCAAGAAACTGATGCACCAGGCGGCCCTGCTGGGGGGCATGATCCGCGACGCTCCCCAC
TATGGCTGGGGCGTGGCCCAGGCCCCGCACAGCTGGGCGACGCTGGCGGACGCTGTTCAG
AACCACGTGAAGTCCCTGAACTGGGGCCACCGCATCCAGCTGCAGGACAGGAAAGTCAAG
TATTTTAACGTCAAGGCCAGCTTTGTCGACACGCACACAGTTTGCGGTGTCTCCAAAGGC
GGGGAGGAGACTCTGCTTTCGGCCGAGCACATTGTCATCGCCACCGGAGGTCGGCCGCGG
TACCCCACGCACATCGAAGGTGCCTTGGAATATGGGATCACGAGTGATGACCTCTTCTGG
CTGAAGGAATCCCCTGGGAAAACGTTGGTGGTCGGGGCCAGCTACGTAGCCCTGGAGTGC
GCGGGCCTCCTCACCGGGCTCGGCTTGGACACCACCGTCATGATACGCAGCGTGCCCCTC
CGGGCCTTCGACCAGCAAATGGCTTCGCTGGTCACCGAGCACATGGCTGGCCACGGCACC
CGGATCCTACGGGGCTGCGCCCCCGAGAAGGTAGAGAAACTCCCAGGCCAGCAGCTCCGC
GTCACCTGGGTGGACCTCACCTCGGACCGGAAGGACGCGGGCACCTTTGACACGGTGCTC
TGGGCCATAGGCCGAGTTCCAGAAACCGCAAGTCTGAATTTGGAAAAGGCTGGTGTGCAT
ACGAACCCCGTCACTGGGAAGATCCTCGTTGATGCCCAGGAAACCACCTCCGTCCCCCAC
ATCTATGCCATCGGTGATGTGGCAGAGGGGCGGCCGGAGCTGACGCCCACGGCCATCATG
GCCGGGCGGCTCCTGGCCCAGCGGCTGAGCGGCCGGACCTCAGACCTGATGGACTACAGC
AGCGTCCCCACGACTGTCTTCACCCCGCTGGAGTACGGCTGCGTGGGGCTGTCAGAGGAG
GCAGCCGTGGCTCGCCATGGAGAAGAGCACGTGGAGGTTTACCACGCGTTCTATAAACCA
CTGGAGTTCACTGTCCCCCAGCGGGATGCATCTCAGTGCTACATAAAGATGGTGTGTCTG
CGGGAGCCCCCACAGCTGGTGCTGGGCCTGCACTTCCTCGGCCCCAACGCAGGCGAAGTT
ATTCAGGGATTTGCCCTGGGGATCAAGTGTGGGGCCTCCTACCAGCAGCTGATGCGGACA
GTGGGCATCCACCCCACCTGTGCGGAGGAGGTGGCCAAGCTCCGCATCTCCAAGCGCTCT
GGCCTGGACCCCACAGTAACCGGCTGCTGAGGCTAG
Enzyme 99 GenBank Gene ID AB022283 Link Image
Enzyme 99 GeneCard ID TXNRD2 Link Image
Enzyme 99 GenAtlas ID Not Available
Enzyme 99 HGNC ID Not Available
Enzyme 99 Chromosome Location Chromosome:2
Enzyme 99 Locus 22q11.21
Enzyme 99 SNPs SNPJam Report Link Image
Enzyme 99 General References
  1. [PubMed Link Image]
Enzyme 99 Metabolite References Not Available
Enzyme 100 [top]
Enzyme 100 ID 502
Enzyme 100 Name TGF-beta receptor type-1
Enzyme 100 Synonyms
  1. Transforming growth factor-beta receptor type I
  2. TGF-beta receptor type I
  3. TGF-beta type I receptor
  4. TbetaR-I
  5. TGFR-1
Enzyme 100 Gene Name TGFBR1
Enzyme 100 Protein Sequence >TGF-beta receptor type-1
MEAAAATPRPRLFLLMLAAAATLVPEATPLQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSITTTYCCNQDHCNKIELPTVGKPSSGLGPV
ELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDM
TTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFR
EAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIK
LALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEVARRCSIGGIHEDY
QLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLT
ALRIKKTLSQLSQQEGIKM
Enzyme 100 Number of Residues 499
Enzyme 100 Molecular Weight 55813.0
Enzyme 100 Theoretical pI 7.45
Enzyme 100 GO Classification
Function
Process
Component
Enzyme 100 General Function Involved in ATP binding
Enzyme 100 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta
Enzyme 100 Pathways Not Available
Enzyme 100 Reactions Not Available
Enzyme 100 Pfam Domain Function
Enzyme 100 Signals
  • 1-29
Enzyme 100 Transmembrane Regions
  • 123-143
Enzyme 100 Essentiality Not Available
Enzyme 100 GenBank ID Protein 2873365 Link Image
Enzyme 100 UniProtKB/Swiss-Prot ID O46680 Link Image
Enzyme 100 UniProtKB/Swiss-Prot Entry Name TGFR1_BOVIN Link Image
Enzyme 100 PDB ID 1IAS Link Image
Enzyme 100 PDB File Show
Enzyme 100 3D Structure
Enzyme 100 Cellular Location Not Available
Enzyme 100 Gene Sequence >1500 bp
ATGGAGGCAGCGGCCGCTACTCCGCGTCCCCGGCTGTTCCTCCTCATGCTGGCGGCGGCG
GCCACGCTGGTCCCGGAGGCAACGCCATTACAGTGTTTTTGCCACCTTTGTACAAAAGAC
AATTTTACTTGTGTCACAGATGGGCTTTGCTTTGTTTCTGTCACAGAGACCACAGACAAA
GTTATACATAATAGCATGTGTATAGCTGAAATTGACCTAATTCCACGAGACAGGCCATTT
GTATGTGCACCATCTTCAAAAACTGGGTCTATAACTACAACATATTGCTGCAACCAGGAC
CACTGCAATAAAATAGAACTTCCAACTGTTGGAAAGCCATCATCTGGCCTTGGTCCTGTT
GAACTGGCAGCTGTCATTGCTGGACCAGTCTGCTTTGTCTGTATCTCACTCATGTTGATG
GTCTATATTTGCCATAACCGCACTGTCATTCACCATCGAGTGCCAAATGAAGAGGATCCC
TCGTTAGATCGCCCTTTTATTTCAGAGGGTACAACGTTAAAAGATTTAATTTACGACATG
ACAACATCAGGTTCTGGATCAGGTTTACCATTGCTTGTTCAGAGAACAATTGCGAGAACT
ATTGTGTTACAAGAAAGTATTGGCAAAGGTCGTTTTGGAGAAGTTTGGCGAGGAAAATGG
AGAGGAGAAGAAGTTGCTGTTAAAATATTCTCCTCTAGAGAAGAACGTTCATGGTTCCGT
GAAGCAGAGATTTATCAGACTGTCATGTTACGTCACGAAAACATCTTGGGATTTATAGCA
GCAGACAATAAAGACAATGGCACATGGACTCAGCTCTGGTTGGTGTCAGATTATCATGAG
CACGGATCCCTTTTTGATTATTTGAACAGATACACAGTTACTGTGGAAGGAATGATAAAA
CTTGCTCTGTCCACAGCAAGTGGACTTGCCCATCTTCACATGGAGATAGTTGGTACCCAA
GGAAAACCAGCCATAGCTCATAGGGATTTGAAATCAAAGAATATCTTGGTAAAGAAGAAT
GGAACTTGCTGTATTGCAGACTTAGGATTGGCAGTAAGGCATGATTCGGCCACGGATACA
ATTGACATTGCTCCAAACCACAGAGTGGGAACAAAAAGGTACATGGCCCCTGAAGTTCTA
GATGATTCCATAAATATGAAACACTTTGAATCCTTCAAACGTGCTGACATCTATGCAATG
GGACTAGTATTCTGGGAAGTAGCTCGACGATGTTCCATTGGTGGAATACATGAAGATTAC
CAGCTGCCTTATTATGATCTTGTACCTTCCGATCCATCAGTTGAAGAAATGAGAAAAGTT
GTTTGTGAACAGAAGTTAAGGCCAAATATTCCAAACAGATGGCAGAGCTGTGAAGCCTTG
AGAGTAATGGCTAAAATTATGAGAGAATGTTGGTATGCCAATGGAGCAGCTAGGCTTACA
GCTTTGCGGATTAAGAAAACATTGTCACAACTCAGTCAGCAGGAAGGCATCAAAATGTAA
Enzyme 100 GenBank Gene ID U97485 Link Image
Enzyme 100 GeneCard ID TGFBR1 Link Image
Enzyme 100 GenAtlas ID Not Available
Enzyme 100 HGNC ID Not Available
Enzyme 100 Chromosome Location Chromosome:9
Enzyme 100 Locus 9q22
Enzyme 100 SNPs SNPJam Report Link Image
Enzyme 100 General References
  1. [PubMed Link Image]
Enzyme 100 Metabolite References Not Available
Enzyme 101 [top]
Enzyme 101 ID 503
Enzyme 101 Name Nucleoside diphosphate kinase A 1
Enzyme 101 Synonyms
  1. NDP kinase A 1
  2. NDK A 1
  3. Nucleoside diphosphate kinase NBR-A
  4. NDK NBR-A
Enzyme 101 Gene Name NME1-1
Enzyme 101 Protein Sequence >Nucleoside diphosphate kinase A 1
MANSERTFIAIKPDGVQRGLIGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIALWFHPEELVNYKSCAQNWIYE
Enzyme 101 Number of Residues 152
Enzyme 101 Molecular Weight 17260.8
Enzyme 101 Theoretical pI 7.58
Enzyme 101 GO Classification
Function
Process
Component
Enzyme 101 General Function Nucleotide transport and metabolism
Enzyme 101 Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein- coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination
Enzyme 101 Pathways Not Available
Enzyme 101 Reactions Not Available
Enzyme 101 Pfam Domain Function
Enzyme 101 Signals
  • None
Enzyme 101 Transmembrane Regions
  • None
Enzyme 101 Essentiality Not Available
Enzyme 101 GenBank ID Protein 1064895 Link Image
Enzyme 101 UniProtKB/Swiss-Prot ID P52174 Link Image
Enzyme 101 UniProtKB/Swiss-Prot Entry Name NDKA1_BOVIN Link Image
Enzyme 101 PDB ID 1BHN Link Image
Enzyme 101 PDB File Show
Enzyme 101 3D Structure
Enzyme 101 Cellular Location Not Available
Enzyme 101 Gene Sequence >459 bp
ATGGCCAACAGCGAGCGCACCTTCATTGCCATCAAGCCCGATGGAGTCCAGCGAGGCCTC
ATTGGAGAAATAATCAAGCGTTTTGAGCAAAAGGGATTCCGTCTTGTTGCCATGAAATTC
ATGCGGGCTTCTGAAGACCTTCTCAAGGAGCACTATATTGACCTGAAGGACCGTCCATTC
TTTGCTGGCCTGGTGAAATACATGCACTCAGGGCCAGTGGTTGCCATGGTCTGGGAGGGA
CTGAATGTTGTGAAGACAGGTCGAGTGATGCTTGGGGAGACTAACCCTGCGGACTCCAAG
CCTGGGACCATCCGTGGGGACTTTTGCATCCAAGTTGGCAGGAACATTATCCATGGCAGT
GATTCCGTGGAGAGTGCAGAGAAGGAGATTGCCTTGTGGTTTCACCCTGAGGAACTGGTG
AATTACAAGAGCTGTGCTCAGAACTGGATCTACGAGTGA
Enzyme 101 GenBank Gene ID X92956 Link Image
Enzyme 101 GeneCard ID NME1-1 Link Image
Enzyme 101 GenAtlas ID Not Available
Enzyme 101 HGNC ID Not Available
Enzyme 101 Chromosome Location Not Available
Enzyme 101 Locus Not Available
Enzyme 101 SNPs SNPJam Report Link Image
Enzyme 101 General References
  1. [PubMed Link Image]
Enzyme 101 Metabolite References Not Available
Enzyme 102 [top]
Enzyme 102 ID 504
Enzyme 102 Name Protein phosphatase 1G
Enzyme 102 Synonyms
  1. Protein phosphatase 2C isoform gamma
  2. PP2C-gamma
  3. Protein phosphatase magnesium-dependent 1 gamma
  4. Protein phosphatase 1B
  5. Magnesium-dependent calcium inhibitable phosphatase
  6. MCPP
Enzyme 102 Gene Name PPM1G
Enzyme 102 Protein Sequence >Protein phosphatase 1G
MGAYLSQPNTVKCSGDGVGASRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYD
GHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGR
PTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGAPHSKSGAGTGEE
PGSQGLNGEAGPEDPSRETSAEENGPTAKAHTGLSSNSECGTEAGQGGEPGTPTGEAGPS
CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEE
AEEDDEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDM
SYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALP
DIKVLTLTDDHEFMVIACDGIWNVMSSQEVIDFIQSKISQRDENGELRLLSSIVEELLDQ
CLAPDTSGDGTGCDNMTCIIICFKPRNTAAPQPESGKRKLEEVLSTEGAEENGNSDKKKA
KRD
Enzyme 102 Number of Residues 543
Enzyme 102 Molecular Weight 58606.3
Enzyme 102 Theoretical pI 3.99
Enzyme 102 GO Classification
Function
Process
Component
Enzyme 102 General Function Signal transduction mechanisms
Enzyme 102 Specific Function A phosphoprotein + H(2)O = a protein + phosphate
Enzyme 102 Pathways Not Available
Enzyme 102 Reactions Not Available
Enzyme 102 Pfam Domain Function
Enzyme 102 Signals
  • None
Enzyme 102 Transmembrane Regions
  • None
Enzyme 102 Essentiality Not Available
Enzyme 102 GenBank ID Protein 1754694 Link Image
Enzyme 102 UniProtKB/Swiss-Prot ID P79126 Link Image
Enzyme 102 UniProtKB/Swiss-Prot Entry Name PPM1G_BOVIN Link Image
Enzyme 102 PDB ID Not Available
Enzyme 102 Cellular Location Not Available
Enzyme 102 Gene Sequence >1632 bp
ATGGGTGCCTACCTCTCTCAGCCCAACACGGTGAAGTGCTCTGGAGACGGGGTCGGCGCT
TCGCGCCTGCCGCTGCCCTACGGCTTCTCCGCCATGCAAGGCTGGCGCGTCTCCATGGAG
GATGCTCACAACTGTATTCAAGAGCTGGACAGTGAGACAGCCATGTTTTCTGTCTATGAT
GGACATGGAGGGGAGGAAGTTGCCTTGTACTGTGCCAAATATCTTCCAGATATCATCAAA
GATCAGAAGGCCTACAAAGAAGGCAAGCTACAGAAGGCTTTGGAAGATGCCTTTTTGGCT
ATTGATGCCAAGCTAACCACTGAGGAAGTCATTAAGGAGCTGGCACAGATTGCAGGGCGA
CCCACTGAAGACGAGGATGAAAAAGAAAAAGTTGCTGATGAAGATGATGTGGACAATGAG
GAGGCTGCACTGCTGCATGAAGAGGCTACCATGACTATTGAAGAGCTGCTGACACGCTAC
GGGCAGAACTGTCACAAGGGTGCTCCCCACAGCAAATCTGGAGCTGGGACAGGCGAGGAA
CCAGGGTCCCAGGGCCTCAATGGGGAGGCGGGACCTGAGGACCCATCTAGGGAAACTTCT
GCAGAGGTAAATGGCCCCACAGCCAAGGCTCACACAGGCCTTTCCTCCAACTCGGAATGT
GGGACTGAGGCAGGCCAAGGTGGGGAGCCTGGCACTCCCACTGGTGAGGCTGGGCCTTCC
TGCTCTTCAGCCTCCGACAAGCTGCCTCGAGTTGATAAGTCCAAGTTCTTTGAGGACAGT
GAGGATGAGTCAGATGAGGCGGAGGAGGAAGAGGAAGACAGCGAGGAATGCAGTGAGGAA
GAAGATGGCTACAGCAGTGAAGAGGCAGAGAATGAGGAAGACGAGGATGACACTGAGGAG
GCTGAAGAGGATGATGAAGAAGAAGAGATGATGGTGCCTGGGATGGAAGGCAAAGAGGAG
CCTGGCTCTGACAGTGGTACAACAGCAGTGGTGGCTCTGATACGAGGGAAGCAGTTGATT
GTAGCCAATGCAGGAGACTCCCGCTGTGTGGTGTCTGAGGCCGGCAAAGCTTTAGACATG
TCCTATGACCACAAACCGGAGGATGAAGTGGAGCTAGCACGCATCAAGAATGCTGGGGGC
AAGGTTACCATGGATGGGCGAGTCAACGGTGGCCTCAACCTCTCCAGAGCCATTGGAGAC
CACTTTTACAAGAGAAACAAGAACTTGCCACCAGAGGAACAGATGATTTCGGCCCTTCCT
GACATCAAGGTGCTGACTCTCACAGATGATCATGAGTTTATGGTCATTGCCTGTGATGGC
ATATGGAATGTGATGAGCAGCCAGGAAGTTATAGACTTTATTCAATCGAAGATCAGCCAG
CGCGATGAAAATGGGGAGCTTCGGTTACTGTCATCCATTGTGGAATATCTGCTGGATCAA
TGCCTGGCACCAGACACTTCTGGGGACGGTACAGGGTGTGACAACATGACCTGCATCATC
ATTTGCTTCAAGCCCCGAAATACAGCAGCGCCTCAGCCAGAGAGTGGCAAGCGGAAACTG
GAGGAGGTGCTGTCTACCGAGGGGGCTGAACAAAATGGCCACAGTGACAAGAAGAAGGCC
AAGCGGGACTAG
Enzyme 102 GenBank Gene ID U81159 Link Image
Enzyme 102 GeneCard ID PPM1G Link Image
Enzyme 102 GenAtlas ID Not Available
Enzyme 102 HGNC ID Not Available
Enzyme 102 Chromosome Location Chromosome:2
Enzyme 102 Locus 2p23.3
Enzyme 102 SNPs SNPJam Report Link Image
Enzyme 102 General References Not Available
Enzyme 102 Metabolite References Not Available
Enzyme 103 [top]
Enzyme 103 ID 505
Enzyme 103 Name Tubulin--tyrosine ligase
Enzyme 103 Synonyms
  1. TTL
Enzyme 103 Gene Name TTL
Enzyme 103 Protein Sequence >Tubulin--tyrosine ligase
MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLMQ
LVNYYRGADKLCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQDGIHPPL
HSSRTDEREFFLASYNRKKEEGEGNVWIAKSSAGAKGEGILISSDATELLDFIDNQGQVH
VIQKYLERPLLLEPGHRKFDIRSWVLVDHQFNIYLYREGVLRTASEPYHMDNFQDKTCHL
TNHCIQKEYSKNYGKYEEGNEMFFEAFNRYLTSALNITLESSILLQIKHIIRSCLMSVEP
AISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAIASVFP
PPDAEQQPPQPATFIKL
Enzyme 103 Number of Residues 377
Enzyme 103 Molecular Weight 43270.1
Enzyme 103 Theoretical pI 6.79
Enzyme 103 GO Classification
Function
Process
Component
Enzyme 103 General Function Involved in ATP binding
Enzyme 103 Specific Function Catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin
Enzyme 103 Pathways Not Available
Enzyme 103 Reactions Not Available
Enzyme 103 Pfam Domain Function
Enzyme 103 Signals
  • None
Enzyme 103 Transmembrane Regions
  • None
Enzyme 103 Essentiality Not Available
Enzyme 103 GenBank ID Protein Not Available
Enzyme 103 UniProtKB/Swiss-Prot ID P38584 Link Image
Enzyme 103 UniProtKB/Swiss-Prot Entry Name TTL_BOVIN Link Image
Enzyme 103 PDB ID Not Available
Enzyme 103 Cellular Location Not Available
Enzyme 103 Gene Sequence Not Available
Enzyme 103 GenBank Gene ID Not Available
Enzyme 103 GeneCard ID TTL Link Image
Enzyme 103 GenAtlas ID Not Available
Enzyme 103 HGNC ID Not Available
Enzyme 103 Chromosome Location Chromosome:2
Enzyme 103 Locus 2q13
Enzyme 103 SNPs SNPJam Report Link Image
Enzyme 103 General References
  1. [PubMed Link Image]
Enzyme 103 Metabolite References Not Available
Enzyme 104 [top]
Enzyme 104 ID 506
Enzyme 104 Name Fumarylacetoacetate hydrolase domain-containing protein 2
Enzyme 104 Synonyms Not Available
Enzyme 104 Gene Name FAHD2
Enzyme 104 Protein Sequence >Fumarylacetoacetate hydrolase domain-containing protein 2
MLGSSGRRLLTTVLQAQRWPFQPSRDMRLVQFQAPHLAGPHLGLESGNGGGVIDLNAFEP
TLPKTMVEFLEQGEATLSVVRRALATQLPVLPRSEVTFLAPVTRPDKVVCVGMNYADHCR
EQNVPVPKEPIIFSKFASAIVGPYDNIILPPESQEVDWEVELAVVIGKRGKYIKATDAMA
HVAGFTVAHDVSARDWQMGRNGKQWLLGKTFDTFCPLGPALVTKDSVADPHNLKICCRVN
GELMQSSNTNQMVFKTEELITWVSQFVTLYPGDIILTGTPPGVGVFRKPPVFLKKGDEVQ
CEIEELGVIINKVV
Enzyme 104 Number of Residues 314
Enzyme 104 Molecular Weight 34555.8
Enzyme 104 Theoretical pI 6.78
Enzyme 104 GO Classification
Function
Process
Component
Enzyme 104 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 104 Specific Function May have hydrolase activity
Enzyme 104 Pathways Not Available
Enzyme 104 Reactions Not Available
Enzyme 104 Pfam Domain Function
Enzyme 104 Signals
  • None
Enzyme 104 Transmembrane Regions
  • None
Enzyme 104 Essentiality Not Available
Enzyme 104 GenBank ID Protein 37780029 Link Image
Enzyme 104 UniProtKB/Swiss-Prot ID Q2KIB0 Link Image
Enzyme 104 UniProtKB/Swiss-Prot Entry Name FAHD2_BOVIN Link Image
Enzyme 104 PDB ID Not Available
Enzyme 104 Cellular Location Not Available
Enzyme 104 Gene Sequence >945 bp
ATGCTGGGGTCCAGTGGCAGGAGGTTGCTCACGACTGTGCTGCAGGCACAGAGGTGGCCC
TTTCAGCCCTCCAGAGACATGAGATTGGTGCAGTTCCAGGCACCCCACCTAGCGGGACCC
CACCTGGGCCTGGAGTCAGGGAATGGCGGGGGTGTCATCGACCTCAACGCCTTTGAGCCC
ACACTGCCCAAGACGATGGTGGAGTTCCTGGAGCAGGGAGAAGCCACTCTGTCAGTGGTG
AGAAGAGCACTGGCCACCCAGTTGCCAGTCCTCCCACGGTCAGAGGTGACGTTCCTGGCC
CCAGTCACTCGGCCAGACAAGGTGGTGTGCGTGGGCATGAACTATGCAGACCACTGCAGA
GAACAGAACGTGCCTGTGCCCAAGGAGCCCATCATCTTCAGCAAGTTCGCCAGCGCCATT
GTGGGGCCCTATGACAACATCATCCTTCCGCCTGAGAGCCAGAAGGTGGACTGGGAAGTG
GAGCTGGCCGTGGTCATCGGAAAGAGAGGCAAGTACATCAAGGCTACAGATGCCATGGCC
CATGTGGCTGGCTTCACTGTGGCACACGACGTGAGTGCTCGTGACTGGCAGATGGGACGC
AATGGAAAGCAGTGGTTGCTGGGGAAAACCTTTGACACCTTCTGCCCTCTGGGCCCTGCC
TTGGTGACCAAGGACAGCGTGGCAGACCCACACAACCTAAAGATCTGCTGCCGAGTAAAT
GGGGAAGTGATGCAGAGCAGCAATACCAACCAGATGGTGTTTAAGACAGAAGAGCTGATA
ACCTGGGTCTCCCAGTTCGTTACTCTTTACCCAGGGGACATCATCCTGACCGGGACGCCC
CCAGGTGTGGGTGTGTTCAGGAAGCCTCCTGTCTTCCTCAAGAAAGGCGATGAAGTCCAG
TGTGAGATTGAAGAACTGGGTGTCATCATCAACAAGGTGGTGTGA
Enzyme 104 GenBank Gene ID AY192436 Link Image
Enzyme 104 GeneCard ID FAHD2 Link Image
Enzyme 104 GenAtlas ID Not Available
Enzyme 104 HGNC ID Not Available
Enzyme 104 Chromosome Location Not Available
Enzyme 104 Locus Not Available
Enzyme 104 SNPs SNPJam Report Link Image
Enzyme 104 General References Not Available
Enzyme 104 Metabolite References Not Available
Enzyme 105 [top]
Enzyme 105 ID 507
Enzyme 105 Name Nucleoside diphosphate kinase B
Enzyme 105 Synonyms
  1. NDP kinase B
  2. NDK B
Enzyme 105 Gene Name NME2
Enzyme 105 Protein Sequence >Nucleoside diphosphate kinase B
MAHAERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLQASEELLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVKSAEKEINLWFKPEELIEYKPCAFDWIYE
Enzyme 105 Number of Residues 152
Enzyme 105 Molecular Weight 17316.0
Enzyme 105 Theoretical pI 8.22
Enzyme 105 GO Classification
Function
Process
Component
Enzyme 105 General Function Nucleotide transport and metabolism
Enzyme 105 Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC
Enzyme 105 Pathways Not Available
Enzyme 105 Reactions Not Available
Enzyme 105 Pfam Domain Function
Enzyme 105 Signals
  • None
Enzyme 105 Transmembrane Regions
  • None
Enzyme 105 Essentiality Not Available
Enzyme 105 GenBank ID Protein 74354800 Link Image
Enzyme 105 UniProtKB/Swiss-Prot ID Q3T0Q4 Link Image
Enzyme 105 UniProtKB/Swiss-Prot Entry Name NDKB_BOVIN Link Image
Enzyme 105 PDB ID 1NSK Link Image
Enzyme 105 PDB File Show
Enzyme 105 3D Structure
Enzyme 105 Cellular Location Not Available
Enzyme 105 Gene Sequence >459 bp
ATGGCCCACGCGGAGCGCACCTTTATTGCTATCAAGCCGGACGGCGTGCAGCGCGGCCTG
GTGGGCGAGATCATCAAGCGCTTCGAGCAGAAGGGATTCCGCCTTGTGGCCATGAAGTTC
CTTCAGGCCTCTGAGGAACTCCTGAAGCAGCACTACATTGACCTGAAAGACCGCCCATTC
TTTCCCGGCCTGGTGAAGTACATGAACTCAGGGCCAGTTGTGGCCATGGTCTGGGAGGGC
CTGAATGTAGTGAAGACAGGACGAGTGATGCTTGGGGAGACCAACCCAGCAGATTCTAAG
CCGGGCACCATTCGTGGTGACTTCTGCATTCAAGTTGGCAGGAACATCATTCATGGCAGT
GATTCAGTAAAAAGTGCTGAGAAAGAGATCAACTTGTGGTTTAAGCCCGAAGAATTGATT
GAATACAAGCCTTGTGCTTTTGACTGGATATATGAATAA
Enzyme 105 GenBank Gene ID BC102300 Link Image
Enzyme 105 GeneCard ID NME2 Link Image
Enzyme 105 GenAtlas ID Not Available
Enzyme 105 HGNC ID Not Available
Enzyme 105 Chromosome Location Chromosome:1
Enzyme 105 Locus 17q21.3
Enzyme 105 SNPs SNPJam Report Link Image
Enzyme 105 General References Not Available
Enzyme 105 Metabolite References Not Available
Enzyme 106 [top]
Enzyme 106 ID 508
Enzyme 106 Name Inosine triphosphate pyrophosphatase
Enzyme 106 Synonyms
  1. ITPase
  2. Inosine triphosphatase
Enzyme 106 Gene Name ITPA
Enzyme 106 Protein Sequence >Inosine triphosphate pyrophosphatase
MAASLAGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIRKCQEA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLEGFQDKSAYALCTFAF
STGDPNEPVRLFRGRTMGRIVVPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNTISHRFR
ALLALQEYFSSLTPGVGDDHPSWGSGEG
Enzyme 106 Number of Residues 208
Enzyme 106 Molecular Weight 23061.2
Enzyme 106 Theoretical pI 5.36
Enzyme 106 GO Classification
Function
Process
Component
Enzyme 106 General Function Nucleotide transport and metabolism
Enzyme 106 Specific Function Hydrolyzes ITP and dITP to their respective monophosphate derivatives. Xanthosine 5'-triphosphate (XTP) is also a potential substrate. May be the major enzyme responsible for regulating ITP concentration in cells
Enzyme 106 Pathways Not Available
Enzyme 106 Reactions Not Available
Enzyme 106 Pfam Domain Function
Enzyme 106 Signals
  • None
Enzyme 106 Transmembrane Regions
  • None
Enzyme 106 Essentiality Not Available
Enzyme 106 GenBank ID Protein 86827634 Link Image
Enzyme 106 UniProtKB/Swiss-Prot ID Q2KIC5 Link Image
Enzyme 106 UniProtKB/Swiss-Prot Entry Name ITPA_BOVIN Link Image
Enzyme 106 PDB ID Not Available
Enzyme 106 Cellular Location Not Available
Enzyme 106 Gene Sequence >627 bp
ATGGCGGCCTCCTTGGCCGGGAAGAAGATCGTGTTTGTCACGGGGAACGCCAAAAAGCTG
GAGGAGGTCATTCAGATTCTAGGAGATAAATTTCCGTGTACTTTGGTGGCGCAGAAAATT
GACCTGCCAGAGTACCAAGGAGAGCCTGATGAGATTTCCATTCGGAAGTGTCAGGAGGCA
GCTCGCCAGGTGCAGGGCCCTGTACTGGTAGAGGACACCTGTCTGTGCTTCAACGCCCTT
GGAGGCCTCCCTGGCCCCTACATAAAGTGGTTTCTGGAGAAGTTAAAGCCTGAAGGTCTC
CACCAGCTCCTGGAGGGGTTCCAAGACAAGTCTGCCTATGCACTCTGCACGTTCGCATTC
AGCACTGGGGACCCGAATGAGCCCGTACGCCTCTTCAGGGGCCGGACAATGGGCCGGATT
GTGGTGCCCCGTGGCTGCCGGGACTTTGGCTGGGACCCCTGCTTTCAGCCTGATGGATAC
GAGCAGACGTATGCAGAGATGCCCAAGGCTGAGAAGAACACCATTTCCCATCGCTTCCGG
GCCCTGCTTGCGTTGCAAGAATATTTTAGCAGCCTGACTCCTGGGGTCGGTGATGACCAC
CCTAGCTGGGGATCCGGAGAGGGGTAG
Enzyme 106 GenBank Gene ID BC112688 Link Image
Enzyme 106 GeneCard ID ITPA Link Image
Enzyme 106 GenAtlas ID Not Available
Enzyme 106 HGNC ID Not Available
Enzyme 106 Chromosome Location Chromosome:2
Enzyme 106 Locus 20p
Enzyme 106 SNPs SNPJam Report Link Image
Enzyme 106 General References Not Available
Enzyme 106 Metabolite References Not Available
Enzyme 107 [top]
Enzyme 107 ID 509
Enzyme 107 Name Acyl-coenzyme A synthetase ACSM1, mitochondrial
Enzyme 107 Synonyms
  1. Acyl-CoA synthetase medium-chain family member 1
  2. Middle-chain acyl-CoA synthetase 1
  3. Butyryl coenzyme A synthetase 1
  4. Butyrate--CoA ligase 1
  5. Xenobiotic/medium-chain fatty acid:CoA ligase XL-3
  6. XM-ligase 3
  7. XL-III
  8. Lipoate-activating enzyme
Enzyme 107 Gene Name ACSM1
Enzyme 107 Protein Sequence >Acyl-coenzyme A synthetase ACSM1, mitochondrial
MQRLMKFRVLWGIHMSCPGFHHAPQHLRCRSLSGAGTLRWNDYDRPEEFNFASDVLDHWT
QMEKEGKRSPNPALWWVNDQGDEVKWSFREMTDLTCRTANVLTQTCGLQTGDRLALILPR
VPEWWLVCVGCIRTGIIFMPGTTQMKAKDILYRLQVSGAKAIVTTDTLAPEVESVAPECP
SLKTKLLVSDHSREGWLDFRSLVKSASPDHICIKSKTLDPMAIFFTSGTTGFPKMAKHSH
GFALRSYFPACRKLLQLKMSDVFWCLSDTGWILAALGSLLEPWTAGSTVFAHHLPQFDPK
VIIETFFKYPITQCLAAPSVYRMILQQNYTSLRFPTLEHCCTGGEALLPEEQEQWKRQTG
VLLYQAYGQSETGISCGTLRGMKIKPGSMGKAIPPFDIQIIDDKGNIQPPNTEGNIGIRI
KPTRPIGLFMYYENNPEKTAEVECGDFYNTGDRATIDEEGYFWFLGRSDDVINASGYRVG
PAEVENALAEHPAVAESAVVSSPDPVRGEVVKAFIVLNPEFSSRDPGELTKELQQHVKSV
TAPYKYPRKVEFVSELPKTITGKIKRSELRKKEFGQK
Enzyme 107 Number of Residues 577
Enzyme 107 Molecular Weight 64922.1
Enzyme 107 Theoretical pI 7.79
Enzyme 107 GO Classification
Function
Process
Component
Enzyme 107 General Function Lipid transport and metabolism
Enzyme 107 Specific Function Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4- unsaturated acids (in vitro). Functions as GTP-dependent lipoate- activating enzyme that generates the substrate for lipoyltransferase
Enzyme 107 Pathways Not Available
Enzyme 107 Reactions Not Available
Enzyme 107 Pfam Domain Function
Enzyme 107 Signals
  • None
Enzyme 107 Transmembrane Regions
  • None
Enzyme 107 Essentiality Not Available
Enzyme 107 GenBank ID Protein 5070357 Link Image
Enzyme 107 UniProtKB/Swiss-Prot ID Q9BEA2 Link Image
Enzyme 107 UniProtKB/Swiss-Prot Entry Name ACSM1_BOVIN Link Image
Enzyme 107 PDB ID Not Available
Enzyme 107 Cellular Location Not Available
Enzyme 107 Gene Sequence >1734 bp
ATGCAAAGGCTGATGAAGTTTCGGGTCCTCTGGGGCATCCACATGTCCTGCCCTGGCTTC
CACCATGCCCCTCAGCACCTGCGCTGCCGATCTTTATCAGGAGCTGGAACCCTAAGATGG
AATGACTATGACAGACCTGAGGAATTTAACTTTGCAAGTGATGTACTGGACCACTGGACT
CAAATGGAGAAGGAGGGCAAGAGAAGTCCAAACCCAGCCCTGTGGTGGGTGAACGATCAA
GGGGATGAAGTGAAGTGGAGCTTCAGAGAGATGACAGACTTAACCTGTCGCACAGCCAAC
GTCCTGACACAGACCTGCGGCCTTCAGACGGGAGACCGTCTAGCGTTGATTTTGCCTCGA
GTGCCTGAGTGGTGGCTTGTGTGTGTGGGCTGCATCCGAACAGGGATCATCTTCATGCCA
GGGACCACCCAGATGAAGGCCAAGGACATTCTCTACCGACTACAAGTATCTGGAGCCAAA
GCCATCGTGACCACAGATACCCTTGCCCCAGAGGTGGAGTCTGTGGCACCTGAGTGTCCT
TCTCTGAAAACCAAGCTCCTGGTGTCTGACCACAGCCGTGAAGGGTGGCTGGACTTCCGA
TCACTGGTTAAATCAGCCTCCCCAGATCACATCTGTATTAAGTCAAAGACCCTGGACCCA
ATGGCCATCTTCTTCACCAGTGGGACCACGGGCTTCCCCAAGATGGCAAAGCACAGCCAC
GGATTCGCTTTACGATCCTATTTCCCAGCATGCAGGAAATTGTTGCAGCTGAAGATGTCT
GATGTCTTCTGGTGCCTGTCAGACACAGGCTGGATTCTGGCTGCCTTGGGGTCCCTGCTT
GAACCATGGACAGCGGGGTCTACAGTCTTTGCTCATCATCTGCCTCAGTTTGACCCTAAG
GTCATTATAGAGACATTTTTCAAATATCCAATTACCCAATGCCTTGCTGCACCTTCTGTA
TATCGAATGATTTTGCAGCAGAATTACACCAGTCTTAGGTTCCCCACTCTGGAACACTGC
TGTACTGGTGGGGAAGCCCTGCTGCCCGAGGAGCAAGAACAGTGGAAAAGACAGACAGGT
GTTCTGCTCTACCAGGCCTATGGACAGTCAGAAACGGGAATAAGCTGTGGCACTCTCCGG
GGGATGAAGATCAAGCCAGGTTCCATGGGGAAGGCCATCCCACCCTTTGACATTCAGATC
ATTGATGACAAGGGCAATATCCAGCCTCCCAACACGGAAGGAAACATTGGCATCAGGATC
AAGCCCACCAGGCCCATAGGCCTCTTCATGTACTATGAGAATAACCCAGAGAAAACAGCT
GAAGTGGAATGTGGGGACTTTTATAACACTGGGGACAGAGCAACTATTGACGAAGAGGGC
TACTTCTGGTTCCTTGGGAGGAGTGACGATGTCATCAATGCATCCGGATACCGCGTTGGG
CCAGCAGAAGTAGAGAATGCCCTGGCAGAGCACCCAGCGGTGGCTGAGTCTGCTGTGGTG
AGCAGCCCGGACCCGGTTCGAGGGGAGGTAGTGAAGGCATTTATTGTCCTGAACCCGGAA
TTCTCGAGCCGTGACCCAGGCGAGCTCACCAAGGAGCTGCAGCAGCATGTCAAGTCAGTG
ACAGCCCCATACAAGTACCCGAGGAAGGTGGAGTTTGTCTCAGAGCTGCCCAAAACCATC
ACTGGCAAGATAAAGAGAAGTGAGCTTCGGAAGAAGGAGTTTGGTCAGAAGTAG
Enzyme 107 GenBank Gene ID AF126145 Link Image
Enzyme 107 GeneCard ID ACSM1 Link Image
Enzyme 107 GenAtlas ID Not Available
Enzyme 107 HGNC ID Not Available
Enzyme 107 Chromosome Location Chromosome:1
Enzyme 107 Locus 16p12.2
Enzyme 107 SNPs SNPJam Report Link Image
Enzyme 107 General References
  1. [PubMed Link Image]
Enzyme 107 Metabolite References Not Available
Enzyme 108 [top]
Enzyme 108 ID 510
Enzyme 108 Name Serine/threonine-protein kinase 25
Enzyme 108 Synonyms Not Available
Enzyme 108 Gene Name STK25
Enzyme 108 Protein Sequence >Serine/threonine-protein kinase 25
MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNRTKEVVAIKIIDLEEAEDEI
EDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATI
LREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPF
WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGHHS
KPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWRSEGHGEESS
SEDSDIDGDPEDGEQGPIWTFPPTIRPSPHGKLHKGTALHGPQKSAEPVKRQPRSQCLST
LVRPVFGELKEKHKQSGGGVGALEELENAFSLAEESCPGISDKLMAHLVERVQRFSHSRN
HLTSTR
Enzyme 108 Number of Residues 426
Enzyme 108 Molecular Weight 48034.2
Enzyme 108 Theoretical pI 6.84
Enzyme 108 GO Classification
Function
Process
Component
Enzyme 108 General Function Involved in ATP binding
Enzyme 108 Specific Function Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration
Enzyme 108 Pathways Not Available
Enzyme 108 Reactions Not Available
Enzyme 108 Pfam Domain Function
Enzyme 108 Signals
  • None
Enzyme 108 Transmembrane Regions
  • None
Enzyme 108 Essentiality Not Available
Enzyme 108 GenBank ID Protein 33943093 Link Image
Enzyme 108 UniProtKB/Swiss-Prot ID Q3SWY6 Link Image
Enzyme 108 UniProtKB/Swiss-Prot Entry Name STK25_BOVIN Link Image
Enzyme 108 PDB ID Not Available
Enzyme 108 Cellular Location Not Available
Enzyme 108 Gene Sequence >1284 bp
ATGGCTCACCTCAGGGGATTTGCCAACCAGCACTCGCGAGTGGACCCCGAGGAGCTTTTC
ACCAAGCTGGACCGCATCGGCAAGGGCTCCTTCGGGGAGGTGTACAAGGGCATCGACAAC
CGCACCAAGGAGGTGGTGGCCATCAAGATCATAGACCTCGAGGAGGCGGAGGACGAGATC
GAGGACATCCAGCAGGAGATCACCGTGCTCAGCCAGTGCGACAGCCCCTACATCACGCGC
TACTTCGGCTCCTACCTGAAGAGCACGAAGCTGTGGATCATCATGGAGTACCTGGGTGGC
GGCTCCGCCTTGGACCTGCTGAAGCCGGGCCCCCTGGAGGAGACCTACATTGCCACCATC
CTGCGGGAGATCCTGAAGGGCCTGGATTACCTGCACTCGGAGCGCAAGATCCACCGGGAC
ATCAAAGCCGCCAACGTGCTGCTCTCGGAGCAGGGCGATGTGAAGCTGGCAGACTTCGGG
GTAGCAGGGCAGCTGACAGACACGCAGATCAAGAGGAACACTTTCGTGGGCACCCCCTTC
TGGATGGCGCCCGAGGTCATCAAGCAGTCGGCCTATGACTTCAAGGCTGATATCTGGTCG
CTGGGGATCACAGCCATCGAGCTGGCCAAGGGCGAGCCCCCCAACTCCGACCTGCACCCC
ATGCGCGTCCTGTTCCTGATCCCCAAGAACAGCCCGCCCACGCTTGAGGGCCACCACAGC
AAGCCCTTCAAGGAGTTTGTGGAGGCCTGCCTCAACAAGGACCCCCGATTTCGGCCCACC
GCCAAGGAGCTCCTGAAGCACAAGTTCATCACGCGCTACACCAAGAAGACCTCCTTCCTC
ACCGAGCTCATCGACCGCTACAAGCGCTGGAGGTCGGAGGGCCACGGCGAGGAGTCCAGC
TCCGAGGACTCCGACATAGATGGAGACCCCGAGGATGGAGAGCAGGGGGCCCATCTTGGA
CGTTCCCCCCAACCATCCGGCCGAGCCCGCACGGGAAGGCTGCACAAGGGGACGGCCCTG
CACGGCCCCCAGAATTCGGCGGAGCCTGTCAAGAGGCAGCCGAGGTCACAGTGCCTGTCC
ACGCTGGTCCGGCCCGTCTTTGGAGAGCTCAAAGAGAAGCACAAGCAGAGCGGCGGGGGC
GTGGGGGCGCTGGAGGAGCTGGAGAACGCCTTCAGCCTGGCTGAGGAGTCCTGCCCCGGC
ATCTCGGACAAGCTGATGGCCCACCTGGTGGAGCGGGTGCAGAGGTTTTCCCACAGCAGA
AACCACCTGACCTCAACCCGCTGA
Enzyme 108 GenBank Gene ID AY346153 Link Image
Enzyme 108 GeneCard ID STK25 Link Image
Enzyme 108 GenAtlas ID Not Available
Enzyme 108 HGNC ID Not Available
Enzyme 108 Chromosome Location Chromosome:2
Enzyme 108 Locus 2q37.3
Enzyme 108 SNPs SNPJam Report Link Image
Enzyme 108 General References Not Available
Enzyme 108 Metabolite References Not Available
Enzyme 109 [top]
Enzyme 109 ID 511
Enzyme 109 Name Protein phosphatase 1L
Enzyme 109 Synonyms
  1. Protein phosphatase 1-like
  2. Protein phosphatase 2C isoform epsilon
  3. PP2C-epsilon
Enzyme 109 Gene Name PPM1L
Enzyme 109 Protein Sequence >Protein phosphatase 1L
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVK
GKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLMDLANKTH
PSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREM
LEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERK
RIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA
SDGLWDAFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ
Enzyme 109 Number of Residues 360
Enzyme 109 Molecular Weight 41041.6
Enzyme 109 Theoretical pI 5.67
Enzyme 109 GO Classification
Function
Process
Component
Enzyme 109 General Function Signal transduction mechanisms
Enzyme 109 Specific Function Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6
Enzyme 109 Pathways Not Available
Enzyme 109 Reactions Not Available
Enzyme 109 Pfam Domain Function
Enzyme 109 Signals
  • None
Enzyme 109 Transmembrane Regions
  • 26-42
Enzyme 109 Essentiality Not Available
Enzyme 109 GenBank ID Protein 148744034 Link Image
Enzyme 109 UniProtKB/Swiss-Prot ID A5PJZ2 Link Image
Enzyme 109 UniProtKB/Swiss-Prot Entry Name PPM1L_BOVIN Link Image
Enzyme 109 PDB ID Not Available
Enzyme 109 Cellular Location Not Available
Enzyme 109 Gene Sequence >1083 bp
ATGATAGAGGATACAATGACTTTGCTATCTCTCCTGGGTCGCATCATGCGCTACTTCTTG
CTGAGACCCGAGACGCTGTTCCTGCTGTGCATCAGCCTGGCGCTGTGGAGTTACTTCTTC
CACACGGACGAGGTGAAGACTATCGTCAAATCCAGCCGGGACGCCGTGAAGATGGTGAAG
GGCAAAGTGGCCGAGATCATGCAGAACGATCGACTAGGGGGGCTCGACGTGCTGGAGGCT
GAGTTCTCCAAGACCTGGGAGTTCAAGAGCCACAATGTGGCGGTGTATTCCATCCAGGGT
CGGAGAGACCACATGGAGGACCGTTTCGAAGTTCTTATGGACCTAGCCAACAAGACGCAC
CCCTCTATCTTCGGGATCTTCGACGGGCACGGGGGCGAGACAGCAGCTGAATATGTAAAA
TCTCGACTCCCAGAGGCCCTTAAGCAGCATCTTCAAGACTACGAGAAAGACAAAGAAAAT
AGTGTATTGTCTTACCAGACCATCCTTGAACAGCAGATTCTATCAATTGACCGAGAAATG
CTAGAAAAATTGACTGTATCCTATGATGAAGCAGGTACAACGTGTTTGATTGCTCTGCTA
TCAGATAAAGACCTCACTGTGGCCAACGTGGGTGACTCGCGTGGGGTCCTATGTGACAAG
GATGGGAACGCCATTCCTTTGTCTCATGATCACAAACCCTACCAGCTGAAGGAGAGGAAG
AGGATAAAGAGAGCCGGTGGTTTTATCAGTTTCAATGGCTCCTGGAGGGTCCAGGGGATC
CTGGCCATGTCTCGATCGCTGGGGGATTATCCACTGAAAAACCTCAATGTGGTCATCCCA
GACCCAGATATCCTGACCTTTGACCTGGACAAGCTCCAGCCCGAGTTCATGATCTTGGCA
TCAGATGGCCTCTGGGATGCTTTCAGCAATGAGGAAGCTGTTCGATTCATCAAGGACCGC
TTGGATGAACCTCACTTTGGGGCCAAGAGCATCGTTTTACAGTCCTTTTACAGAGGCTGC
CCTGACAATATAACAGTCATGGTGGTGAAGTTCAGGAATAGCAGCAAAACAGAAGAGCAG
TGA
Enzyme 109 GenBank Gene ID BC142293 Link Image
Enzyme 109 GeneCard ID PPM1L Link Image
Enzyme 109 GenAtlas ID Not Available
Enzyme 109 HGNC ID Not Available
Enzyme 109 Chromosome Location Chromosome:3
Enzyme 109 Locus 3q26.1
Enzyme 109 SNPs SNPJam Report Link Image
Enzyme 109 General References Not Available
Enzyme 109 Metabolite References Not Available
Enzyme 110 [top]
Enzyme 110 ID 512
Enzyme 110 Name Peroxisomal NADH pyrophosphatase NUDT12
Enzyme 110 Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 12
  2. Nudix motif 12
Enzyme 110 Gene Name NUDT12
Enzyme 110 Protein Sequence >Peroxisomal NADH pyrophosphatase NUDT12
MSSVKRSLNQEIISQFHYSAAEGDIAKLTAILSHSPSLLNETSENGWSALICDRSIVNKS
RQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEMKKEFFNYAGEISKEEEDGLVAWFALGIDTVAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRVCLKEDCPSLHGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQA
FFVPPSRAIAHQLIKHWIGMNPNL
Enzyme 110 Number of Residues 444
Enzyme 110 Molecular Weight 50119.1
Enzyme 110 Theoretical pI 6.69
Enzyme 110 GO Classification
Function
Process
Component
Enzyme 110 General Function Replication, recombination and repair
Enzyme 110 Specific Function Hydrolyzes NAD(P)H to NMNH and AMP (2',5'-ADP), and diadenosine diphosphate to AMP. Has also activity towards NAD(P)(+), ADP-ribose and diadenosine triphosphate. May act to regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism in this organelle
Enzyme 110 Pathways Not Available
Enzyme 110 Reactions Not Available
Enzyme 110 Pfam Domain Function
Enzyme 110 Signals
  • None
Enzyme 110 Transmembrane Regions
  • None
Enzyme 110 Essentiality Not Available
Enzyme 110 GenBank ID Protein 88954139 Link Image
Enzyme 110 UniProtKB/Swiss-Prot ID Q29RH3 Link Image
Enzyme 110 UniProtKB/Swiss-Prot Entry Name NUD12_BOVIN Link Image
Enzyme 110 PDB ID Not Available
Enzyme 110 Cellular Location Not Available
Enzyme 110 Gene Sequence >1335 bp
ATGTCTTCTGTAAAAAGAAGTCTGAATCAAGAAATAATATCCCAGTTTCACTATTCAGCT
GCAGAAGGAGATATTGCCAAGTTAACAGCAATACTCAGTCATTCTCCATCTCTTCTCAAT
GAAACTTCTGAAAATGGCTGGAGTGCTTTAATATGCGACAGATCCATTGTCAACAAATCA
AGGCAGACTGCACTGGATATAGCTAAATTTTGGGGTTATAAGCATATAGCTAACTTATTA
GCTAATGCTAAAGGTGGGAAGAAGCCTTGGTTCCTAACCAATGAAGTGGAAGAATGTGAA
AATTATTTTAGCAAGACACTACTGGACCGGAAAAGTGAAAAAAGAAATAATTCTGACTGG
CTGTTAGCAAAAGAAAGCCATCCAGCCACAGTTTATATCCTTTTCTCAGATTTAAATCCC
TTGGTTACTCTAGGAGGCAATAAAGAAAGTTTTCAACAGCCAGAAGTCAGGCTTTGTCAG
CTGAACTACACAGATATAAAGGATTATTTGGCTCAGCCTGAAAAGATCACCTTGATTTTC
CTTGGAGTAGAACTTGAAATGAAAAAAGAGTTTTTTAATTATGCTGGGGAAATCTCAAAA
GAAGAAGAAGATGGGTTGGTTGCCTGGTTTGCTTTAGGTATAGATACTGTTGCTGCTGAA
GAATTTAAGCAAAGGCATGAAAATTGTTATTTTCTTCATCCACCAATGCCAGCTCTTCTG
CAATTGAAAGAAAAAGAAGCTGGGGTTGTAGCTCAAGCAAGATCTGTTCTCGCTTGGCAC
AGTCGGTATAAGTTCTGCCCAACCTGTGGAAATGCAACTAAAATTGAAGAAGGTGGCTAT
AAAAGAGTATGCTTAAAAGAAGACTGTCCTAGTCTCCATGGTGTTCACAATACATCATAC
CCAAGAGTTGATCCAGTGGTAATCATGCAAGTTATTCATCCCGATGGGACCAAATGTCTT
TTAGGCAGGCAGAAGAGATTTCCTCCGGGCATGTTTACTTGCCTCGCTGGATTTATTGAA
CCTGGGGAGACAATAGAAGACGCTGTTCGGAGAGAAGTAGAAGAGGAAAGTGGAGTCAAA
GTTGGCCATGTTCAGTATGTCTCTTGTCAACCGTGGCCAATGCCCTCTTCCTTAATGATT
GGTTGCTTAGCTGTGGCAGTGTCTACAGAAATTAAAGTTGACAAGAATGAAATAGAGGAT
GCCCGCTGGTTCACTAGAGAACAGGTTGTGGATGTTCTGACCAAAGGCAAGCAGCAGGCA
TTCTTTGTTCCACCGAGCCGAGCTATTGCACATCAGTTAATCAAACACTGGATTGGAATG
AACCCCAATCTCTAA
Enzyme 110 GenBank Gene ID BC114173 Link Image
Enzyme 110 GeneCard ID NUDT12 Link Image
Enzyme 110 GenAtlas ID Not Available
Enzyme 110 HGNC ID Not Available
Enzyme 110 Chromosome Location Chromosome:5
Enzyme 110 Locus 5q21.2
Enzyme 110 SNPs SNPJam Report Link Image
Enzyme 110 General References Not Available
Enzyme 110 Metabolite References Not Available
Enzyme 111 [top]
Enzyme 111 ID 513
Enzyme 111 Name Serine/threonine-protein kinase 12
Enzyme 111 Synonyms
  1. Aurora-B
Enzyme 111 Gene Name AURKB
Enzyme 111 Protein Sequence >Serine/threonine-protein kinase 12
MAQKENAYPWPYGRQTAQPGLNTLPQRVLRKEPVTPSALVLMSRSNAQPTAAPGQKVVEN
SSGTPNIPKRSFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLQHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSRTFDEQRTATI
MEELADALTYCHAKKVIHRDIKPENLLLGLRGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRTHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPPSVPLGA
QDFIYKLLKHNPSERLPLAQVSAHPWVRTHSRRVLPPSAPQSVP
Enzyme 111 Number of Residues 344
Enzyme 111 Molecular Weight 39441.2
Enzyme 111 Theoretical pI 9.98
Enzyme 111 GO Classification
Function
Process
Component
Enzyme 111 General Function Involved in ATP binding
Enzyme 111 Specific Function May be directly involved in regulating the cleavage of polar spindle microtubules and is a key regulator for the onset of cytokinesis during mitosis. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Phosphorylates 'Ser-10' and 'Ser-28' of histone H3 during mitosis
Enzyme 111 Pathways Not Available
Enzyme 111 Reactions Not Available
Enzyme 111 Pfam Domain Function
Enzyme 111 Signals
  • None
Enzyme 111 Transmembrane Regions
  • None
Enzyme 111 Essentiality Not Available
Enzyme 111 GenBank ID Protein 33355452 Link Image
Enzyme 111 UniProtKB/Swiss-Prot ID Q7YRC6 Link Image
Enzyme 111 UniProtKB/Swiss-Prot Entry Name AURKB_BOVIN Link Image
Enzyme 111 PDB ID Not Available
Enzyme 111 Cellular Location Not Available
Enzyme 111 Gene Sequence >1035 bp
ATGGCCCAGAAGGAGAACGCCTACCCCTGGCCCTATGGCCGGCAGACGGCTCAGCCTGGC
CTGAACACCCTGCCCCAGAGAGTTCTCCGGAAGGAGCCTGTCACTCCATCGGCACTTGTC
CTCATGAGTCGCTCCAATGCCCAGCCCACAGCTGCCCCTGGCCAGAAGGTGGTGGAGAAC
AGCAGTGGAACCCCCAACATCCCAAAGCGTTCCTTCACAATCGATGACTTTGAGATTGGG
CGTCCTCTGGGCAAAGGCAAGTTTGGAAATGTGTACTTGGCTCGGGAGAAGAAAAGCCAT
TTCATCGTGGCGCTCAAAGTCCTCTTCAAGTCTCAGATCGAGAAGGAGGGTGTGGAGCAC
CAGCTGCGTAGAGAGATCGAAATCCAAGCGCATCTGCAACATCCCAACATCTTGCGTCTC
TACAACTATTTCTATGACCGGCGAAGGATCTACTTGATTCTGGAGTATGCCCCCCGGGGG
GAGCTCTACAAGGAGCTGCAGAAGAGCCGAACTTTTGATGAGCAGCGAACAGCCACGATC
ATGGAGGAGCTGGCAGATGCTCTGACATACTGCCATGCGAAGAAGGTGATTCACAGAGAC
ATCAAGCCTGAGAATCTGCTCTTGGGGCTCCGGGGAGAGCTGAAGATTGCTGACTTCGGC
TGGTCGGTGCACGCCCCCTCCCTGAGGAGGAAGACAATGTGCGGCACTCTGGACTACCTG
CCCCCAGAGATGATTGAGGGGCGCACGCACAATGAAAAGGTGGACCTGTGGTGCATCGGT
GTGCTCTGCTACGAGCTGCTGGTGGGAAACCCACCCTTTGAGAGTGCTTCCCACAATGAG
ACGTACCGGCGCATCGTCAAGGTGGACTTAAAGTTCCCTCCTTCTGTGCCCTTGGGAGCC
CAGGACTTCATCTACAAGCTGCTCAAGCATAACCCCTCAGAACGCCTGCCGCTGGCCCAG
GTCTCGGCCCACCCTTGGGTCCGAACCCACTCTCGCAGGGTGCTGCCTCCCTCTGCCCCT
CAGTCTGTCCCCTGA
Enzyme 111 GenBank Gene ID AY336975 Link Image
Enzyme 111 GeneCard ID AURKB Link Image
Enzyme 111 GenAtlas ID Not Available
Enzyme 111 HGNC ID Not Available
Enzyme 111 Chromosome Location Chromosome:1
Enzyme 111 Locus 17p13.1
Enzyme 111 SNPs SNPJam Report Link Image
Enzyme 111 General References Not Available
Enzyme 111 Metabolite References Not Available
Enzyme 112 [top]
Enzyme 112 ID 514
Enzyme 112 Name DNA-directed RNA polymerase III subunit RPC1
Enzyme 112 Synonyms
  1. RNA polymerase III subunit C1
  2. DNA-directed RNA polymerase III subunit A
Enzyme 112 Gene Name POLR3A
Enzyme 112 Protein Sequence >DNA-directed RNA polymerase III subunit RPC1
MVKEQFRETDVAKKISHICFGMKSAEEMRQQAHIQVVSKNLYSQDNNHSPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNTCHHCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSSFLQSFETAIEHNKEVEPLLGKAQENLNPLVVLNLFKRIPAEDIPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPEVHPGANF
IQQRHTQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGRGEDLCVNDSYVTIQNSELMSGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCRSEPALSKNELLLSAESIMKKNEFLC
CQDSFLQEIKKFIKEVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQIEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICMSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKANRDPSPPRRPLIFD
TNEFHIPLVT
Enzyme 112 Number of Residues 1390
Enzyme 112 Molecular Weight 155789.3
Enzyme 112 Theoretical pI 8.70
Enzyme 112 GO Classification
Function
Process
Component
Enzyme 112 General Function Transcription
Enzyme 112 Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition
Enzyme 112 Pathways Not Available
Enzyme 112 Reactions Not Available
Enzyme 112 Pfam Domain Function
Enzyme 112 Signals
  • None
Enzyme 112 Transmembrane Regions
  • None
Enzyme 112 Essentiality Not Available
Enzyme 112 GenBank ID Protein 134024541 Link Image
Enzyme 112 UniProtKB/Swiss-Prot ID A4IF62 Link Image
Enzyme 112 UniProtKB/Swiss-Prot Entry Name RPC1_BOVIN Link Image
Enzyme 112 PDB ID Not Available
Enzyme 112 Cellular Location Not Available
Enzyme 112 Gene Sequence >4173 bp
ATGGTGAAGGAGCAGTTCCGGGAGACAGATGTGGCCAAGAAAATAAGCCACATCTGTTTT
GGAATGAAGTCAGCCGAGGAGATGCGCCAGCAGGCACACATCCAGGTTGTGAGTAAGAAC
CTGTACAGCCAGGACAACAACCACTCCCCACTGCTATACGGGGTGCTTGACCACAGGATG
GGTACAAGTGAGAAGGACCGTCCTTGTGAAACCTGTGGGAAGAACTTGGCTGACTGTCTA
GGCCACTATGGGTACATTGACTTGGAGCTGCCGTGCTTCCACGTGGGGTACTTCCGAGCA
GTTATAGGCATCTTACAGATGATCTGTAAAACCTGCTGCCACATCATGCTGTCCCAGGAG
GAGAAGAAGCAGTTTCTGGATTATCTAAAGAGGCCCGGCCTGACCTACCTCCAGAAGCGA
GGGCTAAAGAAGAAAATCTCTGACAAGTGCCGGAAAAAGAACACGTGCCATCACTGCGGC
GCCTTCAATGGTACTGTCAAGAAATGCGGGTTACTGAAGATAATCCATGAGAAATACAAG
ACCAACAAGAAAGTGGTGGATCCCATCGTATCAAGTTTCCTTCAGTCCTTTGAAACCGCC
ATAGAGCATAACAAGGAAGTGGAGCCTCTGCTGGGAAAGGCCCAGGAAAACTTGAATCCC
TTAGTAGTTTTGAATTTATTTAAACGAATCCCAGCTGAAGATATCCCTCTACTTCTGATG
AATCCGGAAGCTGGAAAGCCCTCCGATTTGATTCTCACACGACTCTTAGTGCCCCCTTTG
TGCATCAGACCCTCTGTCGTGAGTGATTTGAAGTCTGGCACCAATGAAGACGATCTGACG
ATGAAGTTGACAGAAATCATTTTCCTAAATGACGTCATTAAAAAGCATCGGATATCCGGA
GCCAAGACCCAGATGATCATGGAAGACTGGGACTTCCTGCAGCTGCAGTGTGCTCTCTAC
ATTAACAGCGAGCTCTCAGGCATCCCCCTCAATATGGCACCCAAGAAATGGACCAGAGGG
TTTGTCCAGCGCCTGAAGGGAAAGCAGGGTCGATTCAGAGGCAATCTCTCAGGAAAGAGA
GTGGATTTTTCTGGTAGAACAGTCATCTCACCTGACCCCAACCTCCGAATTGATGAGGTA
GCTGTGCCAGTTCACGTGGCCAAAATTCTAACATTTCCTGAGAAGGTGAACAAAGCAAAC
ATCAACTTTTTGAGGAAACTGGTTCGAAATGGCCCTGAAGTTCACCCAGGAGCCAATTTC
ATTCAGCAGAGACACACGCAGATGAAAAGGTTTCTGAAATACGGAAACAGAGAAAAGATG
GCCCAGGAGCTCAAGTTCGGGGACATTGTGGAGAGGCACCTCATCGATGGAGACGTGGTC
CTCTTCAACCGGCAGCCCTCGCTGCACAAACTGAGCATCATGGCGCACCTGGCCAGGGTC
AAGCCCCACCGGACTTTCAGATTTAACGAGTGTGTCTGTACACCCTACAATGCGGATTTT
GATGGAGATGAAATGAACCTTCATCTTCCTCAAACAGAAGAAGCTAAAGCAGAAGCCCTT
GTTCTCATGGGGACTAAAGCAAACCTTGTAACACCGAGAAATGGAGAACCACTAATTGCT
GCTATTCAGGATTTTCTGACAGGTGCCTATCTCCTCACTCTTAAGGATACTTTCTTTGAC
CGAGCCAAAGCTTGTCAGATCATCGCTTCAATACTGGTGGGCAAGGATGAGAAAATTAAA
GTTCGTCTCCCACCCCCTACAATACTCAAGCCTGTCACCCTGTGGACGGGAAAGCAGATC
TTCAGTGTCATCCTGAGACCCAGCGATGACAATCCAGTGAGGGCCAACCTCCGAACCAAG
GGCAAGCAGTACTGCGGCAGAGGCGAGGACCTCTGTGTCAACGACTCCTACGTCACAATC
CAGAACAGCGAGCTGATGAGTGGCAGCATGGACAAAGGAACGCTGGGGTCAGGATCCAAG
AACAACATTTTTTACATTTTGCTGCGAGACTGGGGGCAGAATGAAGCTGCCGACGCGATG
TCACGGCTTGCCAGGCTGGCTCCCGTCTACTTGTCTAACCGTGGATTCTCAATCGGGATT
GGTGACGTCACACCTGGCCAAGGGCTGCTGAAGGCCAAGTATGAGTTGCTGAACGCTGGC
TACAAAAAATGCGATGAGTACATCGAAGCCCTGAACACAGGCAAGCTGCAGCAGCAGCCC
GGCTGCACCGCCGAGGAGACTCTGGAGGCTTTGATCCTGAAGGAGCTGTCCGTGATCCGT
GACCACGCAGGTAGCGCCTGCCTCCGGGAGCTGGATAAGAGCAACAGCCCCCTCACCATG
GCTCTGTGTGGTTCCAAAGGTTCCTTCATTAACATATCACAGATGATTGCCTGTGTGGGA
CAGCAAGCTATCAGTGGCTCGCGAGTGCCAGATGGCTTTGAAAACAGGTCCCTGCCTCAC
TTTGAAAAGCACTCAAAGCTCCCAGCTGCCAAAGGCTTTGTGGCTAATAGCTTTTATTCT
GGTTTGACACCAACCGAGTTTTTCTTCCACACGATGGCTGGCCGGGAAGGTCTGGTCGAC
ACAGCCGTGAAGACAGCTGAAACAGGATATATGCAGAGAAGGCTCGTCAAGTCCCTGGAA
GATCTTTGTTCACAGTATGACCTCACAGTCCGCAGCTCTACGGGCGATATCATCCAGTTC
ATTTACGGGGGAGACGGCTTAGATCCTGCAGCCATGGAAGGAAAAGATGAGCCCTTAGAG
TTTAAAAGGGTTCTGGACAACATCAAAGCAGTCTTCCCGTGCCGGAGCGAGCCTGCTCTC
AGTAAGAACGAGCTGCTCCTGAGCGCCGAGTCCATCATGAAGAAGAACGAGTTTCTCTGC
TGCCAGGACAGCTTCCTGCAGGAGATAAAAAAGTTTATCAAGGAGGTTTCTGAGAAGATC
AAGAAGACCAGAGATAAATACGGCATCAACGACAACGGCACGACAGAGCCCCGTGTGCTG
TACCAGTTGGACCGGATCACCCCCACCCAGATAGAGAAGTTTCTGGAGACGTGTAGGGAC
AAGTACATGAGGGCACAGATGGAGCCAGGTTCCGCAGTGGGCGCGCTCTGTGCCCAGAGC
ATTGGTGAGCCGGGCACCCAGATGACCCTGAAGACTTTCCACTTTGCGGGCGTGGCCTCC
ATGAACATCACCCTGGGCGTGCCCCGCATCAAAGAGATCATCAACGCCTCCAAGGCCATC
AGCACTCCCATCATCACAGCACAGCTGGACAAGGATGACGATGCAGATTATGCTCGTCTG
GTGAAAGGCAGAATTGAGAAAACCCTCTTGGGAGAGATTTCAGAGTATATCGAAGAAGTG
TTTCTTCCTGATGATTGCTTCATTCTCGTCAAGCTCTCCCTAGAACGGATCAGACTTCTG
AGGCTGGAAGTGAACGCTGAGACAGTGAGGTACTCCATCTGCATGTCCAAGCTGCGCGTG
AAGCCCGGCGACGTGGCCGTGCACGGCGAGGCAGTGGTGTGCGTCACCCCCCGAGAGAAC
AGCAAGAGCTCCATGTACTACGTGCTGCAGTTCCTGAAAGAGGATCTCCCCAAGGTGGTG
GTGCAGGGCATCCCGGAGGTGTCCCGAGCTGTCATCCACATTGATGAGCAGAGCGGGAAG
GAGAAGTACAAGCTCCTGGTGGAGGGGGATAACCTGCGGGCCGTCATGGCCACCCACGGC
GTGAAGGGCACCCGGACCACCTCCAACAACACGTACGAGGTGGAGAAAACCCTGGGCATC
GAAGCTGCCCGGACAACTATCATCAACGAGATCCAGTATACGATGGTCAACCACGGCATG
AGCATCGACCGGCGGCACGTCATGCTGCTCTCCGACCTCATGACCTACAAGGGTGAAGTC
CTGGGCATCACCAGGTTTGGCCTGGCCAAGATGAAGGAGAGCGTGCTGATGCTGGCCTCG
TTTGAGAAGACGGCCGACCACCTCTTTGACGCTGCCTACTTTGGGCAGAAGGACTCTGTG
TGTGGGGTGTCTGAATGCATCATCATGGGGATCCCCATGAACATTGGAACTGGACTCTTC
AAGCTGCTCCACAAGGCCAACAGGGACCCCAGCCCTCCCAGGAGGCCCCTCATCTTCGAC
ACAAACGAATTCCACATCCCCCTTGTCACCTAG
Enzyme 112 GenBank Gene ID BC134422 Link Image
Enzyme 112 GeneCard ID POLR3A Link Image
Enzyme 112 GenAtlas ID Not Available
Enzyme 112 HGNC ID Not Available
Enzyme 112 Chromosome Location Chromosome:1
Enzyme 112 Locus 10q22-q23
Enzyme 112 SNPs SNPJam Report Link Image
Enzyme 112 General References Not Available
Enzyme 112 Metabolite References Not Available
Enzyme 113 [top]
Enzyme 113 ID 515
Enzyme 113 Name Serine/threonine-protein kinase 38
Enzyme 113 Synonyms Not Available
Enzyme 113 Gene Name STK38
Enzyme 113 Protein Sequence >Serine/threonine-protein kinase 38
MAMTGSTPCSSMSSHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDE
EKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKIL
RKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMK
KDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKA
HRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYN
KLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRF
CCEWEHRIGAPGVEEIKNNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVATSNHPDTDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Enzyme 113 Number of Residues 465
Enzyme 113 Molecular Weight 54175.7
Enzyme 113 Theoretical pI 7.17
Enzyme 113 GO Classification
Function
Process
Component
Enzyme 113 General Function Involved in ATP binding
Enzyme 113 Specific Function ATP + a protein = ADP + a phosphoprotein
Enzyme 113 Pathways Not Available
Enzyme 113 Reactions Not Available
Enzyme 113 Pfam Domain Function
Enzyme 113 Signals
  • None
Enzyme 113 Transmembrane Regions
  • None
Enzyme 113 Essentiality Not Available
Enzyme 113 GenBank ID Protein 124829167 Link Image
Enzyme 113 UniProtKB/Swiss-Prot ID A2VDV2 Link Image
Enzyme 113 UniProtKB/Swiss-Prot Entry Name STK38_BOVIN Link Image
Enzyme 113 PDB ID Not Available
Enzyme 113 Cellular Location Not Available
Enzyme 113 Gene Sequence >1398 bp
ATGGCAATGACAGGCTCAACACCTTGCTCGTCCATGAGTAGTCACACAAAGGAAAGGGTG
ACGATGACCAAAGTGACACTGGAGAATTTTTATAGCAACCTTATTGCTCAACATGAAGAA
CGAGAAATGAGACAAAAGAAGTTAGAAAAAGTGATGGAAGAAGAAGGCCTCAAAGATGAA
GAGAAACGACTCCGGAGATCAGCGCATGCTCGGAAGGAAACAGAGTTTCTTCGTTTGAAG
AGAACAAGACTTGGACTGGAAGATTTTGAGTCCTTAAAAGTAATAGGCAGAGGAGCCTTT
GGTGAGGTGCGGCTTGTTCAGAAGAAAGATACGGGCCATGTGTATGCAATGAAAATACTT
CGTAAAGCAGATATGCTTGAAAAAGAGCAGGTTGGCCACATTCGTGCGGAGCGTGACATT
CTAGTGGAGGCAGACAGTTTGTGGGTTGTGAAAATGTTCTATAGTTTTCAGGATAAGCTA
AACCTCTACCTAATCATGGAGTTCCTGCCTGGAGGGGACATGATGACCCTGTTGATGAAA
AAAGACACGCTGACAGAAGAGGAAACTCAGTTTTATATAGCAGAAACAGTATTAGCCATA
GACTCTATTCACCAACTTGGCTTCATCCACAGAGACATCAAACCAGACAACCTTCTCCTG
GACAGCAAGGGCCATGTGAAGCTTTCTGACTTTGGCCTTTGCACAGGACTGAAAAAAGCA
CACAGGACGGAATTTTATAGAAATCTGAACCACAGCCTCCCCAGTGATTTCACTTTTCAG
AACATGAATTCCAAAAGGAAAGCAGAAACCTGGAAAAGAAATAGACGTCAGCTAGCCTTC
TCCACAGTAGGCACTCCTGACTACATTGCTCCTGAGGTGTTCATGCAGACCGGGTACAAC
AAGCTCTGTGATTGGTGGTCGCTGGGGGTGATCATGTATGAAATGCTCATTGGCTACCCA
CCTTTCTGTTCTGAGACCCCTCAAGAGACATATAAGAAGGTGATGAACTGGAAAGAAACT
TTGACTTTTCCTCCAGAAGTTCCTATTTCTGAGAAAGCCAAGGATCTAATTTTGAGATTC
TGCTGTGAATGGGAACATAGAATTGGAGCCCCTGGAGTTGAGGAAATCAAAAATAATTCT
TTTTTTGAAGGTGTTGACTGGGAACATATCAGAGAGAGACCTGCTGCAATATCTATTGAA
ATCAAAAGCATTGATGATACCTCAAACTTCGATGAGTTTCCAGAATCTGATATTCTTAAG
CCAACAGTGGCAACAAGTAATCACCCTGACACAGACTACAAGAACAAAGACTGGGTCTTC
ATCAATTACACCTACAAGCGCTTTGAGGGCCTGACTGCACGGGGGGCGATACCTTCCTAC
ATGAAAGCAGCAAAATAG
Enzyme 113 GenBank Gene ID BC133417 Link Image
Enzyme 113 GeneCard ID STK38 Link Image
Enzyme 113 GenAtlas ID Not Available
Enzyme 113 HGNC ID Not Available
Enzyme 113 Chromosome Location Chromosome:6
Enzyme 113 Locus 6p21
Enzyme 113 SNPs SNPJam Report Link Image
Enzyme 113 General References Not Available
Enzyme 113 Metabolite References Not Available
Enzyme 114 [top]
Enzyme 114 ID 516
Enzyme 114 Name Isocitrate dehydrogenase [NADP] cytoplasmic
Enzyme 114 Synonyms
  1. IDH
  2. Cytosolic NADP-isocitrate dehydrogenase
  3. Oxalosuccinate decarboxylase
  4. NADP(+)-specific ICDH
  5. IDP
Enzyme 114 Gene Name IDH1
Enzyme 114 Protein Sequence >Isocitrate dehydrogenase [NADP] cytoplasmic
MSQKIQGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEISYTPSDGSPKTVYLVHNFTESGGVAM
GMYNQDKSIEDFAHSSFQMALSKNWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSEFE
AQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETLTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLQLKLAQAKL
Enzyme 114 Number of Residues 414
Enzyme 114 Molecular Weight 46785.1
Enzyme 114 Theoretical pI 6.52
Enzyme 114 GO Classification
Function
Process
Component
Enzyme 114 General Function Energy production and conversion
Enzyme 114 Specific Function May act as a corneal epithelial crystallin and may be involved in maintaining corneal epithelial transparency
Enzyme 114 Pathways Not Available
Enzyme 114 Reactions Not Available
Enzyme 114 Pfam Domain Function
Enzyme 114 Signals
  • None
Enzyme 114 Transmembrane Regions
  • None
Enzyme 114 Essentiality Not Available
Enzyme 114 GenBank ID Protein 4959708 Link Image
Enzyme 114 UniProtKB/Swiss-Prot ID Q9XSG3 Link Image
Enzyme 114 UniProtKB/Swiss-Prot Entry Name IDHC_BOVIN Link Image
Enzyme 114 PDB ID 1T0L Link Image
Enzyme 114 PDB File Show
Enzyme 114 3D Structure
Enzyme 114 Cellular Location Not Available
Enzyme 114 Gene Sequence >1245 bp
ATGTCTCAAAAAATCCAAGGCGGGTCTGTGGTAGAGATGCAAGGAGATGAAATGACACGG
ATCATTTGGGAGTTGATTAAAGAGAAACTCATTTTTCCCTACGTGGAACTGGACCTGCAC
AGCTACGATTTAGGCATAGAGAATCGCGATGCCACCAACGACCAGGTCACCAAGGACGCT
GCAGAAGCTATAAAGAAGTACAACGTTGGTGTCAAGTGTGCCACCATCACCCCCGATGAG
AAGAGAGTGGAGGAATTCAAGTTGAAACAAATGTGGAAGTCTCCAAATGGCACCATCCGA
AATATCCTGGGTGGCACTGTCTTCAGGGAAGCTATTATCTGCAAAAATATACCCCGGCTT
GTGAGCGGATGGGTAAAACCCATTATCATAGGTCGTCATGCTTATGGGGATCAATATAGA
GCAACCGATTTTGTTGTGCCAGGGCCTGGAAAAGTAGAGATATCCTACACACCAAGCGAT
GGATCCCCCAAAACGGTATACCTAGTACATAACTTCACAGAGAGTGGTGGTGTTGCCATG
GGGATGTACAATCAAGATAAGTCAATCGAAGATTTTGCGCACAGTTCTTTCCAGATGGCT
TTGTCTAAGAACTGGCCTTTGTATCTGAGCACCAAAAACACTATTCTGAAGAAATACGAT
GGACGTTTTAAAGACATCTTTCAGGAGATATATGACAAGCAGTACAAATCTGAGTTTGAA
GCTCAGAATATCTGGTATGAGCACAGGCTCATTGATGACATGGTGGCCCAAGCTATGAAA
TCGGAGGGGGGCTTCATTTGGGCCTGTAAGAACTATGATGGGGACGTGCAGTCGGACTCC
GTGGCCCAAGGTTATGGCTCTCTCGGCATGATGACCAGTGTGCTGGTTTGTCCAGATGGC
AAGACAGTAGAAGCAGAGGCTGCCCACGGGACTGTAACCCGTCACTACCGAATGTACCAG
AAAGGACAGGAGACATTGACCAATCCCATTGCTTCCATTTTTGCCTGGACCAGAGGCTTA
GCCCACAGAGCTAAGCTTGATAACAATAAAGAGCTCAGCTTTTTTGCAAAGGCTTTGGAA
GAAGTCTGTATTGAGACCATTGAGGCTGGCTTCATGACCAAGGACTTAGCTGCATGTATT
AAAGGTTTACCCAACGTGCAACGTTCTGACTACTTGAATACATTTGAGTTCATGGATAAA
CTCGGAGAGAACCTGCAGTTAAAACTAGCCCAGGCCAAACTTTAA
Enzyme 114 GenBank Gene ID AF136009 Link Image
Enzyme 114 GeneCard ID IDH1 Link Image
Enzyme 114 GenAtlas ID Not Available
Enzyme 114 HGNC ID Not Available
Enzyme 114 Chromosome Location Chromosome:2
Enzyme 114 Locus 2q33.3
Enzyme 114 SNPs SNPJam Report Link Image
Enzyme 114 General References
  1. [PubMed Link Image]
Enzyme 114 Metabolite References Not Available
Enzyme 115 [top]
Enzyme 115 ID 517
Enzyme 115 Name Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial
Enzyme 115 Synonyms
  1. Endopeptidase Clp
Enzyme 115 Gene Name CLPP
Enzyme 115 Protein Sequence >Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial
MWPKILLRGGRVAAGLCPALGPRLAARFPPQRTPENRLAPQRNLHATAARALPLIPIVVE
QTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGG
VVTSGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGA
RGQATDIAIQAEEIMKLKKQLYSIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKV
LVHPPQDGEDEPELVQKEPGEPTAVEPAPASA
Enzyme 115 Number of Residues 272
Enzyme 115 Molecular Weight 29704.2
Enzyme 115 Theoretical pI 8.32
Enzyme 115 GO Classification
Function
Process
Component
Enzyme 115 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 115 Specific Function Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates
Enzyme 115 Pathways Not Available
Enzyme 115 Reactions Not Available
Enzyme 115 Pfam Domain Function
Enzyme 115 Signals
  • None
Enzyme 115 Transmembrane Regions
  • None
Enzyme 115 Essentiality Not Available
Enzyme 115 GenBank ID Protein 86826474 Link Image
Enzyme 115 UniProtKB/Swiss-Prot ID Q2KHU4 Link Image
Enzyme 115 UniProtKB/Swiss-Prot Entry Name CLPP_BOVIN Link Image
Enzyme 115 PDB ID Not Available
Enzyme 115 Cellular Location Not Available
Enzyme 115 Gene Sequence >819 bp
ATGTGGCCCAAAATATTGCTTAGGGGGGGCCGGGTGGCGGCCGGCTTGTGCCCAGCACTG
GGGCCTCGCCTCGCCGCCCGCTTTCCCCCGCAGCGGACGCCCGAGAATCGCCTGGCCCCG
CAGCGGAACCTGCACGCGACGGCGGCCCGGGCTCTCCCGCTCATTCCCATCGTGGTGGAG
CAGACGGGTCGCGGTGAGCGCGCCTATGACATCTACTCGCGGCTGCTTCGGGAGCGTATT
GTGTGCGTCATGGGCCCTATCGATGACAGTGTCGCCAGCCTGGTCATCGCGCAGCTGCTG
TTCCTGCAGTCGGAAAGCAACAAGAAGCCCATCCACATGTATATCAACAGCCCCGGTGGC
GTGGTGACCTCGGGCCTGGCCATCTACGACACGATGCAATACATCCTGAACCCCATCTGC
ACGTGGTGTGTGGGCCAGGCAGCCAGCATGGGCTCCCTGCTTCTGGCTGCTGGCACCCCA
GGCATGCGCCACTCACTCCCCAACTCCCGCATCATGATCCACCAGCCCTCTGGGGGTGCC
CGGGGCCAAGCCACAGACATCGCCATCCAGGCAGAGGAGATCATGAAGCTCAAGAAGCAG
CTCTACAGCATCTACGCCAAGCACACCAAACAGAGCCTGCAGGTGATCGAGTCAGCCATG
GAGAGGGACCGCTACATGAGCCCCATGGAGGCCCAGGAGTTCGGCATCTTGGACAAGGTT
CTGGTCCACCCCCCACAGGATGGGGAGGATGAGCCGGAGCTGGTACAGAAGGAGCCGGGG
GAGCCAACAGCAGTAGAACCCGCCCCAGCCAGCGCCTGA
Enzyme 115 GenBank Gene ID BC112880 Link Image
Enzyme 115 GeneCard ID CLPP Link Image
Enzyme 115 GenAtlas ID Not Available
Enzyme 115 HGNC ID Not Available
Enzyme 115 Chromosome Location Chromosome:1
Enzyme 115 Locus 19p13.3
Enzyme 115 SNPs SNPJam Report Link Image
Enzyme 115 General References Not Available
Enzyme 115 Metabolite References Not Available
Enzyme 116 [top]
Enzyme 116 ID 518
Enzyme 116 Name Nucleoside diphosphate kinase A 2
Enzyme 116 Synonyms
  1. NDP kinase A 2
  2. NDK A 2
  3. Nucleoside diphosphate kinase NBR-B
  4. NDK NBR-B
Enzyme 116 Gene Name NME1-2
Enzyme 116 Protein Sequence >Nucleoside diphosphate kinase A 2
MANSERTFIAIKPDGVQRGLMGEIIKRFEQKGFRLVAMKFMRASEDLLKEHYIDLKDRPF
FAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIALWFRPEELVNYKSCAQNWIYE
Enzyme 116 Number of Residues 152
Enzyme 116 Molecular Weight 17297.9
Enzyme 116 Theoretical pI 8.21
Enzyme 116 GO Classification
Function
Process
Component
Enzyme 116 General Function Nucleotide transport and metabolism
Enzyme 116 Specific Function Major role in the synthesis of nucleoside triphosphates other than ATP. Possesses nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease activities. Involved in cell proliferation, differentiation and development, signal transduction, G protein- coupled receptor endocytosis, and gene expression. Required for neural development including neural patterning and cell fate determination
Enzyme 116 Pathways Not Available
Enzyme 116 Reactions Not Available
Enzyme 116 Pfam Domain Function
Enzyme 116 Signals
  • None
Enzyme 116 Transmembrane Regions
  • None
Enzyme 116 Essentiality Not Available
Enzyme 116 GenBank ID Protein 1064897 Link Image
Enzyme 116 UniProtKB/Swiss-Prot ID P52175 Link Image
Enzyme 116 UniProtKB/Swiss-Prot Entry Name NDKA2_BOVIN Link Image
Enzyme 116 PDB ID 1BE4 Link Image
Enzyme 116 PDB File Show
Enzyme 116 3D Structure
Enzyme 116 Cellular Location Not Available
Enzyme 116 Gene Sequence >459 bp
ATGGCCAACAGCGAGCGCACCTTCATTGCCATCAAGCCCGATGGAGTCCAGCGAGGCCTC
ATGGGAGAAATAATCAAGCGTTTTGAGCAAAAGGGATTCCGTCTTGTTGCCATGAAATTC
ATGCGGGCTTCTGAAGACCTTCTCAAGGAGCACTATATTGACCTGAAGGACCGTCCATTC
TTTGCTGGCCTGGTGAAATACATGCACTCAGGGCCCGTGGTTGCCATGGTCTGGGAGGGA
CTGAATGTTGTGAAGACAGGTCGAGTGATGCTTGGGGAGACTAACCCTGCGGACTCCAAG
CCTGGGACCATCCGTGGTGACTTTTGCATCCAAGTTGGCAGGAACATTATCCATGGCAGT
GATTCCGTGGAGAGTGCAGAGAAGGAGATTGCCTTGTGGTTTCGCCCTGAGGAACTGGTG
AATTACAAGAGCTGTGCTCAGAACTGGATCTACGAGTGA
Enzyme 116 GenBank Gene ID X92957 Link Image
Enzyme 116 GeneCard ID NME1-2 Link Image
Enzyme 116 GenAtlas ID Not Available
Enzyme 116 HGNC ID Not Available
Enzyme 116 Chromosome Location Not Available
Enzyme 116 Locus Not Available
Enzyme 116 SNPs SNPJam Report Link Image
Enzyme 116 General References
  1. [PubMed Link Image]
Enzyme 116 Metabolite References Not Available
Enzyme 117 [top]
Enzyme 117 ID 519
Enzyme 117 Name Fumarylacetoacetate hydrolase domain-containing protein 1
Enzyme 117 Synonyms Not Available
Enzyme 117 Gene Name FAHD1
Enzyme 117 Protein Sequence >Fumarylacetoacetate hydrolase domain-containing protein 1
MAASRPLSRFWEWGKNIVCVGRNYADHVREMQSAAPSEPVLFLKPSTAYAPEGSPVLVPA
YTRNLHHELELAVVMGKRCRAVSEAAAMDYVAGYALCLDMTARDVQDECKKKGLPWTLAK
SFTASCPVSAFVPKEKIPDPHNLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIMTLE
EGDIILTGTPKGVGPVKENDEIQAGIHGVLSMKFKVERPEY
Enzyme 117 Number of Residues 221
Enzyme 117 Molecular Weight 24499.2
Enzyme 117 Theoretical pI 7.45
Enzyme 117 GO Classification
Function
Process
Component
Enzyme 117 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 117 Specific Function May have hydrolase activity
Enzyme 117 Pathways Not Available
Enzyme 117 Reactions Not Available
Enzyme 117 Pfam Domain Function
Enzyme 117 Signals
  • None
Enzyme 117 Transmembrane Regions
  • None
Enzyme 117 Essentiality Not Available
Enzyme 117 GenBank ID Protein 87578205 Link Image
Enzyme 117 UniProtKB/Swiss-Prot ID Q2HJ98 Link Image
Enzyme 117 UniProtKB/Swiss-Prot Entry Name FAHD1_BOVIN Link Image
Enzyme 117 PDB ID 1SAW Link Image
Enzyme 117 PDB File Show
Enzyme 117 3D Structure
Enzyme 117 Cellular Location Not Available
Enzyme 117 Gene Sequence >666 bp
ATGGCCGCCAGCAGGCCGCTGTCCCGCTTCTGGGAGTGGGGGAAGAACATCGTGTGCGTG
GGCCGGAACTACGCGGACCACGTCCGGGAGATGCAGAGCGCCGCGCCCAGCGAGCCGGTG
CTCTTCCTGAAGCCGTCCACCGCCTACGCCCCCGAGGGCTCGCCGGTGCTCGTGCCCGCC
TACACCCGCAACCTGCATCACGAGCTCGAGCTCGCCGTGGTGATGGGCAAGCGCTGCCGC
GCCGTCTCGGAGGCCGCGGCCATGGACTACGTGGCCGGCTATGCCCTGTGCCTGGACATG
ACCGCCAGGGACGTGCAAGACGAGTGCAAGAAGAAGGGGCTGCCCTGGACTCTGGCCAAG
AGTTTCACGGCCTCCTGCCCGGTCAGTGCCTTCGTGCCCAAAGAGAAGATCCCTGACCCT
CACAACCTGAAGCTCTGGCTCAAGGTCAACGGCGAACTCAGGCAGGAGGGTGAGACATCC
TCCATGATTTTTTCCATCCCCTACATCATCAGCTACGTTTCTAAGATCATGACCTTGGAA
GAAGGAGATATTATCTTGACCGGGACGCCAAAGGGAGTGGGACCCGTTAAAGAAAATGAT
GAGATCCAGGCCGGCATACATGGCGTCCTCAGTATGAAGTTTAAGGTGGAGAGGCCAGAA
TATTGA
Enzyme 117 GenBank Gene ID BC113240 Link Image
Enzyme 117 GeneCard ID FAHD1 Link Image
Enzyme 117 GenAtlas ID Not Available
Enzyme 117 HGNC ID Not Available
Enzyme 117 Chromosome Location Chromosome:1
Enzyme 117 Locus 16p13.3
Enzyme 117 SNPs SNPJam Report Link Image
Enzyme 117 General References Not Available
Enzyme 117 Metabolite References Not Available
Enzyme 118 [top]
Enzyme 118 ID 520
Enzyme 118 Name Three prime repair exonuclease 1
Enzyme 118 Synonyms
  1. 3'-5' exonuclease TREX1
Enzyme 118 Gene Name TREX1
Enzyme 118 Protein Sequence >Three prime repair exonuclease 1
MGSRALPPGPVQTLIFLDLEATGLPFSQPKITELCLLAVHRYALEGLSAPQGPSPTAPVP
PRVLDKLSLCVAPGKVCSPAASEITGLSTAVLAAHGRRAFDADLVNLIRTFLQRQPQPWC
LVAHNGDRYDFPLLRAELALLGLASALDDAFCVDSIAALKALEPTGSSSEHGPRKSYSLG
SVYTRLYGQAPPDSHTAEGDVLALLSVCQWRPRALLRWVDAHAKPFSTVKPMYVITTSTG
TNPRPSAVTATVPLARASDTGPNLRGDRSPKPAPSPKMCPGAPPGEGLLAPLGLLAFLTL
AVAMLYGLSLAMPGQ
Enzyme 118 Number of Residues 315
Enzyme 118 Molecular Weight 33131.9
Enzyme 118 Theoretical pI 8.48
Enzyme 118 GO Classification
Function
Process
Component
Enzyme 118 General Function Involved in 3'-5' exonuclease activity
Enzyme 118 Specific Function Exonuclease with a preference for double stranded DNA with mismatched 3' termini. May play a role in DNA repair
Enzyme 118 Pathways Not Available
Enzyme 118 Reactions Not Available
Enzyme 118 Pfam Domain Function
Enzyme 118 Signals
  • None
Enzyme 118 Transmembrane Regions
  • None
Enzyme 118 Essentiality Not Available
Enzyme 118 GenBank ID Protein 12751327 Link Image
Enzyme 118 UniProtKB/Swiss-Prot ID Q9BG99 Link Image
Enzyme 118 UniProtKB/Swiss-Prot Entry Name TREX1_BOVIN Link Image
Enzyme 118 PDB ID Not Available
Enzyme 118 Cellular Location Not Available
Enzyme 118 Gene Sequence >948 bp
ATGGGCTCTCGGGCCCTGCCCCCGGGGCCTGTGCAGACCCTCATCTTCCTGGACTTGGAG
GCCACCGGCCTGCCCTTCTCCCAGCCCAAGATCACCGAGCTGTGCCTGCTGGCCGTCCAC
AGATATGCCCTGGAGGGCCTTTCTGCGCCTCAGGGGCCTTCGCCAACGGCACCCGTGCCG
CCCCGGGTGCTGGACAAGCTCTCCCTGTGCGTGGCTCCAGGGAAGGTGTGCAGCCCCGCG
GCCAGCGAAATCACAGGCCTGAGCACCGCCGTGCTGGCTGCACATGGGCGTCGGGCCTTT
GACGCTGACCTGGTCAACCTGATCCGTACCTTCCTACAGCGCCAGCCGCAGCCTTGGTGC
CTCGTGGCCCACAATGGTGACCGCTACGACTTCCCCCTGCTCCGGGCCGAGCTGGCACTG
CTGGGCCTGGCCAGTGCTCTGGACGACGCCTTCTGTGTGGACAGCATCGCTGCCCTGAAG
GCTCTGGAGCCGACTGGCAGCTCCTCGGAGCACGGCCCAAGGAAGAGCTACAGCCTGGGC
AGCGTCTACACACGCCTGTACGGGCAGGCCCCGCCAGACTCGCACACCGCCGAGGGGGAC
GTGCTCGCCCTGCTGAGCGTCTGTCAGTGGAGGCCGCGGGCCCTGCTACGGTGGGTGGAT
GCTCACGCCAAGCCCTTCAGCACCGTCAAGCCAATGTACGTGATCACAACCTCTACTGGA
ACCAACCCAAGGCCATCTGCTGTCACAGCCACTGTGCCCCTGGCCAGAGCCAGTGACACC
GGCCCCAACCTTCGTGGTGACAGGAGCCCCAAGCCAGCTCCTTCCCCAAAGATGTGCCCT
GGAGCCCCACCCGGGGAAGGGCTGCTGGCCCCCCTGGGTCTGCTGGCCTTCCTGACTTTG
GCGGTAGCCATGCTGTATGGGCTGTCCCTGGCCATGCCCGGGCAGTAG
Enzyme 118 GenBank Gene ID AF319575 Link Image
Enzyme 118 GeneCard ID TREX1 Link Image
Enzyme 118 GenAtlas ID Not Available
Enzyme 118 HGNC ID Not Available
Enzyme 118 Chromosome Location Chromosome:3
Enzyme 118 Locus 3p21.31
Enzyme 118 SNPs SNPJam Report Link Image
Enzyme 118 General References
  1. [PubMed Link Image]
Enzyme 118 Metabolite References Not Available
Enzyme 119 [top]
Enzyme 119 ID 521
Enzyme 119 Name Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
Enzyme 119 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
  3. Isocitrate dehydrogenase subunits 3/4
Enzyme 119 Gene Name IDH3A
Enzyme 119 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
MAGPAWISKVSRLLGAFHNQKQVTRGFAGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAP
IQWEERNVAAIQGPGGKWMIPPEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYHDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEAASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAENCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAAKIETACFATIKDGKSLTKDLGGNSKCSDFTEEICR
RVKDLD
Enzyme 119 Number of Residues 366
Enzyme 119 Molecular Weight 39667.5
Enzyme 119 Theoretical pI 7.22
Enzyme 119 GO Classification
Function
Process
Component
Enzyme 119 General Function Energy production and conversion
Enzyme 119 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 119 Pathways Not Available
Enzyme 119 Reactions Not Available
Enzyme 119 Pfam Domain Function
Enzyme 119 Signals
  • None
Enzyme 119 Transmembrane Regions
  • None
Enzyme 119 Essentiality Not Available
Enzyme 119 GenBank ID Protein 902743 Link Image
Enzyme 119 UniProtKB/Swiss-Prot ID P41563 Link Image
Enzyme 119 UniProtKB/Swiss-Prot Entry Name IDH3A_BOVIN Link Image
Enzyme 119 PDB ID Not Available
Enzyme 119 Cellular Location Not Available
Enzyme 119 Gene Sequence >1101 bp
ATGGCAGGGCCCGCGTGGATCTCCAAGGTCTCTCGGCTGCTGGGGGCATTCCACAACCAA
AAACAGGTGACCAGAGGTTTTGCTGGTGGTGTTAAGACAGTAACTTTAATTCCAGGAGAT
GGAATTGGCCCAGAAATTTCTGCTGCAGTTATGAAGATTTTTGATGCTGCCAAAGCACCT
ATTCAGTGGGAGGAGCGAAACGTCGCCGCCATTCAAGGTCCGGGAGGCAAGTGGATGATC
CCTCCAGAAGCCAAAGAGTCCATGGATAAGAACAAGATGGGCTTGAAAGGCCCTTTAAAA
ACACCAATAGCTGCTGGTCACCCATCTATGAATTTATTGCTGCGTAAAACATTTGACCTT
TATGCAAATGTCCGACCATGTGTCTCAATCGAAGGCTATAAAACCCCTTACCATGATGTA
AATATTGTCACCATTCGAGAGAACACGGAAGGAGAATACAGTGGAATCGAGCATGTGATC
GTGGATGGAGTTGTGCAGAGTATCAAGCTCATCACCGAGGCAGCGAGCAAGCGCATCGCG
GAGTTTGCATTTGAATACGCACGGAACAACCACCGGAGCAACGTCACAGCCGTGCACAAA
GCCAACATCATGCGAATGTCAGATGGGCTTTTTCTGCAAAAATGCAGGGAAGTTGCAGAA
AACTGTAAAGATATTAAATTTAATGAGATGTACCTTGATACAGTATGTTTGAATATGGTC
CAAGACCCGTCCCAGTTTGATGTTCTTGTTATGCCAAATTTGTATGGAGACATCCTTAGT
GACCTGTGTGCGGGATTGATTGGAGGTCTTGGTGTGACACCAAGCGGCAACATTGGAGCC
AACGGAGTTGCAATCTTCGAGTCGGTTCACGGGACCGCCCCGGACATTGCGGGCAAGGAC
ATGGCCAATCCCACAGCCCTCCTGCTCAGCGCCGTGATGATGCTGCGCCACATGGGGCTT
TTTGACCACGCTGCGAAGATTGAGACGGCGTGTTTTGCTACAATTAAGGATGGAAAGAGC
TTAACCAAAGATTTGGGAGGCAATTCAAAGTGCTCGGACTTCACAGAAGAAATCTGTCGC
CGAGTAAAAGATTTAGATTAA
Enzyme 119 GenBank Gene ID U07980 Link Image
Enzyme 119 GeneCard ID IDH3A Link Image
Enzyme 119 GenAtlas ID Not Available
Enzyme 119 HGNC ID Not Available
Enzyme 119 Chromosome Location Chromosome:1
Enzyme 119 Locus 15q25.1-q25.2
Enzyme 119 SNPs SNPJam Report Link Image
Enzyme 119 General References
  1. [PubMed Link Image]
Enzyme 119 Metabolite References Not Available
Enzyme 120 [top]
Enzyme 120 ID 522
Enzyme 120 Name ADP-dependent glucokinase
Enzyme 120 Synonyms
  1. ADP-GK
  2. ADPGK
Enzyme 120 Gene Name ADPGK
Enzyme 120 Protein Sequence >ADP-dependent glucokinase
MALWRGSAYAGFLALAVGCVFLLEPQLPGSALRSLWSSLQLGPAPAPPGVGSPEGRLAAA
WDALIVRPARRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSELHSRNDLEEAFV
HFMGKGAAAERFFSDKETFHDIAQVASEFPEAQHYVGGNAALIGQKFAANSDLKVLLCGP
VGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWDQLKAPHANRFIFSHDLSNGAM
NMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKEFQRKRLLEVVTSISDIPTGVPVHLELAS
MTNKELMSTIVHQQVFPAVTSLGLNEQELLFLSQSASGPHSSLSSWNGVPDVGVVSDILF
WILKEHGKSESRASDLSRIHFHTLAYHILATVDGHWANQLAAVAAGARVAATQACATETI
DTRRVSLKAPHEFMTSRLEAGSRVVLNPNEPVVEWHREGVSFHFTPVLVCKDPVRTVGLG
DAISAEGLFYSEVHPHL
Enzyme 120 Number of Residues 497
Enzyme 120 Molecular Weight 54085.1
Enzyme 120 Theoretical pI 5.81
Enzyme 120 GO Classification
Function
Process
Component
Enzyme 120 General Function Involved in ADP-specific glucokinase activity
Enzyme 120 Specific Function Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency
Enzyme 120 Pathways
  • Carbohydrate degradation
  • glycolysis
Enzyme 120 Reactions Not Available
Enzyme 120 Pfam Domain Function
Enzyme 120 Signals
  • 1-22
Enzyme 120 Transmembrane Regions
  • None
Enzyme 120 Essentiality Not Available
Enzyme 120 GenBank ID Protein 126010731 Link Image
Enzyme 120 UniProtKB/Swiss-Prot ID A2VE47 Link Image
Enzyme 120 UniProtKB/Swiss-Prot Entry Name ADPGK_BOVIN Link Image
Enzyme 120 PDB ID Not Available
Enzyme 120 Cellular Location Not Available
Enzyme 120 Gene Sequence >1494 bp
ATGGCGCTGTGGCGCGGCTCCGCGTACGCTGGCTTCCTGGCGCTCGCGGTGGGCTGCGTC
TTCCTGCTGGAGCCGCAGCTGCCGGGGTCGGCCCTGCGCTCGCTGTGGAGTTCGCTGCAG
CTGGGGCCCGCGCCCGCGCCCCCAGGAGTCGGCTCCCCTGAGGGCCGGTTGGCAGCCGCC
TGGGACGCGCTCATCGTGCGGCCGGCCCGGCGTTGGCGCCGCGTGGCCGTGGGCGTCAAT
GCCTGTGTAGACGTAGTGCTGTCAGGGGTGAAGCTCTTGCAGGCCCTTGGCTTGAGTCCT
GGGAATGGGAAAGATCACAGCGAGCTGCATTCGAGGAATGATCTAGAAGAAGCCTTCGTT
CACTTCATGGGGAAAGGAGCAGCTGCTGAACGCTTCTTCAGTGATAAGGAAACTTTCCAT
GACATTGCCCAGGTTGCATCAGAGTTCCCAGAAGCCCAGCACTATGTAGGAGGAAATGCA
GCTTTAATTGGACAGAAGTTTGCAGCCAACTCAGATTTAAAGGTTCTTCTTTGTGGTCCA
GTTGGTCCAAAGCTGCATGAGCTCCTTGATGACAATGTATTTGTCCCACCAGAGTCATTG
CAGGAAGTGGATGAGTTCCACCTCATTTTAGAGTATCAAGCAGGGGAGGAGTGGGACCAG
TTAAAAGCTCCCCATGCCAACCGGTTCATCTTCTCCCACGACCTCTCCAACGGGGCCATG
AATATGCTGGAGGTGTTTGTGTCTAGCCTGGAGGAGTTTCAGCCAGACCTTGTGGTCCTC
TCTGGATTGCACATGATGGAGGGACAGAGCAAGGAGTTCCAGAGGAAGAGGCTCTTGGAG
GTCGTGACCTCCATTTCTGACATCCCTACGGGTGTTCCAGTTCACCTGGAGCTGGCCAGC
ATGACCAACAAGGAGCTCATGAGCACCATTGTGCACCAGCAGGTCTTTCCTGCCGTGACT
TCCCTGGGGCTGAATGAACAGGAGCTGTTATTTCTCAGCCAGTCGGCATCTGGACCTCAC
TCTTCTCTTTCTTCCTGGAATGGTGTTCCTGATGTGGGCGTGGTCAGCGACATCCTCTTT
TGGATCTTGAAGGAACATGGGAAAAGTGAAAGCAGAGCCTCTGACCTCAGCAGGATCCAT
TTCCACACGCTGGCCTACCACATCCTGGCGACTGTGGATGGACACTGGGCCAACCAGCTG
GCTGCTGTGGCTGCAGGCGCCCGCGTGGCGGCGACACAGGCCTGCGCGACGGAGACCATA
GACACCCGCCGCGTATCTCTGAAGGCACCCCACGAGTTCATGACCTCCCGTTTGGAGGCC
GGCTCCAGGGTTGTGTTAAACCCAAATGAGCCAGTGGTCGAATGGCACAGGGAGGGCGTG
TCCTTCCACTTCACACCAGTGTTGGTGTGTAAAGATCCTGTTCGAACTGTGGGCCTCGGA
GATGCCATCTCAGCCGAAGGACTCTTCTATTCAGAAGTACACCCTCACTTGTAG
Enzyme 120 GenBank Gene ID BC133568 Link Image
Enzyme 120 GeneCard ID ADPGK Link Image
Enzyme 120 GenAtlas ID Not Available
Enzyme 120 HGNC ID Not Available
Enzyme 120 Chromosome Location Chromosome:1
Enzyme 120 Locus 15q24.1
Enzyme 120 SNPs SNPJam Report Link Image
Enzyme 120 General References Not Available
Enzyme 120 Metabolite References Not Available
Enzyme 121 [top]
Enzyme 121 ID 523
Enzyme 121 Name 6-phosphofructokinase, muscle type
Enzyme 121 Synonyms
  1. Phosphofructokinase 1
  2. Phosphohexokinase
  3. Phosphofructo-1-kinase isozyme A
  4. PFK-A
  5. Phosphofructokinase-M
Enzyme 121 Gene Name PFKM
Enzyme 121 Protein Sequence >6-phosphofructokinase, muscle type
MTHEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVDG
GDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDGS
LTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSA
LHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEE
HLCRRLSETRNRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTRA
MDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPKSKSGSHTVAVMNVGAPAAGMNAAVRS
TVRIGLIQGNRMLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQI
SANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATVSNNVPGSDFSVG
ADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEDPFT
IRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGH
MQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANSPDSGCVLGMRKRALVFQ
PVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEANV
Enzyme 121 Number of Residues 779
Enzyme 121 Molecular Weight 85293.0
Enzyme 121 Theoretical pI 8.37
Enzyme 121 GO Classification
Function
Process
Component
Enzyme 121 General Function Carbohydrate transport and metabolism
Enzyme 121 Specific Function ATP + D-fructose 6-phosphate = ADP + D- fructose 1,6-bisphosphate
Enzyme 121 Pathways
  • Carbohydrate degradation
  • glycolysis
  • D-glyceraldehyde 3- phosphate and glycerone phosphate from D-glucose:step 3/4
Enzyme 121 Reactions Not Available
Enzyme 121 Pfam Domain Function
Enzyme 121 Signals
  • None
Enzyme 121 Transmembrane Regions
  • None
Enzyme 121 Essentiality Not Available
Enzyme 121 GenBank ID Protein 113911829 Link Image
Enzyme 121 UniProtKB/Swiss-Prot ID Q0IIG5 Link Image
Enzyme 121 UniProtKB/Swiss-Prot Entry Name K6PF_BOVIN Link Image
Enzyme 121 PDB ID Not Available
Enzyme 121 Cellular Location Not Available
Enzyme 121 Gene Sequence >2340 bp
ATGACCCATGAGCACCATGCAGCCAAAACCCTGGGAATCGGCAAAGCCATCGCCGTGTTA
ACCTCTGGTGGCGATGCCCAAGGTATGAATGCTGCTGTCAGGGCTGTGGTTCGTGTTGGC
ATCTATACTGGTGCCCGTGTCTTCTTTGTCCATGAGGGTTATCAAGGCCTGGTAGATGGT
GGAGATAACATCCGGGAAGCCACATGGGAGAGTGTCTCGATGATGCTTCAGCTGGGAGGC
ACGGTGATTGGAAGCGCCCGGTGCAAGGACTTTCGGGAACGGGAAGGCCGGCTCCGAGCT
GCCCACAACCTGGTGAAACGTGGGATCACCAACCTGTGTGTCATTGGGGGAGACGGCAGC
CTGACTGGGGCCGACACCTTCCGCTCTGAGTGGAGTGACTTGTTGAGTGACCTCCAGAAA
TCAGGCAAGATTACAGCAGAGGAGGCTACCAAGTCCAGCTACCTGAACATCGTGGGGCTG
GTTGGCTCAATTGACAATGACTTCTGTGGCACTGATATGACCATTGGCACCGACTCTGCC
CTGCACCGGATCATAGAGATTGTAGATGCCATCACTACTACCGCTCAGAGCCACCAGAGG
ACCTTTGTGTTGGAGGTGATGGGCCGGCACTGTGGATACCTGGCCCTTGTCACTTCCCTC
TCCTGTGGGGCCGACTGGGTCTTTATTCCCGAGTGTCCACCAGATGACGACTGGGAGGAA
CACCTTTGTCGCCGGCTCAGCGAGACAAGGAACCGTGGTTCTCGTCTCAACATCATCATC
GTAGCTGAGGGTGCGATTGACAAGAATGGGAAACCAATCACCTCTGAAGACATCAAAAAC
CTGGTGGTTAAGCGTCTGGGATATGACACCCGAGTCACCGTCTTGGGGCACGTGCAGCGG
GGTGGGACACCGTCGGCCTTTGACAGAATCCTGGGCAGCAGGATGGGTGTGGAAGCAGTA
ATGGCACTTTTGGAGGGGACCCCGGACACCCCAGCCTGTGTGGTGAGCCTCTCTGGTAAC
CAGGCTGTGCGCCTGCCCCTCATGGAGTGTGTCCAGGTGACCAAGGACGTGACCAGGGCC
ATGGATGAAAGGAGATTCGATGAGGCCTTGAAGCTGAGGGGCCGGAGCTTCATGAACAAC
TGGGAGGTATACAAGCTTCTGGCTCACGTCAGACCCCCAAAGTCTAAGAGTGGCTCCCAC
ACGGTGGCCGTGATGAACGTGGGAGCGCCGGCCGCAGGCATGAACGCAGCCGTTCGCTCC
ACTGTGAGAATCGGCCTCATCCAGGGCAACCGAATGCTGGTGGTGCACGATGGCTTCGAG
GGCCTGGCCAAGGGTCAGATCGAGGAAGCTGGATGGAGCTACGTCGGGGGCTGGACTGGC
CAAGGTGGTTCTAAACTTGGGACTAAAAGGACTCTACCCAAGAAGAGCTTTGAACAGATC
AGTGCCAACATCACGAAGTTTAATATTCAGGGCCTTGTCATTATCGGGGGCTTTGAGGCT
TACACGGGGGGCCTGGAGCTGATGGAAGGCAGGAAGCAGTATGATGAGCTCTGCATCCCC
TTCGTGGTCATCCCTGCCACGGTCTCCAACAATGTGCCCGGCTCGGACTTCAGCGTGGGG
GCTGACACTGCCCTCAACACCATCTGCATGACGTGTGACCGCATCAAGCAGTCAGCGGCA
GGCACCAAGCGCCGTGTGTTTATCATTGAAACGATGGGCGGCTACTGTGGCTACCTGGCC
ACCATGGCAGGCCTGGCAGCTGGGGCTGATGCTGCGTATATTTTTGAGGACCCCTTCACC
ATTCGAGACCTGCAGGTGAATGTGGAGCATCTGGTGCAGAAGATGAAAACGACTGTGAAG
AGGGGCCTGGTGTTAAGGAACGAGAAGTGCAATGAGAACTACACCACTGACTTCATCTTC
AACTTGTACTCTGAGGAGGGGAAGGGCATCTTCGACAGCAGGAAGAACGTGCTGGGCCAC
ATGCAGCAGGGTGGGAGCCCAACTCCATTCGACAGGAATTTTGCCACTAAGATGGGTGCA
AAGGCTATGAACTGGATGTCAGGGAAAATCAAAGAGAGTTACCGTAATGGGCGGATCTTT
GCCAATTCCCCAGACTCGGGCTGTGTTCTGGGGATGCGTAAGAGGGCCCTGGTCTTCCAA
CCAGTGACTGAGTTGAAGGAACAGACGGATTTTGAGCACCGCATCCCCAAGGAGCAGTGG
TGGCTGAAGCTGAGGCCCATCCTCAAGATCCTCGCCAAGTACGAGATTGACTTGGATACC
TCAGAGCACGCCCACCTGGAGCACATCTCTCGGAAGCGGTCCGGAGAAGCTAACGTCTAG
Enzyme 121 GenBank Gene ID BC122655 Link Image
Enzyme 121 GeneCard ID PFKM Link Image
Enzyme 121 GenAtlas ID Not Available
Enzyme 121 HGNC ID Not Available
Enzyme 121 Chromosome Location Chromosome:1
Enzyme 121 Locus 12q13.3
Enzyme 121 SNPs SNPJam Report Link Image
Enzyme 121 General References Not Available
Enzyme 121 Metabolite References Not Available
Enzyme 122 [top]
Enzyme 122 ID 524
Enzyme 122 Name Protein phosphatase 1A
Enzyme 122 Synonyms
  1. Protein phosphatase 2C isoform alpha
  2. PP2C-alpha
Enzyme 122 Gene Name PPM1A
Enzyme 122 Protein Sequence >Protein phosphatase 1A
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVYFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEEELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
Enzyme 122 Number of Residues 382
Enzyme 122 Molecular Weight 42529.5
Enzyme 122 Theoretical pI 4.89
Enzyme 122 GO Classification
Function
Process
Component
Enzyme 122 General Function Signal transduction mechanisms
Enzyme 122 Specific Function Enzyme with a broad specificity
Enzyme 122 Pathways Not Available
Enzyme 122 Reactions Not Available
Enzyme 122 Pfam Domain Function
Enzyme 122 Signals
  • None
Enzyme 122 Transmembrane Regions
  • None
Enzyme 122 Essentiality Not Available
Enzyme 122 GenBank ID Protein 3063743 Link Image
Enzyme 122 UniProtKB/Swiss-Prot ID O62829 Link Image
Enzyme 122 UniProtKB/Swiss-Prot Entry Name PPM1A_BOVIN Link Image
Enzyme 122 PDB ID 1A6Q Link Image
Enzyme 122 PDB File Show
Enzyme 122 3D Structure
Enzyme 122 Cellular Location Not Available
Enzyme 122 Gene Sequence >1149 bp
ATGGGAGCATTTTTAGACAAACCAAAGATGGAAAAACATAATGCCCAGGGGCAGGGTAAT
GGGTTGCGATATGGGCTAAGCAGCATGCAAGGCTGGCGAGTTGAAATGGAGGATGCACAT
ACTGCTGTGATCGGTCTGCCAAGTGGACTTGAAACATGGTCATTCTTTGCTGTGTATGAT
GGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGCATTTGTTAGATCACATCACC
AATAACCAGGATTTTAAAGGGTCTGCAGGAGCACCTTCTGTGGAAAATGTAAAGAATGGA
ATCAGAACAGGCTTCCTGGAGATTGATGAACATATGAGAGTTATGTCAGAGAAGAAACAT
GGTGCTGATAGGAGTGGGTCAACAGCTGTGGGTGTCTTAATTTCTCCTCAACACACGTAT
TTCATTAACTGTGGAGACTCAAGAGGTTTACTTTGTAGGAACAGGAAAGTTTACTTCTTC
ACACAAGATCACAAACCAAGTAATCCGCTGGAAAAAGAACGAATTCAGAATGCAGGTGGT
TCTGTAATGATTCAGCGTGTGAATGGCTCTCTGGCTGTGTCGAGGGCCCTTGGGGACTTT
GATTACAAATGTGTCCATGGAAAAGGTCCTACAGAGCAGCTTGTTTCACCAGAGCCTGAA
GTCCATGATATTGAAAGATCTGAAGAAGATGATCAATTCATTATTCTTGCATGTGATGGT
ATTTGGGATGTCATGGGAAATGAAGAGCTCTGTGATTTTGTAAGATCCAGACTTGAAGTC
ACTGATGACCTTGAGAAAGTTTGCAATGAAGTAGTCGACACCTGTTTGTATAAGGGAAGT
CGAGACAACATGAGTGTGATATTGATCTGTTTTCCAAATGCACCCAAAGTATCGCCAGAA
GCAGTGAAGAAGGAGGAAGAGTTGGACAAATACCTGGAAAGCAGAGTAGAAGAAATCATA
AAGAAGCAGGGGGAAGGCGTCCCTGACTTAGTCCATGTGATGCGCACATTAGCGAGTGAG
AACATACCCAGCCTCCCACCAGGGGGTGAACTGGCAAGCAAGCGGAATGTAATTGAAGCC
GTTTACAATAGACTGAATCCATACAAAAATGATGACACCGACTCTACATCAACTGATGAT
ATGTGGTAA
Enzyme 122 GenBank Gene ID AJ005457 Link Image
Enzyme 122 GeneCard ID PPM1A Link Image
Enzyme 122 GenAtlas ID Not Available
Enzyme 122 HGNC ID Not Available
Enzyme 122 Chromosome Location Chromosome:1
Enzyme 122 Locus 14q23.1
Enzyme 122 SNPs SNPJam Report Link Image
Enzyme 122 General References
  1. [PubMed Link Image]
Enzyme 122 Metabolite References Not Available
Enzyme 123 [top]
Enzyme 123 ID 525
Enzyme 123 Name Adenylosuccinate synthetase isozyme 2
Enzyme 123 Synonyms
  1. AMPSase 2
  2. AdSS 2
  3. Adenylosuccinate synthetase, acidic isozyme
  4. IMP--aspartate ligase 2
Enzyme 123 Gene Name ADSS
Enzyme 123 Protein Sequence >Adenylosuccinate synthetase isozyme 2
MAFAETNPATSSLPNGDCGRPRTRPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFGGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMERIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHFPANQEVLNKVEVQYKTLPGWNTDISNARTFKE
LPINAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
Enzyme 123 Number of Residues 456
Enzyme 123 Molecular Weight 50156.1
Enzyme 123 Theoretical pI 6.72
Enzyme 123 GO Classification
Function
Process
Component
Enzyme 123 General Function Nucleotide transport and metabolism
Enzyme 123 Specific Function Plays an important role in the de novo pathway of purine nucleotide biosynthesis
Enzyme 123 Pathways
  • Purine metabolism
  • AMP biosynthesis via de novo pathway
  • AMP from IMP:step 1/2
Enzyme 123 Reactions Not Available
Enzyme 123 Pfam Domain Function
Enzyme 123 Signals
  • None
Enzyme 123 Transmembrane Regions
  • None
Enzyme 123 Essentiality Not Available
Enzyme 123 GenBank ID Protein 154425984 Link Image
Enzyme 123 UniProtKB/Swiss-Prot ID A7MBG0 Link Image
Enzyme 123 UniProtKB/Swiss-Prot Entry Name PURA2_BOVIN Link Image
Enzyme 123 PDB ID Not Available
Enzyme 123 Cellular Location Not Available
Enzyme 123 Gene Sequence Not Available
Enzyme 123 GenBank Gene ID BC151541 Link Image
Enzyme 123 GeneCard ID ADSS Link Image
Enzyme 123 GenAtlas ID Not Available
Enzyme 123 HGNC ID Not Available
Enzyme 123 Chromosome Location Chromosome:1
Enzyme 123 Locus 1cen-q12
Enzyme 123 SNPs SNPJam Report Link Image
Enzyme 123 General References Not Available
Enzyme 123 Metabolite References Not Available
Enzyme 124 [top]
Enzyme 124 ID 526
Enzyme 124 Name Uridine diphosphate glucose pyrophosphatase
Enzyme 124 Synonyms
  1. UDPG pyrophosphatase
  2. UGPPase
  3. Nucleoside diphosphate-linked moiety X motif 14
  4. Nudix motif 14
Enzyme 124 Gene Name NUDT14
Enzyme 124 Protein Sequence >Uridine diphosphate glucose pyrophosphatase
MERIEGVAVGRCAASPYLVPLTLHYRQNGAQKSWDFMKTHDSVTILMFNSSRRSLVLVKQ
FRPAVYAGEVERLFPGSLAAAEQDRPQALQAALPGSAGVTYELCAGLLDQPGLSLEEVAC
KEAWEECGYRLAPSDLRRVTSYKSGVGLTGSSQTMFYAEVTDAQRGSPGGGLAEEGELIE
VVHLPLDGARTFADDPDVPKTLGVIFGISWFFSCVAPGLGLQ
Enzyme 124 Number of Residues 222
Enzyme 124 Molecular Weight 23900.9
Enzyme 124 Theoretical pI 4.77
Enzyme 124 GO Classification
Function
Process
Component
Enzyme 124 General Function Replication, recombination and repair
Enzyme 124 Specific Function Hydrolyzes UDP-glucose to glucose 1-phosphate and UMP and ADP-ribose to ribose 5-phosphate and AMP. The physiological substrate is probably UDP-glucose. Poor activity on other substrates such as ADP-glucose, CDP-glucose, GDP-glucose and GDP- mannose
Enzyme 124 Pathways Not Available
Enzyme 124 Reactions Not Available
Enzyme 124 Pfam Domain Function
Enzyme 124 Signals
  • None
Enzyme 124 Transmembrane Regions
  • None
Enzyme 124 Essentiality Not Available
Enzyme 124 GenBank ID Protein 115545445 Link Image
Enzyme 124 UniProtKB/Swiss-Prot ID Q05B60 Link Image
Enzyme 124 UniProtKB/Swiss-Prot Entry Name NUD14_BOVIN Link Image
Enzyme 124 PDB ID Not Available
Enzyme 124 Cellular Location Not Available
Enzyme 124 Gene Sequence >669 bp
ATGGAGCGCATCGAGGGGGTGGCCGTGGGCCGCTGCGCAGCCTCGCCGTACCTGGTGCCG
CTCACGCTGCACTACCGCCAGAATGGCGCCCAGAAGTCGTGGGACTTCATGAAGACTCAT
GATAGCGTGACCATCCTCATGTTCAACTCTTCCCGGAGGAGCCTGGTGTTGGTGAAGCAG
TTCCGGCCAGCCGTGTATGCTGGCGAGGTGGAGCGTCTCTTCCCAGGGTCCCTGGCCGCT
GCGGAGCAGGACAGGCCCCAGGCGCTGCAGGCGGCGCTGCCTGGCTCAGCAGGGGTCACC
TACGAGCTGTGTGCCGGCCTCCTGGACCAGCCCGGGCTCTCGCTGGAGGAGGTGGCCTGC
AAGGAGGCCTGGGAGGAGTGTGGCTACCGCCTGGCACCCTCTGACCTGCGCCGGGTGACC
TCGTACAAGTCTGGCGTGGGACTGACCGGCTCCAGCCAGACCATGTTCTACGCTGAGGTG
ACGGATGCCCAGCGGGGCAGCCCGGGTGGGGGCCTGGCTGAGGAGGGAGAGCTCATCGAG
GTGGTGCACCTGCCCCTGGACGGTGCCCGGACCTTTGCGGATGACCCGGATGTTCCCAAG
ACCCTCGGCGTGATCTTTGGTATCTCGTGGTTCTTCAGCTGTGTGGCCCCTGGCCTGGGT
CTCCAGTGA
Enzyme 124 GenBank Gene ID BC122769 Link Image
Enzyme 124 GeneCard ID NUDT14 Link Image
Enzyme 124 GenAtlas ID Not Available
Enzyme 124 HGNC ID Not Available
Enzyme 124 Chromosome Location Chromosome:1
Enzyme 124 Locus 14q32.33
Enzyme 124 SNPs SNPJam Report Link Image
Enzyme 124 General References Not Available
Enzyme 124 Metabolite References Not Available