We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Potassium (RMDB00586)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-15 23:06:05
Update Date 2009-08-20 16:37:36
Accession Number RMDB00586
Common Name Potassium
Description Potassium is an essential electrolyte. Potassium balance is crucial for regulating the excitability of nerves and muscles and so critical for regulating contractility of cardiac muscle. Although the most important changes seen in the presence of deranged potassium are cardiac, smooth muscle is also affected with increasing muscle weakness, a feature of both hyperkalaemia and hypokalaemia. Physiologically, it exists as an ion in the body. Potassium (K+) is a positively charged electrolyte, cation, which is present throughout the body in both intracellular and extracellular fluids. The majority of body potassium, >90%, are intracellular. It moves freely from intracellular fluid (ICF) to extracellular fluid (ECF) and vice versa when adenosine triphosphate increases the permeability of the cell membrane. It is mainly replaced inside or outside the cells by another cation, sodium (Na+). The movement of potassium into or out of the cells is linked to certain body hormones and also to certain physiological states. Standard laboratory tests measure ECF potassium. Potassium enters the body rapidly during food ingestion. Insulin is produced when a meal is eaten; this causes the temporary movement of potassium from ECF to ICF. Over the ensuing hours, the kidneys excrete the ingested potassium and homeostasis is returned. In the critically ill patient, suffering from hyperkalaemia, this mechanism can be manipulated beneficially by administering high concentration (50%) intravenous glucose. Insulin can be added to the glucose, but glucose alone will stimulate insulin production and cause movement of potassium from ECF to ICF. The stimulation of alpha receptors causes increased movement of potassium from ICF to ECF. A noradrenaline infusion can elevate serum potassium levels. An adrenaline infusion, or elevated adrenaline levels, can lower serum potassium levels. Metabolic acidosis causes a rise in extracellular potassium levels. In this situation, excess of hydrogen ions (H+) are exchanged for intracellular potassium ions, probably as a result of the cellular response to a falling blood pH. Metabolic alkalosis causes the opposite effect, with potassium moving into the cells. (PMID: 17883675)
Synonyms
  1. K+
  2. Potassium
  3. Kalium
  4. Potassium (ion)
  5. Potassium (K+)
  6. Potassium cation
  7. potassium ion
  8. Potassium ion (K+)
  9. Potassium ion(+)
  10. Potassium ion(1+)
  11. Potassium monocation
  12. Potassium(+)
  13. potassium(1+)
  14. potassium(1+) ion
  15. potassium(I) cation
  16. Potassium ion (K1+)
Chemical IUPAC Name potassium
Chemical Formula [K]+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals
Application
Source
  • Exogenous
Average Molecular Weight 39.098
Monoisotopic Molecular Weight 38.963711
Isomeric SMILES [K+]
Canonical SMILES [K+]
KEGG Compound ID C00238 Link Image
BioCyc ID K%2b Link Image
BiGG ID 34349 Link Image
Wikipedia Link Potassium Link Image
METLIN ID 3197 Link Image
PubChem Compound 813 Link Image
PubChem Substance 26713092 Link Image
ChEBI ID 26216 Link Image
CAS Registry Number 7440-09-7
InChI Identifier InChI=1/K/q+1
Synthesis Reference Alberti, Augusto. Recovering potassium salts from the refuse liquor of the manufacture of tartaric acid. (1910), US 957295 19100510 CAN 4:13164 AN 1910:13164
Melting Point (Experimental) 63.2 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 578 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.77 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • golgi apparatus
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location Not Available
Concentrations (Normal)
Biofluid Rumen
Value 13120.81 +/- 153.46 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 11361 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Sodium/potassium-transporting ATPase subunit alpha-1
  2. Sodium/potassium-transporting ATPase subunit alpha-2
  3. S-adenosylmethionine synthetase
  4. Acetyl-CoA acetyltransferase, mitochondrial
  5. S-adenosylmethionine synthetase isoform type-1
  6. GMP reductase 2
  7. Pyruvate kinase
  8. Pyruvate kinase
  9. Pyruvate kinase
  10. Pyruvate kinase
  11. Tubulin--tyrosine ligase
  12. 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
  13. GMP reductase
  14. Inosine-5'-monophosphate dehydrogenase 2
  15. Inosine-5'-monophosphate dehydrogenase
  16. Sodium/potassium-transporting ATPase subunit beta-2
  17. Sodium/potassium-transporting ATPase subunit beta-3
  18. Sodium/potassium-transporting ATPase gamma chain
  19. Cell division protein kinase 2
  20. Caseinolytic peptidase B protein homolog
Enzyme 1 [top]
Enzyme 1 ID 145
Enzyme 1 Name Sodium/potassium-transporting ATPase subunit alpha-1
Enzyme 1 Synonyms
  1. Sodium pump subunit alpha-1
  2. Na(+)/K(+) ATPase alpha-1 subunit
Enzyme 1 Gene Name ATP1A1
Enzyme 1 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-1
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAVLCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALS
RIAGLCNRAVFQANQDNLPILKRAVAGDASESALLKCIEVCCGSVKEMRERYTKIVEIPF
NSTNKYQLSIHKNANAGEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDARA
CVVHGSDLKDMTPEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPQTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPNHLLGIRVTWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
Enzyme 1 Number of Residues 1021
Enzyme 1 Molecular Weight 112641.7
Enzyme 1 Theoretical pI 5.19
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Inorganic ion transport and metabolism
Enzyme 1 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 771-790 801-821 842-864 917-936 950-968 984-1004
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 115305284 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q08DA1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name AT1A1_BOVIN Link Image
Enzyme 1 PDB ID 1MO8 Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >3066 bp
ATGGGGAAGGGGGTTGGACGTGATAAATATGAACCGGCAGCTGTTTCAGAGCATGGGGAC
AAGAAAAAAGCCAAGAAAGAGAGGGATATGGACGAGCTGAAGAAAGAAGTTTCTATGGAT
GATCATAAACTTAGCCTTGATGAACTTCATCGCAAATATGGAACAGACTTGAGCCGAGGC
TTAACAACTGCTCGAGCTGCCGAGATCCTAGCCAGAGATGGACCCAACGCCCTCACGCCC
CCTCCCACGACCCCTGAATGGGTCAAGTTCTGTCGACAGCTGTTTGGGGGGTTCTCAATG
TTACTGTGGATTGGAGCAGTTCTTTGCTTCCTGGCCTATGGTATCCAAGCTGCTACAGAA
GAGGAACCTCAAAATGATAATCTGTACCTTGGTGTGGTGCTGTCTGCTGTCGTCATCATA
ACCGGGTGTTTCTCCTACTATCAAGAAGCTAAAAGCTCAAAGATCATGGAGTCCTTCAAA
AACATGGTTCCTCAGCAAGCCCTCGTGATTCGAAATGGTGAGAAAATGAGCATAAATGCG
GAAGAGGTTGTCGTCGGAGATCTGGTGGAAGTGAAAGGAGGGGATCGAATTCCTGCCGAT
CTCAGGATCATTTCTGCAAATGGCTGCAAGGTGGATAACTCCTCACTCACGGGAGAATCA
GAGCCACAGACCAGGTCTCCGGATTTCACCAATGAAAATCCCCTGGAGACACGGAACATT
GCCTTTTTTTCAACTAACTGTGTTGAAGGCACTGCACGTGGCATTGTCGTGTATACTGGG
GATCGAACCGTGATGGGCAGAATTGCCACGCTGGCTTCTGGGCTGGAGGGGGGCCAGACT
CCCATCGCTGCGGAAATTGAACATTTTATCCACATCATCACGGGTGTGGCTGTGTTCCTG
GGCGTGTCGTTCTTCATCCTTTCTCTGATCCTTGAGTACACCTGGCTGGAGGCTGTCATC
TTCCTCATCGGCATCATTGTAGCCAACGTGCCAGAGGGTTTGCTGGCCACCGTCACGGTG
TGCCTGACGCTGACTGCAAAGCGCATGGCCAGGAAAAACTGCTTAGTGAAGAACCTGGAG
GCTGTGGAGACCTTGGGATCCACGTCCACCATCTGCTCAGACAAAACTGGAACTCTGACC
CAGAACCGAATGACAGTGGCCCACATGTGGTTCGACAACCAAATCCACGAGGCGGACACG
ACAGAGAATCAGAGCGGTGTTTCATTTGACAAGACTTCGGCCACGTGGCTCGCTCTGTCC
AGAATTGCAGGTCTTTGTAACAGGGCCGTGTTTCAGGCTAACCAGGATAACCTGCCTATC
CTGAAGCGGGCTGTAGCGGGTGATGCCTCAGAGTCTGCGCTCCTGAAGTGCATTGAGGTG
TGCTGCGGTTCTGTGAAGGAGATGAGAGAGAGATACACCAAGATCGTCGAGATCCCATTC
AACTCCACCAACAAGTACCAGTTATCCATCCACAAGAACGCCAATGCAGGTGAGCCCCGG
CACCTACTGGTGATGAAAGGTGCCCCAGAAAGGATCTTGGACCGCTGCAGCTCCATCCTC
ATCCATGGCAAGGAGCAGCCCCTGGACGAGGAGCTGAAGGACGCTTTTCAGAATGCCTAC
CTGGAGCTGGGTGGCCTCGGAGAGCGTGTGCTGGGTTTTTGCCACTTGCTGCTGCCAGAT
GAGCAGTTTCCTGAAGGCTTCCAGTTTGACACCGACGATGTGAACTTCCCTGTTGATAAT
CTCTGCTTCGTGGGACTCATCTCCATGATTGACCCACCACGGGCTGCTGTCCCAGATGCT
GTGGGCAAATGCCGAAGTGCTGGAATCAAGGTCATCATGGTCACCGGAGACCATCCCATC
ACTGCCAAAGCCATTGCCAAAGGTGTGGGGATCATCTCAGAAGGTAATGAGACTGTAGAA
GACATTGCTGCCCGCCTCAACATCCCAGTGAGCCAGGTGAACCCCAGGGATGCCCGGGCC
TGCGTGGTGCATGGAAGTGATCTGAAGGACATGACTCCCGAGCAGCTGGATGACATCTTG
AAGTACCACACAGAGATTGTGTTCGCCAGGACCTCTCCGCAGCAGAAGCTCATCATTGTG
GAAGGCTGCCAGAGACAGGGTGCCATCGTGGCTGTAACTGGAGACGGTGTCAATGACTCC
CCGGCTTTGAAGAAGGCAGACATTGGGGTTGCCATGGGGATTGCAGGCTCAGACGTGTCT
AAGCAAGCTGCTGACATGATTCTCCTAGATGACAACTTTGCCTCAATTGTGACTGGAGTA
GAGGAAGGTCGTCTGATCTTTGATAACTTGAAGAAATCCATTGCTTATACCCTCACCAGT
AACATTCCTGAGATTACCCCCTTCCTGATATTTATTATTGCAAACATTCCACTCCCTCTG
GGGACCGTCACCATCCTCTGCATCGACTTGGGAACGGACATGGTCCCTGCTATCTCCTTG
GCTTATGAGCAGGCTGAGAGCGACATCATGAAGAGGCAGCCCAGAAACCCCCAGACGGAC
AAACTCGTGAACGAGCGGCTGATCAGCATGGCCTATGGACAGATTGGTATGATCCAGGCC
CTGGGGGGCTTCTTCACTTACTTTGTTATCATGGCTGAGAACGGCTTCCTCCCAAATCAC
CTGCTGGGCATCCGAGTGACCTGGGATGACCGTTGGATCAACGATGTGGAGGACAGCTAT
GGGCAGCAGTGGACCTATGAACAGAGGAAGATTGTGGAGTTCACCTGCCACACGGCCTTC
TTTGTCAGTATCGTGGTGGTGCAGTGGGCTGACCTGGTCATCTGCAAGACCAGGAGGAAT
TCTGTCTTCCAGCAGGGGATGAAGAACAAGATCTTAATATTTGGCCTCTTTGAAGAGACA
GCCCTTGCTGCTTTCCTTTCCTACTGCCCTGGAATGGGTGTTGCCCTGAGGATGTATCCC
CTCAAACCTACCTGGTGGTTCTGTGCCTTCCCCTACTCTCTTCTCATCTTCGTGTATGAC
GAAGTCCGGAAGCTCATCATCAGGCGACGTCCTGGCGGTTGGGTGGAGAAGGAGACCTAC
TACTAG
Enzyme 1 GenBank Gene ID BC123864 Link Image
Enzyme 1 GeneCard ID ATP1A1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 1p21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 158
Enzyme 2 Name Sodium/potassium-transporting ATPase subunit alpha-2
Enzyme 2 Synonyms
  1. Sodium pump subunit alpha-2
  2. Na(+)/K(+) ATPase alpha-2 subunit
Enzyme 2 Gene Name ATP1A2
Enzyme 2 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-2
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAFGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYL
ELGGLGERVLGFCQLNLPSAKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
Enzyme 2 Number of Residues 1020
Enzyme 2 Molecular Weight 112178.3
Enzyme 2 Theoretical pI 5.33
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Inorganic ion transport and metabolism
Enzyme 2 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium, providing the energy for active transport of various nutrients
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 770-789 800-820 841-863 916-935 949-967 983-1003
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 124829106 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A2VDL6 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AT1A2_BOVIN Link Image
Enzyme 2 PDB ID 1Q3I Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >3063 bp
ATGGGCCGTGGGGCTGGCCGCGAGTACTCGCCTGCAGCCACCACTGCGGAAAATGGGGGC
GGCAAGAAGAAACAGAAAGAGAAGGAGCTGGATGAGCTGAAGAAGGAAGTGGCCATGGAT
GACCACAAGCTGTCCTTGGATGAGCTGGGCCGCAAGTACCAAGTGGATCTGTCCAAGGGC
CTCACCAACCAGCGGGCCCAGGACATTCTGGCTCGGGATGGACCCAATGCCCTCACCCCA
CCCCCAACCACCCCTGAGTGGGTCAAGTTCTGTCGTCAGCTTTTCGGGGGCTTCTCCATC
CTACTGTGGATTGGGGCCATCCTCTGCTTCCTGGCCTTTGGCATCCAGGCTGCCATGGAG
GATGAACCGTCCAACGACAATCTTTATCTGGGCGTGGTGCTGGCAGCTGTGGTCATCGTC
ACTGGCTGCTTCTCCTACTACCAGGAGGCCAAGAGCTCCAAGATCATGGATTCCTTCAAG
AACATGGTGCCTCAGCAAGCCCTTGTGGTGCGAGAAGGAGAGAAGATGCAGATCAACGCG
GAGGAGGTGGTGGTGGGCGACCTGGTGGAGGTGAAGGGTGGGGACCGCGTGCCCGCTGAC
CTCCGGATCATCTCTTCTCACGGCTGCAAGGTGGACAACTCCTCCCTGACAGGCGAGTCA
GAACCCCAGACCCGCTCCCCTGAGTTCACCCACGAGAATCCCCTGGAGACCCGCAATATC
TGTTTCTTCTCTACCAACTGTGTGGAAGGCACTGCCAGGGGCATCGTGATTGCCACAGGT
GACCGGACGGTGATGGGCCGTATAGCCACTCTGGCCTCAGGCCTGGAGGTCGGGCGGACG
CCCATAGCCATGGAGATTGAGCACTTCATTCAGCTGATCACAGGGGTGGCCGTCTTCCTG
GGGGTCTCCTTCTTCGTGCTGTCCCTCATCCTGGGCTACAGCTGGCTGGAGGCGGTCATC
TTCCTTATCGGCATCATTGTGGCCAACGTGCCTGAGGGTCTGCTGGCCACTGTCACCGTG
TGTCTGACCCTGACAGCCAAGCGCATGGCTCGGAAGAACTGCCTGGTGAAGAACCTGGAG
GCGGTGGAGACTCTGGGCTCCACCTCCACCATCTGCTCCGACAAGACCGGAACCCTCACC
CAGAACCGCATGACCGTCGCCCACATGTGGTTCGACAATCAGATCCATGAGGCCGACACC
ACGGAAGATCAGTCTGGGGCCACTTTTGACAAACGATCCCCGACATGGACTGCCCTATCC
CGGATTGCTGGTCTCTGCAACCGTGCTGTGTTCAAGGCAGGGCAGGAAAACATCTCTGTG
TCTAAGCGGGACACAGCAGGTGATGCCTCCGAGTCAGCTCTCCTCAAGTGCATTGAGCTG
TCCTGCGGCTCCGTGAGGAAGATGAGGGATAGAAACCCCAAGGTGGCAGAGATCCCTTTC
AACTCAACCAATAAGTACCAGCTGTCCATCCACGAGCGAGAAGACAGCCCCCAGAGCCAC
GTGCTGGTGATGAAGGGGGCCCCTGAGCGCATCCTGGACCGTTGCTCCTCCATCCTGGTG
CAGGGCAAGGAGATCCCTCTGGACAAGGAGATGCAAGATGCCTTCCAGAATGCCTACCTG
GAGCTGGGAGGGCTCGGGGAGCGCGTCCTGGGCTTCTGTCAACTGAATCTGCCTTCTGCA
AAGTTTCCTCGGGGCTTCAAATTTGACACGGATGAGCTGAACTTTCCCACAGAGAAGCTC
TGCTTCGTGGGGCTCATGTCCATGATTGACCCTCCACGGGCTGCCGTTCCCGATGCTGTG
GGCAAGTGCCGGAGTGCAGGCATCAAGGTGATCATGGTGACCGGTGACCACCCCATCACA
GCCAAGGCCATTGCCAAAGGCGTGGGCATCATCTCAGAAGGCAACGAGACAGTGGAGGAC
ATTGCCGCCCGGCTCAACATTCCTGTTAGCCAAGTCAACCCCAGAGAAGCCAAGGCGTGT
GTGGTGCACGGCTCTGACCTGAAAGATATGACGTCGGAGCAGCTGGACGAGATCCTCAAG
AATCACACGGAGATCGTCTTTGCCCGGACGTCTCCTCAGCAGAAGCTCATCATCGTGGAG
GGCTGCCAGAGGCAGGGAGCCATTGTGGCGGTGACGGGGGATGGGGTGAATGACTCCCCG
GCGCTAAAGAAGGCGGACATTGGCATCGCCATGGGCATCGCTGGCTCCGACGTTTCTAAG
CAGGCCGCCGACATGATCCTGCTGGATGACAACTTTGCCTCCATCGTCACTGGCGTGGAG
GAGGGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCGCCTACACCCTGACCAGTAAC
ATCCCCGAGATCACCCCTTTCCTGCTGTTCATCATCGCCAACATCCCCCTGCCTCTGGGC
ACCGTGACCATCCTCTGCATTGACCTGGGCACTGATATGGTCCCTGCCATCTCCTTGGCC
TATGAGGCAGCTGAGAGTGACATCATGAAGCGGCAGCCACGCAACCCGCAGACGGACAAG
CTGGTGAACGAGAGGCTCATCAGCATGGCCTATGGACAGATCGGGATGATCCAGGCTCTG
GGTGGCTTCTTCACCTACTTTGTGATCCTGGCAGAGAATGGTTTTCTACCTTCGCGGCTT
CTGGGAATCCGCCTGGACTGGGATGACCGGTCCATGAATGACTTGGAGGACAGCTACGGA
CAGGAGTGGACCTATGAACAGCGGAAGGTGGTGGAGTTCACATGCCACACGGCTTTCTTT
GCCAGCATTGTGGTCGTGCAATGGGCTGACCTCATCATCTGCAAGACCCGCCGCAACTCA
GTTTTCCAGCAGGGAATGAAAAACAAGATTCTGATTTTTGGGCTCCTGGAGGAGACAGCA
CTGGCGGCCTTTCTGTCTTACTGCCCGGGCATGGGCGTGGCTCTCCGAATGTACCCGCTC
AAGGTCACCTGGTGGTTCTGCGCCTTCCCCTACAGTCTCCTTATCTTCATCTACGATGAG
GTCCGAAAGCTGATCCTGCGGCGATATCCGGGTGGCTGGGTGGAGAAGGAGACCTACTAC
TGA
Enzyme 2 GenBank Gene ID BC133297 Link Image
Enzyme 2 GeneCard ID ATP1A2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1q21-q23
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 174
Enzyme 3 Name S-adenosylmethionine synthetase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name MAT2A
Enzyme 3 Protein Sequence >S-adenosylmethionine synthetase
MNGQLNGFHDAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVA
KTGMILLAGEITSRAAVDYQKVVRETIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQG
VHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDS
KTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDT
IYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPGVI
VRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY
Enzyme 3 Number of Residues 395
Enzyme 3 Molecular Weight 43690.4
Enzyme 3 Theoretical pI 6.45
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Coenzyme transport and metabolism
Enzyme 3 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 3 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 152941174 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID A7E3T7 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name A7E3T7_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1188 bp
ATGAACGGGCAGCTCAACGGCTTCCACGACGCGTTCATCGAGGAGGGCACGTTCCTCTTT
ACCTCCGAGTCCGTGGGGGAAGGCCACCCAGATAAGATCTGTGACCAGATCAGTGATGCT
GTCCTTGATGCCCACCTTCAGCAGGACCCTGATGCCAAAGTGGCTTGTGAAACTGTTGCT
AAGACTGGAATGATCCTTCTTGCTGGGGAAATTACATCCAGAGCTGCTGTTGACTACCAG
AAAGTGGTTCGTGAAACCATTAAACACATTGGATATGACGATTCTTCCAAAGGGTTTGAC
TACAAGACATGTAATGTGCTAGTGGCCTTGGAGCAACAGTCACCAGATATTGCCCAAGGT
GTTCATCTTGACCGAAACGAGGAAGACATTGGTGCAGGAGACCAGGGTTTGATGTTTGGT
TATGCCACTGATGAAACTGAGGAATGTATGCCTTTAACCATTGTCTTAGCACACAAGCTC
AATGCCAAACTGGCTGAACTGCGCCGGAATGGCACTTTGCCTTGGTTACGCCCTGATTCT
AAAACTCAAGTGACTGTGCAGTATATGCAGGATCGAGGTGCCGTACTTCCCATCAGAGTC
CACACAATTGTTATATCTGTTCAGCATGATGAAGAAGTTTGTCTTGATGAGATGAGAGAT
GCTCTGAAGGAGAAAGTCATCAAAGCTGTTGTACCTGCAAAGTACCTTGATGAGGACACA
ATCTATCATCTACAGCCAAGTGGCAGATTTGTTATTGGTGGGCCTCAGGGTGATGCTGGT
TTGACTGGCCGGAAAATCATTGTGGACACTTACGGTGGTTGGGGAGCTCATGGAGGAGGT
GCCTTTTCAGGAAAGGATTATACCAAGGTGGACCGTTCAGCTGCTTATGCTGCTCGTTGG
GTGGCAAAATCCCTTGTTAAAGGAGGTCTGTGCAGAAGGGTTCTTGTTCAGGTCTCTTAT
GCTATTGGAGTATCTCATCCATTGTCTATCTCCATTTTCCATTATGGCACCTCTCAGAAG
AGTGAGAGAGAGCTATTAGAGATTGTGAAGAAGAATTTTGACCTCCGCCCTGGGGTCATT
GTCAGGGATCTGGATCTGAAGAAGCCAATTTATCAGAGGACTGCAGCCTATGGCCACTTT
GGTAGGGACAGCTTCCCATGGGAAGTGCCCAAAAAGCTTAAATATTGA
Enzyme 3 GenBank Gene ID BT030708 Link Image
Enzyme 3 GeneCard ID MAT2A Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 2p11.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 371
Enzyme 4 Name Acetyl-CoA acetyltransferase, mitochondrial
Enzyme 4 Synonyms
  1. Acetoacetyl-CoA thiolase
Enzyme 4 Gene Name ACAT1
Enzyme 4 Protein Sequence >Acetyl-CoA acetyltransferase, mitochondrial
MPVLAALLRRGPLLQRRVQEIRYAERSYVSKPTLNEVVIVSAIRTPIGSFLGSLSSLPAT
KLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKV
CASGMKAIMMASQNLMCGHQDVMVAGGMESMSNVPYVMNRGATPYGGVKLEDLIVKDGLT
DVYNKIHMGNCAENTAKKLNITREEQDTYALNSYTRSKAAWEAGRFGNEVVPVTITVKGK
PDVVVKEDEEYKRVDFSKIPKLKTVFQRENGTVTAANASTLNDGAAAVVLMTADAAKRLN
VKPLARIAAFADAAVEPIDFPLAPAYAVPKVLKDAGLKKEDITMWEVNEAFSVVVLANIK
MLEMDPQKVNINGGAVSLGHPIGMSGARIVVHLAHALKQGEYGLASICNGGGGASAMLIQ
KL
Enzyme 4 Number of Residues 422
Enzyme 4 Molecular Weight 44888.8
Enzyme 4 Theoretical pI 9.21
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Lipid transport and metabolism
Enzyme 4 Specific Function Plays a major role in ketone body metabolism
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 88758637 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q29RZ0 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name THIL_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1269 bp
ATGCCTGTGTTAGCGGCCCTTCTGCGGCGCGGCCCCCTGCTTCAGAGGCGGGTGCAGGAA
ATAAGGTATGCGGAGCGAAGTTATGTATCAAAACCCACTTTGAATGAAGTGGTCATAGTA
AGTGCTATAAGAACACCCATTGGATCCTTTCTAGGCAGTCTTTCCTCTCTGCCAGCCACT
AAACTTGGTTCCATTGCAATTCAGGGAGCCATTGAAAAGGCAGGGATTCCAAAAGAAGAA
GTGAAAGAAGCATACATGGGCAATGTTCTACAAGGAGGTGAAGGACAGGCCCCTACAAGG
CAAGCAGTACTGGGAGCAGGCTTACCTATTTCTACTCCATGTACCACTATAAACAAAGTT
TGTGCCTCAGGAATGAAAGCCATCATGATGGCCTCTCAGAATCTTATGTGTGGACATCAG
GATGTGATGGTGGCAGGTGGCATGGAGAGCATGTCCAATGTCCCCTATGTAATGAACAGA
GGAGCAACACCATATGGTGGGGTAAAGCTTGAAGATTTGATTGTAAAAGATGGACTAACT
GATGTCTACAATAAAATTCATATGGGCAACTGTGCTGAAAATACTGCAAAGAAGCTGAAT
ATTACACGAGAGGAACAGGATACTTATGCTCTTAATTCCTATACCAGAAGTAAAGCAGCA
TGGGAAGCTGGAAGATTTGGAAATGAAGTTGTTCCTGTCACAATTACAGTAAAAGGTAAA
CCAGATGTAGTGGTGAAAGAAGATGAAGAATATAAACGTGTTGATTTTAGCAAAATTCCA
AAGCTGAAGACAGTTTTCCAAAGAGAAAATGGTACAGTAACAGCTGCCAATGCCAGCACA
CTGAATGATGGAGCAGCTGCTGTGGTTCTGATGACTGCAGATGCAGCTAAGAGGCTCAAT
GTTAAACCACTGGCAAGAATAGCAGCATTTGCTGATGCTGCTGTAGAACCTATTGATTTT
CCACTTGCGCCTGCATATGCTGTTCCTAAGGTTCTTAAAGATGCAGGTTTGAAAAAAGAA
GATATTACTATGTGGGAAGTAAATGAAGCCTTTAGTGTGGTCGTACTAGCAAACATTAAA
ATGCTAGAGATGGATCCCCAAAAAGTGAATATCAACGGAGGAGCTGTTTCTCTTGGACAT
CCAATTGGGATGTCTGGAGCCAGAATTGTCGTCCATTTGGCTCATGCACTGAAGCAAGGA
GAATATGGTCTTGCCAGTATTTGCAACGGAGGAGGAGGTGCTTCTGCCATGCTGATCCAA
AAGCTGTAG
Enzyme 4 GenBank Gene ID BC113328 Link Image
Enzyme 4 GeneCard ID ACAT1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 11q22.3-q23.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 403
Enzyme 5 Name S-adenosylmethionine synthetase isoform type-1
Enzyme 5 Synonyms
  1. AdoMet synthetase 1
  2. Methionine adenosyltransferase 1
  3. MAT 1
Enzyme 5 Gene Name MAT1A
Enzyme 5 Protein Sequence >S-adenosylmethionine synthetase isoform type-1
MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETV
CKTGMVLLCGEITSMAMVDYQRVVRETIQHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQ
CVHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIMLAHRLNARMAELRRSGQLPWLQPD
SKTQVTVQYTQDNGAVIPMRVHTVVISVQHNEDITLEDMRRALKEQVIRAVVPARYLDED
TIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
WVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVNKNFDLRPGV
IVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
Enzyme 5 Number of Residues 396
Enzyme 5 Molecular Weight 43760.5
Enzyme 5 Theoretical pI 5.61
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Coenzyme transport and metabolism
Enzyme 5 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 5 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 86821449 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q2KJC6 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name METK1_BOVIN Link Image
Enzyme 5 PDB ID 1O9T Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1191 bp
ATGAATGGACCAGTGGATGGCTTGTGTGATCATTCTCTAAGTGAGGAAGGAGCATTCATG
TTCACATCGGAATCTGTAGGAGAGGGGCACCCGGATAAGATCTGTGACCAGATCAGTGAT
GCAGTGCTGGATGCCCATCTCAAGCAGGACCCCAATGCCAAGGTGGCCTGTGAGACGGTG
TGTAAGACGGGCATGGTGCTTCTGTGCGGGGAGATCACCTCCATGGCCATGGTGGATTAC
CAGCGTGTGGTGCGGGAGACCATCCAGCACATCGGCTACGACGACTCCGCCAAGGGCTTT
GACTTTAAGACCTGCAACGTGCTGGTGGCTTTGGAGCAGCAGTCCCCGGATATCGCCCAG
TGTGTCCACCTGGACAGAAATGAAGAGGATGTCGGTGCCGGAGATCAGGGGCTGATGTTT
GGCTATGCCACGGATGAGACGGAAGAGTGCATGCCCCTCACCATCATGCTGGCGCACAGA
CTCAACGCCCGCATGGCAGAGCTGCGACGCTCAGGGCAGCTCCCCTGGCTGCAACCTGAC
TCCAAGACACAGGTGACAGTGCAGTACACGCAGGACAACGGTGCGGTCATCCCTATGCGC
GTCCATACCGTCGTCATCTCCGTGCAGCACAACGAAGACATAACGCTGGAGGACATGCGC
AGAGCCCTGAAGGAGCAGGTGATCAGGGCTGTTGTGCCAGCACGGTACCTGGACGAGGAC
ACCATCTACCACCTGCAGCCCAGTGGGCGCTTTGTCATCGGAGGCCCCCAGGGGGATGCC
GGTGTCACTGGCCGAAAGATCATCGTGGACACCTATGGCGGCTGGGGGGCACACGGCGGA
GGCGCCTTCTCTGGGAAGGACTACACCAAGGTGGACCGCTCGGCAGCGTACGCTGCCCGC
TGGGTGGCCAAGTCCCTGGTGAAAGCAGGGCTCTGCCGGAGGGTGCTTGTGCAGGTGTCC
TATGCCATTGGTGTGGCTGAGCCACTGTCTATTTCCATCTTTACCTATGGAACCTCCCAG
AAGACAGAGAGAGAGCTGCTGGATGTGGTCAATAAGAACTTTGACCTTCGGCCTGGTGTT
ATCGTCAGGGACTTGGACTTGAAGAAGCCCATCTACCAGAAGACAGCATGCTACGGCCAC
TTCGGGAGGAGCGAGTTCCCTTGGGAAGTTCCCAAAAAGCTTGTGTTTTAG
Enzyme 5 GenBank Gene ID BC105410 Link Image
Enzyme 5 GeneCard ID MAT1A Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 10q22
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 432
Enzyme 6 Name GMP reductase 2
Enzyme 6 Synonyms
  1. Guanosine 5'-monophosphate oxidoreductase 2
  2. Guanosine monophosphate reductase 2
Enzyme 6 Gene Name GMPR2
Enzyme 6 Protein Sequence >GMP reductase 2
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFAFRNSKQMYTGIPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLEQWKEFASQNPDCLEHLAASSGTGSSDFEQLEQILNAI
PQVKYVCLDVANGYSEHFVEFVKDVRKRFPEHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERNGRKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGD
VEHTIRDIIGGIRSTCTYVGAAKQKELSRRTTFIRVTQQVKPIFSDES
Enzyme 6 Number of Residues 348
Enzyme 6 Molecular Weight 38032.3
Enzyme 6 Theoretical pI 7.52
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Nucleotide transport and metabolism
Enzyme 6 Specific Function Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 81673705 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q32L93 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name GMPR2_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1047 bp
ATGCCTCACATCGACAACGACGTCAAACTGGATTTCAAGGATGTCCTGTTGAGGCCCAAA
CGCAGTACCCTTAAGTCTCGAAGTGAGGTGGATCTCACAAGATCCTTTGCCTTTCGGAAC
TCAAAGCAGATGTACACTGGGATCCCCATTATTGCTGCCAATATGGATACTGTGGGCACC
TTTGAGATGGCCAAGGTCCTCTGTAAGTTCTCCCTCTTCACTGCTGTCCATAAACACTAC
AGCCTCGAGCAGTGGAAAGAGTTTGCCAGCCAGAATCCTGACTGTCTTGAGCATCTGGCT
GCCAGCTCAGGCACAGGCTCTTCGGACTTTGAGCAGCTGGAACAGATCCTGAACGCTATT
CCCCAGGTGAAGTATGTATGCCTGGACGTGGCCAATGGCTACTCTGAACACTTTGTGGAA
TTTGTGAAGGATGTGCGGAAGCGCTTCCCTGAACACACCATCATGGCAGGGAATGTGGTA
ACAGGAGAAATGGTGGAAGAGCTGATCCTCTCTGGGGCTGACATCATCAAAGTGGGAATT
GGACCAGGCTCCGTGTGTACCACCCGGAAGAAAACTGGAGTGGGGTATCCACAGCTAAGT
GCAGTGATGGAGTGTGCAGATGCTGCTCACGGCCTCAAAGGCCACATCATTTCAGATGGA
GGCTGCAGCTGTCCTGGGGATGTGGCCAAGGCTTTCGGGGCAGGGGCTGACTTCGTGATG
CTGGGCGGCATGCTGGCTGGGCACAGTGAGTCAGGTGGTGAGCTCATCGAGAGGAATGGC
AGGAAGTACAAGCTCTTCTACGGCATGAGTTCCGAAATGGCCATGAAGAAGTATGCCGGG
GGTGTGGCTGAGTACAGGGCCTCAGAAGGAAAGACAGTGGAGGTGCCCTTTAAAGGGGAT
GTGGAACATACCATCCGAGACATTATTGGAGGCATCCGCTCCACCTGCACTTACGTGGGA
GCAGCTAAGCAGAAGGAGCTGAGCCGGAGAACTACCTTCATCCGTGTCACCCAGCAGGTG
AAACCGATCTTCAGTGACGAGAGCTAG
Enzyme 6 GenBank Gene ID BC109695 Link Image
Enzyme 6 GeneCard ID GMPR2 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 14q12
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 449
Enzyme 7 Name Pyruvate kinase
Enzyme 7 Synonyms Not Available
Enzyme 7 Gene Name PKM
Enzyme 7 Protein Sequence >Pyruvate kinase
CIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELARASSHSTDLMEAMAMGSV
EASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDP
VQEAWAEDVDLRVNLAMNVGKARGFFKKG
Enzyme 7 Number of Residues 149
Enzyme 7 Molecular Weight 16527.0
Enzyme 7 Theoretical pI 9.23
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Carbohydrate transport and metabolism
Enzyme 7 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 7 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 193248617 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID B3IVN4 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name B3IVN4_BOVIN Link Image
Enzyme 7 PDB ID 1F3W Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence Not Available
Enzyme 7 GenBank Gene ID AB355747 Link Image
Enzyme 7 GeneCard ID PKM Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Not Available
Enzyme 7 Locus Not Available
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 457
Enzyme 8 Name Pyruvate kinase
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name PKM2
Enzyme 8 Protein Sequence >Pyruvate kinase
HWSDASRAPGPVCSSRASRAGPRRSSSGPKTSEAMSKHHSDAGTAFIQTQQLHAAMADTF
LEHMCRLDIDSPPITARNTGIICTIGPASRAVETLKEMIKSGMNVARLNFSHGTHEYHAE
TIKNVREATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDN
AYMEKCDENILWLDYKNICKVVDVGSKIYVDDGLISLLVKQKGPDFLVTEVENGGSLGSK
KGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMVFASFIRKASDVHEVRKVLGEKGKNIK
IISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVIC
ATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAE
AAIYHLQLFEELRRLSPITSDPTEAAAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRP
RAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQEAWAEDVDLRVNLAMNVGKARGFFKKG
DVVIVLTGWRPGSGFTNTMRVVPVP
Enzyme 8 Number of Residues 565
Enzyme 8 Molecular Weight 61427.1
Enzyme 8 Theoretical pI 8.47
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Carbohydrate transport and metabolism
Enzyme 8 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 8 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 73587283 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q3ZC87 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name Q3ZC87_BOVIN Link Image
Enzyme 8 PDB ID 1F3X Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID BC102826 Link Image
Enzyme 8 GeneCard ID PKM2 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 15q22
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 465
Enzyme 9 Name Pyruvate kinase
Enzyme 9 Synonyms Not Available
Enzyme 9 Gene Name PKLR
Enzyme 9 Protein Sequence >Pyruvate kinase
MEQIPGDRQRQQLPATMADTFLEHLCLLDIDSEPVVARSTSIIATIGPASRSVERLKEMI
EAGMNIARLNFSHGSHEYHAESIANIREAVESFANSPLSYRPVAIALDTKGPEIRTGILQ
GDPASEVEIVKGSRVLVTVDPEFQTRGDANTVWVDYPNIVRVMPVGGRIYIDDGLISLVV
KKIGPEGLETEVENGGVLGSRKGVNLPGTQVDLPGLSEQDVQDLRFGVEHGVDIVFVSFV
RKASDVAAVRDALGPEGQGIKIVSKIENHEGVKKFNEILEVSDGIMVARGDLGIEIPAEK
VFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGET
AKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCCA
GAIIVLTTTGRSAQLLSRYRPRATVIAVTRSAQAARQAHLCRGVFPVLYREPPEDIWADD
VDRRVQFGIDNGKLCGFLSSGDLVIVVTGWQPGSGHTNIMRVLSVT
Enzyme 9 Number of Residues 526
Enzyme 9 Molecular Weight 56869.7
Enzyme 9 Theoretical pI 5.40
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Carbohydrate transport and metabolism
Enzyme 9 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 9 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 95768271 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q1JPG7 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name Q1JPG7_BOVIN Link Image
Enzyme 9 PDB ID 1LIU Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1581 bp
ATGGAGCAGATCCCCGGAGACAGGCAGCGGCAGCAGCTGCCAGCCACTATGGCAGACACC
TTCCTGGAACATCTGTGCCTGCTGGACATCGACTCTGAGCCTGTGGTCGCTCGCAGTACC
AGTATCATCGCCACCATCGGGCCGGCATCTCGCTCCGTGGAGCGTCTCAAGGAGATGATC
GAGGCCGGGATGAACATCGCGAGACTCAACTTCTCCCACGGCTCCCACGAGTACCACGCT
GAGTCCATCGCTAACATCCGGGAGGCGGTGGAGAGCTTTGCAAATTCTCCGCTCAGCTAC
CGACCCGTGGCCATCGCCCTGGACACCAAGGGACCAGAGATACGCACTGGGATCCTGCAA
GGGGACCCGGCGTCAGAAGTGGAGATAGTGAAGGGCTCCCGGGTGCTGGTGACCGTGGAC
CCAGAGTTCCAGACCCGCGGGGACGCGAACACCGTGTGGGTGGACTACCCCAATATCGTC
CGAGTCATGCCGGTGGGGGGCCGCATCTACATTGACGACGGGCTCATCTCCCTAGTGGTC
AAGAAAATCGGTCCGGAAGGGCTAGAGACCGAAGTGGAGAACGGCGGTGTCCTGGGCAGT
CGGAAGGGCGTGAACTTGCCAGGCACCCAGGTGGACCTGCCCGGGCTGTCCGAGCAAGAT
GTCCAGGACCTGCGCTTCGGGGTGGAGCATGGCGTGGACATCGTCTTTGTCTCTTTCGTG
CGGAAAGCCAGCGACGTGGCTGCCGTCCGGGATGCTCTGGGGCCGGAAGGACAGGGCATC
AAGATCGTTAGCAAAATCGAGAACCACGAGGGCGTAAAGAAGTTCAATGAAATCCTGGAG
GTGAGCGACGGTATTATGGTGGCACGGGGTGACCTGGGCATTGAGATCCCGGCTGAGAAG
GTTTTCCTGGCTCAGAAGATGATGATCGGCCGTTGCAACTTGGCGGGAAAGCCCGTTGTC
TGTGCTACACAGATGCTGGAGAGCATGATCACTAAGCCCCGGCCAACTCGGGCAGAGACG
AGTGACGTGGCCAATGCTGTTCTGGATGGGGCAGACTGCATCATGCTGTCAGGGGAGACT
GCCAAAGGCAACTTTCCTGTGGAGGCTGTAAAGATGCAGCATGCGATTGCCCGGGAGGCA
GAGGCTGCCGTGTACCACCGGCAGCTCTTTGAGGAGCTACGCCGGGCAGCACCACTGAGC
CGGGATCCCACGGAGGTCACCGCTATTGGTGCTGTGGAGGCTGCCTTCAAGTGCTGTGCT
GGTGCCATCATTGTGCTGACCACAACTGGCCGCTCAGCCCAGCTTCTGTCCCGGTACCGA
CCTCGGGCAACAGTCATTGCCGTCACCCGCTCTGCTCAGGCTGCCCGCCAGGCCCACCTG
TGCCGAGGAGTCTTCCCTGTGCTCTACCGTGAACCTCCAGAGGACATCTGGGCCGATGAT
GTGGACCGTCGGGTCCAATTTGGCATCGACAATGGAAAGCTCTGTGGCTTCCTCAGTTCT
GGGGACCTGGTGATTGTGGTGACAGGCTGGCAACCAGGCTCCGGCCATACCAACATCATG
CGGGTGCTGAGCGTAACCTGA
Enzyme 9 GenBank Gene ID BT025386 Link Image
Enzyme 9 GeneCard ID PKLR Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 1q21
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 497
Enzyme 10 Name Pyruvate kinase
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name PKM2
Enzyme 10 Protein Sequence >Pyruvate kinase
MSKHHSDAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRAVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVREATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVDVGSKIYVDDGL
ISLLVKQKGPDFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQNVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLSPITSDPTEAAAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNHQTARQAHLYRGIFPVVCKDPVQE
AWAEDVDLRVNLAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Enzyme 10 Number of Residues 531
Enzyme 10 Molecular Weight 57948.4
Enzyme 10 Theoretical pI 7.95
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Carbohydrate transport and metabolism
Enzyme 10 Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Enzyme 10 Pathways
  • Carbohydrate degradation
  • glycolysis
  • pyruvate from D- glyceraldehyde 3-phosphate:step 5/5
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 146231736 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID A5D984 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name A5D984_BOVIN Link Image
Enzyme 10 PDB ID 1F3X Link Image
Enzyme 10 PDB File Show
Enzyme 10 3D Structure
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1596 bp
ATGTCGAAGCACCACAGCGACGCCGGGACGGCCTTCATTCAGACTCAGCAGCTGCACGCA
GCCATGGCCGACACATTCCTGGAGCACATGTGCCGCCTGGACATCGACTCACCGCCCATT
ACGGCCCGAAACACCGGCATCATCTGTACCATCGGCCCAGCTTCACGAGCAGTGGAGACA
TTGAAGGAGATGATTAAGTCTGGAATGAATGTGGCTCGTTTGAACTTCTCTCATGGAACC
CACGAGTACCACGCAGAGACCATCAAGAATGTACGTGAAGCCACGGAGAGCTTTGCTTCA
GACCCCATTCTCTATCGGCCAGTGGCAGTGGCCCTGGACACTAAAGGACCTGAGATCCGA
ACTGGGCTCATCAAGGGCAGCGGCACCGCTGAGGTGGAGCTGAAGAAGGGAGCCACACTG
AAGATCACCCTGGACAATGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGAC
TACAAGAACATTTGCAAGGTGGTGGATGTGGGCAGCAAGATCTACGTGGATGATGGGCTT
ATTTCTCTGCTGGTGAAGCAGAAAGGTCCTGACTTCCTGGTGACGGAGGTGGAGAACGGT
GGCTCCTTGGGCAGCAAGAAGGGTGTGAACCTCCCTGGGGCTGCCGTGGACCTGCCTGCT
GTGTCAGAAAAGGACATCCAGGATCTAAAGTTTGGGGTGGAGCAGAACGTGGATATGGTG
TTTGCGTCTTTCATCCGCAAGGCTTCTGATGTCCATGAAGTCAGGAAGGTCCTGGGAGAG
AAAGGAAAGAACATCAAGATAATCAGCAAAATCGAGAATCATGAGGGAGTTCGGAGGTTT
GACGAGATCCTGGAAGCCAGTGATGGGATCATGGTGGCTCGTGGTGATCTGGGCATTGAG
ATCCCTGCAGAGAAGGTCTTCCTTGCCCAGAAGATGATGATTGGTCGGTGCAACCGAGCT
GGGAAGCCCGTCATCTGTGCCACACAGATGCTGGAGAGCATGATCAAGAAGCCTCGCCCT
ACCCGGGCGGAGGGCAGTGACGTGGCCAATGCCGTCTTGGATGGAGCCGACTGCATCATG
CTGTCCGGAGAGACGGCCAAAGGGGACTACCCCCTGGAAGCTGTCCGCATGCAGCACCTG
ATTGCCCGTGAGGCAGAGGCTGCCATCTACCATTTGCAATTGTTCGAGGAGCTCCGTCGC
CTGTCACCCATTACCAGCGACCCCACCGAAGCTGCCGCTGTGGGGGCCGTGGAGGCGTCC
TTCAAGTGCTGCAGTGGGGCCATAATCGTCCTCACCAAGTCTGGCAGGTCTGCACATCAG
GTGGCCAGATACCGCCCCCGGGCCCCCATCATTGCTGTGACTCGGAATCACCAGACAGCT
CGCCAGGCCCACCTATACCGCGGCATCTTCCCTGTGGTGTGTAAGGACCCAGTGCAGGAG
GCCTGGGCTGAGGACGTGGATCTCCGGGTGAACTTGGCCATGAATGTCGGAAAGGCCCGA
GGCTTCTTCAAGAAGGGAGACGTGGTCATTGTGCTGACCGGGTGGCGCCCTGGTTCCGGC
TTCACCAACACCATGCGTGTAGTTCCTGTGCCATGA
Enzyme 10 GenBank Gene ID BT030503 Link Image
Enzyme 10 GeneCard ID PKM2 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:1
Enzyme 10 Locus 15q22
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 505
Enzyme 11 Name Tubulin--tyrosine ligase
Enzyme 11 Synonyms
  1. TTL
Enzyme 11 Gene Name TTL
Enzyme 11 Protein Sequence >Tubulin--tyrosine ligase
MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLMQ
LVNYYRGADKLCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQDGIHPPL
HSSRTDEREFFLASYNRKKEEGEGNVWIAKSSAGAKGEGILISSDATELLDFIDNQGQVH
VIQKYLERPLLLEPGHRKFDIRSWVLVDHQFNIYLYREGVLRTASEPYHMDNFQDKTCHL
TNHCIQKEYSKNYGKYEEGNEMFFEAFNRYLTSALNITLESSILLQIKHIIRSCLMSVEP
AISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAIASVFP
PPDAEQQPPQPATFIKL
Enzyme 11 Number of Residues 377
Enzyme 11 Molecular Weight 43270.1
Enzyme 11 Theoretical pI 6.79
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in ATP binding
Enzyme 11 Specific Function Catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein Not Available
Enzyme 11 UniProtKB/Swiss-Prot ID P38584 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name TTL_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence Not Available
Enzyme 11 GenBank Gene ID Not Available
Enzyme 11 GeneCard ID TTL Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:2
Enzyme 11 Locus 2q13
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 637
Enzyme 12 Name 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
Enzyme 12 Synonyms
  1. Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain
  2. BCKDH E1-alpha
Enzyme 12 Gene Name BCKDHA
Enzyme 12 Protein Sequence >2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
MQGSAKMAMAVAVAVARVWRPSRGLGRTGLPLLRLLGARGLARFHPHRWQQQQHFSSLDD
KPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPQEKVLKFYKSMT
LLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDDTDLVFGQYREAGVLMYRDYP
LELFMAQCYGNVSDLGKGRQMPVHYGCRERHFVTISSPLATQIPQAVGAAYAAKRANANR
VVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQYRGDGIAARGPG
YGILSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDE
VNYWDKQDHPISRLRHHLQSRGWWDDEQEKAWRKQSRKKVMEAFEQAERKLKPNPSLIFS
DVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFEK
Enzyme 12 Number of Residues 455
Enzyme 12 Molecular Weight 51678.0
Enzyme 12 Theoretical pI 8.61
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Energy production and conversion
Enzyme 12 Specific Function The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components:branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3)
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 163239 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID P11178 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name ODBA_BOVIN Link Image
Enzyme 12 PDB ID 1U5B Link Image
Enzyme 12 PDB File Show
Enzyme 12 3D Structure
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >1368 bp
TTTTTTGGGTTGGTTAGATTTCATGCAGGGGTCAGCCAAGATGGCGATGGCGGTGGCGGT
TGCGGTGGCCAGGGTTTGGAGACCAAGTCGAGGCTTGGGACGGACGGGCCTCCCGCTCCT
GCGGCTGCTTGGGGCTCGTGGGCTGGCTAGATTTCACCCCCACAGGTGGCAGCAACAGCA
GCACTTCTCGTCCCTGGATGACAAGCCGCAGTTCCCAGGGGCCTCAGCGGAGTTCATAGA
CAAGCTCGAATTCATCCAGCCCAATGTCATCTCTGGGATCCCCATCTACCGGGTCATGGA
CCGGCAGGGCCAGATCATCAACCCCAGCGAGGATCCCCACCTGCCCCAGGAGAAGGTGCT
CAAATTCTACAAGAGCATGACCCTGCTCAACACCATGGACCGCATCCTCTATGAATCCCA
GAGGCAGGGCCGCATATCCTTCTACATGACCAACTATGGCGAAGAGGGGACACACGTGGG
GAGCGCAGCAGCCCTGGACGACACAGACCTGGTGTTTGGCCAGTACCGGGAGGCAGGTGT
GCTCATGTACCGGGACTACCCGTTGGAGCTGTTCATGGCCCAGTGCTACGGCAACGTGAG
CGACCTGGGCAAGGGGCGCCAGATGCCCGTCCACTACGGCTGCAGGGAGCGTCACTTCGT
CACCATCTCCTCTCCACTGGCCACGCAGATCCCCCAGGCGGTCGGGGCAGCCTACGCGGC
CAAGAGGGCCAACGCTAACAGGGTGGTCATCTGTTACTTTGGAGAGGGGGCGGCCAGTGA
GGGGGACGCCCACGCCGGCTTCAACTTCGCCGCCACCCTCGAGTGCCCCATCATCTTCTT
CTGTCGGAACAACGGCTACGCCATCTCCACGCCCACCTCGGAGCAGTACCGCGGGGACGG
CATAGCGGCTCGAGGCCCCGGGTACGGCATCCTGTCCATCCGCGTGGACGGCAATGATGT
GTTTGCCGTGTACAACGCCACCAAGGAGGCCCGGCGGCGGGCCGTGGCGGAGAACCAGCC
CTTCCTCATTGAGGCCATGACCTACAGGATCGGGCACCACAGCACCAGTGACGACAGCTC
GGCGTACCGCTCAGTGGACGAGGTCAACTACTGGGACAAGCAGGACCACCCCATCTCCCG
GCTGCGGCATCACCTGCAGAGCCGCGGCTGGTGGGACGACGAGCAGGAGAAGGCCTGGAG
GAAGCAGTCCCGCAAGAAGGTAATGGAGGCCTTTGAGCAGGCTGAGCGGAAGCTGAAGCC
CAACCCCAGCTTGATCTTCTCGGACGTGTATCAGGAGATGCCTGCCCAGCTCCGCAAGCA
GCAGGAGTCTCTGGCACGTCACCTCCAGACCTATGGTGAACACTACCC
Enzyme 12 GenBank Gene ID J03759 Link Image
Enzyme 12 GeneCard ID BCKDHA Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:1
Enzyme 12 Locus 19q13.1-q13.2
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 999
Enzyme 13 Name GMP reductase
Enzyme 13 Synonyms Not Available
Enzyme 13 Gene Name GMPR
Enzyme 13 Protein Sequence >GMP reductase
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAVVMSQHSMFTAIHKHYTLDDWKLFAANHPECLQHVAVSSGSGKDDLEKMSNILEAV
PQVKFICLDVANGYSEHFVEFVKLVRSRFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVIERNGQKLKLFYGMSSETAMKKHSGGVAEYRAPEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
Enzyme 13 Number of Residues 345
Enzyme 13 Molecular Weight 37503.8
Enzyme 13 Theoretical pI 7.12
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Nucleotide transport and metabolism
Enzyme 13 Specific Function Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 115305427 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q08DA2 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name Q08DA2_BOVIN Link Image
Enzyme 13 PDB ID 2BLE Link Image
Enzyme 13 PDB File Show
Enzyme 13 3D Structure
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >1038 bp
ATGCCCCGCATAGATGCGGACCTCAAGCTAGACTTCAAGGATGTCCTGCTCCGACCCAAA
CGAAGCAGCCTCAAGAGTAGAGCCGAGGTGGACCTTGAGCGAACCTTCACATTTCGGAAC
TCGAAGCAGACCTACTCGGGGATTCCCATCATTGTGGCCAACATGGACACCGTGGGGACG
TTTGAGATGGCAGTGGTGATGTCACAGCACTCCATGTTTACAGCGATTCACAAGCATTAT
ACCCTGGATGACTGGAAGCTCTTTGCAGCTAATCACCCAGAATGCCTGCAGCATGTAGCC
GTGAGTTCGGGCAGTGGGAAGGATGATCTGGAAAAGATGAGCAACATCCTGGAAGCTGTG
CCACAGGTTAAGTTTATTTGCCTGGATGTGGCCAATGGGTACTCGGAGCATTTTGTGGAG
TTCGTGAAGCTGGTCCGGTCCAGATTTCCAGAACACACCATTATGGCAGGGAACGTGGTG
ACGGGAGAGATGGTAGAAGAGCTTATTCTTTCTGGAGCAGATATCATCAAAGTGGGAGTT
GGACCAGGTTCCGTGTGCACCACCCGCACCAAGACAGGGGTGGGCTACCCCCAGCTGAGT
GCTGTGATCGAGTGCGCAGATTCGGCCCACGGCCTGAAGGGGCACATCATCTCGGACGGA
GGCTGCACGTGTCCAGGAGATGTCGCCAAAGCCTTTGGGGCTGGAGCAGATTTTGTTATG
CTGGGAGGAATGTTTTCGGGCCATACTGAGTGTGCCGGAGAGGTGATCGAGAGGAACGGA
CAGAAGCTCAAGCTCTTCTATGGGATGAGCTCAGAGACGGCGATGAAGAAACACTCCGGA
GGGGTCGCGGAGTATAGAGCCCCTGAGGGCAAGACTGTGGAAGTGCCTTACAAAGGGGAT
GTCGAGAACACGATTCTGGATATTCTCGGGGGACTGAGGTCTACCTGCACCTACGTGGGG
GCCGCCAAACTCAAAGAGCTCAGCAGGAGGGCGACGTTCATCCGAGTGACCCAGCAACAC
AACACCGTGTTCAGCTAA
Enzyme 13 GenBank Gene ID BC123863 Link Image
Enzyme 13 GeneCard ID GMPR Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:6
Enzyme 13 Locus 6p23
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1002
Enzyme 14 Name Inosine-5'-monophosphate dehydrogenase 2
Enzyme 14 Synonyms
  1. IMP dehydrogenase 2
  2. IMPDH-II
  3. IMPD 2
Enzyme 14 Gene Name IMPDH2
Enzyme 14 Protein Sequence >Inosine-5'-monophosphate dehydrogenase 2
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPRDRVRDVFEAKARHGFCGIPITDTGRMGSHLVGIISSRDIDFLKEEEHDRLLGEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNENDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLSQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSIQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Enzyme 14 Number of Residues 514
Enzyme 14 Molecular Weight 55762.5
Enzyme 14 Theoretical pI 7.34
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Nucleotide transport and metabolism
Enzyme 14 Specific Function Rate limiting enzyme in the de novo synthesis of guanine nucleotides and therefore is involved in the regulation of cell growth. It may also have a role in the development of malignancy and the growth progression of some tumors
Enzyme 14 Pathways
  • Purine metabolism
  • XMP biosynthesis via de novo pathway
  • XMP from IMP:step 1/1
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 74356323 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q3SWY3 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name IMDH2_BOVIN Link Image
Enzyme 14 PDB ID 1JR1 Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1545 bp
ATGGCCGACTACCTGATTAGCGGGGGCACGTCTTATGTGCCGGACGACGGGCTCACGGCA
CAGCAGCTGTTCAACTGCGGGGACGGCCTCACCTACAATGACTTTCTCATTCTCCCCGGG
TACATCGACTTCACTGCAGACCAAGTGGACCTGACCTCTGCTCTAACTAAAAAGATCACT
CTGAAGACCCCACTGGTTTCCTCACCCATGGACACAGTCACAGAGGCTGGGATGGCCATA
GCAATGGCGCTTACGGGTGGTATTGGCTTCATTCATCACAATTGTACACCAGAATTCCAG
GCCAATGAAGTTCGGAAAGTGAAGAAATATGAGCAGGGATTCATCACAGACCCTGTGGTC
CTCAGTCCCAGGGATCGCGTGAGGGATGTGTTTGAAGCCAAGGCCCGGCATGGGTTCTGT
GGTATCCCCATCACTGACACAGGCCGGATGGGAAGCCACCTGGTGGGCATCATCTCCTCA
AGGGACATTGATTTTCTCAAGGAGGAAGAGCATGACCGGCTTTTGGGAGAGATCATGACA
AAGAGGGAAGACTTGGTGGTAGCCCCTGCAGGCATCACATTGAAAGAAGCAAATGAAATT
CTGCAGCGTAGCAAGAAGGGAAAGTTACCCATTGTAAATGAAAATGATGAGCTGGTGGCC
ATCATTGCCCGGACAGACCTGAAGAAAAACCGAGATTACCCACTGGCCTCCAAAGATGCC
AAGAAGCAGCTGCTGTGTGGAGCAGCCATTGGCACTCATGAGGATGACAAGTATCGGCTA
GACTTGCTGTCCCAGGCCGGTGTGGACGTAGTGGTTTTGGATTCTTCCCAAGGAAACTCC
ATCTTCCAGATCAACATGATCAAGTACATCAAAGAGAAATACCCCAGTATCCAAGTCATT
GGAGGGAATGTGGTCACGGCTGCTCAGGCCAAGAACCTCATTGATGCTGGCGTAGATGCC
CTGCGGGTGGGAATGGGCAGTGGCTCCATCTGCATCACTCAGGAAGTGCTGGCCTGCGGG
CGGCCCCAAGCAACAGCTGTTTACAAGGTGTCAGAATATGCGCGGCGTTTTGGTGTTCCT
GTCATTGCTGACGGAGGAATCCAAAATGTGGGCCATATTGCCAAAGCTTTGGCCCTTGGA
GCCTCCACAGTTATGATGGGCTCCCTCCTGGCTGCTACCACTGAGGCCCCTGGCGAGTAC
TTCTTCTCTGATGGAATCCGGCTAAAGAAGTACCGTGGTATGGGTTCTCTCGATGCCATG
GACAAGCATCTCAGCAGCCAGAATCGATATTTCAGTGAAGCAGACAAAATCAAGGTGGCC
CAGGGGGTGTCTGGGGCTGTTCAGGATAAAGGATCCATCCATAAGTTTGTTCCCTACCTG
ATTGCTGGCATCCAGCACTCCTGCCAGGATATTGGTGCCAAGAGTCTGACCCAAGTTCGA
GCCATGATGTATTCTGGGGAGCTCAAGTTTGAGAAGAGAACATCCTCAGCCCAGGTGGAA
GGTGGTGTCCACAGCCTCCATTCGTATGAGAAGCGTCTTTTCTGA
Enzyme 14 GenBank Gene ID BC104602 Link Image
Enzyme 14 GeneCard ID IMPDH2 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:3
Enzyme 14 Locus 3p21.2
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 1003
Enzyme 15 Name Inosine-5'-monophosphate dehydrogenase
Enzyme 15 Synonyms Not Available
Enzyme 15 Gene Name IMPDH1
Enzyme 15 Protein Sequence >Inosine-5'-monophosphate dehydrogenase
MEEPRAPPAGSAPFPVSLQGGGTADVPEPGARQHPGHETAAQRYSARLLQAGYEPESMAD
YLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFTADEVDLTSALTRKITLKT
PLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSP
SHTVGDVLEAKIRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRN
ELVVAPAGVTLKEANEILQRSKKGKLPIVNDRDELVAIIARTDLKKNRDYPLASKDSHKQ
LLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGN
VVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIA
DGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKS
SSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMM
YSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Enzyme 15 Number of Residues 571
Enzyme 15 Molecular Weight 61330.6
Enzyme 15 Theoretical pI 6.75
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Nucleotide transport and metabolism
Enzyme 15 Specific Function Inosine 5'-phosphate + NAD(+) + H(2)O = xanthosine 5'-phosphate + NADH
Enzyme 15 Pathways
  • Purine metabolism
  • XMP biosynthesis via de novo pathway
  • XMP from IMP:step 1/1
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 117306245 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID A0JNA3 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name A0JNA3_BOVIN Link Image
Enzyme 15 PDB ID 1JCN Link Image
Enzyme 15 PDB File Show
Enzyme 15 3D Structure
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1716 bp
ATGGAGGAGCCACGCGCTCCGCCAGCAGGGTCGGCGCCGTTCCCGGTGTCTCTGCAGGGA
GGCGGAACCGCTGATGTTCCGGAGCCCGGAGCCCGGCAGCACCCGGGACACGAGACGGCG
GCGCAACGGTACAGCGCCCGCCTGCTGCAGGCCGGCTACGAGCCCGAGAGCATGGCGGAC
TACCTGATCAGCGGCGGCACCGGTTACGTGCCCGAGGATGGGCTCACTGCGCAGCAGCTG
TTCGCCAACGCCGACGGCCTCACCTACAACGACTTCCTGATTCTCCCAGGATTCATAGAC
TTCACAGCTGATGAAGTGGATCTGACTTCAGCCCTGACTCGGAAGATCACACTAAAGACG
CCACTCATCTCATCCCCCATGGACACTGTGACGGAGGCTGACATGGCCATTGCAATGGCT
CTGATGGGCGGTATTGGTTTCATTCACCACAACTGCACTCCAGAATTCCAGGCCAATGAG
GTGCGGAAGGTCAAGAAATTTGAACAGGGCTTCATCACGGACCCCGTGGTACTAAGCCCC
TCGCATACCGTGGGTGACGTGCTGGAGGCCAAGATCCGGCATGGCTTCTCAGGCATCCCC
ATCACTGAGACGGGCACCATGGGCAGCAAGCTGGTGGGCATTGTCACCTCCCGAGACATC
GACTTCCTTGCCGAGAAGGACCACACCACCCTTCTCAGTGAGGTGATGACCCCACGGAAT
GAGCTGGTGGTGGCTCCAGCAGGTGTAACATTGAAAGAGGCAAATGAGATTCTGCAGCGC
AGCAAGAAAGGAAAGCTGCCCATTGTCAATGATCGAGATGAGTTAGTGGCCATCATTGCC
CGCACTGACCTGAAGAAGAACCGGGACTACCCCCTGGCCTCCAAGGATTCCCACAAGCAG
CTGCTGTGCGGGGCGGCTGTGGGCACCCGTGAGGATGACAAATACCGCCTGGACCTGCTC
ACCCAGGCGGGCGCTGATGTCATAGTGCTGGACTCATCCCAAGGGAACTCTGTGTATCAG
ATCGCCATGGTACACTACATTAAGCAGAAGTACCCCCACCTCCAGGTGATTGGGGGCAAT
GTGGTGACAGCAGCTCAGGCCAAGAACCTGATTGACGCTGGTGTGGATGGGCTGCGTGTG
GGCATGGGATGCGGCTCCATCTGCATCACCCAGGAAGTGATGGCCTGTGGTCGGCCCCAG
GGCACTGCCGTGTACAAAGTGGCTGAGTATGCCCGGCGCTTCGGGGTCCCAGTCATAGCC
GACGGCGGCATCCAGACCGTGGGGCACGTGGTTAAGGCGCTGGCCCTCGGAGCCTCCACA
GTGATGATGGGTTCCCTGCTCGCGGCCACCACGGAGGCCCCCGGCGAATACTTCTTCTCG
GATGGTGTGAGGCTCAAGAAGTACCGCGGCATGGGCTCGCTGGACGCCATGGAGAAGAGC
AGCAGCAGCCAGAAACGCTACTTCAGCGAGGGGGACAAGGTGAAGATTGCGCAGGGCGTC
TCGGGCTCTATCCAGGACAAAGGCTCCATTCAGAAGTTCGTGCCCTACCTCATAGCGGGC
ATCCAGCACGGCTGCCAGGACATCGGGGCCCGGAGTCTGTCTGTCCTGCGGTCCATGATG
TACTCAGGAGAGCTCAAGTTTGAGAAGCGGACCATGTCGGCCCAGATCGAGGGCGGCGTC
CACGGCCTGCACTCTTACGAGAAGCGGCTGTACTGA
Enzyme 15 GenBank Gene ID BC126584 Link Image
Enzyme 15 GeneCard ID IMPDH1 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:7
Enzyme 15 Locus 7q31.3-q32
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References Not Available
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 1031
Enzyme 16 Name Sodium/potassium-transporting ATPase subunit beta-2
Enzyme 16 Synonyms
  1. Sodium/potassium-dependent ATPase subunit beta-2
Enzyme 16 Gene Name ATP1B2
Enzyme 16 Protein Sequence >Sodium/potassium-transporting ATPase subunit beta-2
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVISFYAGANQSMNVTCVGKRDEDAENLGNFVMFPANGNIDLIYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAPRVAFKLRINKT
Enzyme 16 Number of Residues 290
Enzyme 16 Molecular Weight 33401.0
Enzyme 16 Theoretical pI 8.25
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in potassium ion binding
Enzyme 16 Specific Function This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • 40-67
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 1314361 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q28030 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name AT1B2_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >873 bp
ATGGTCATCCAGAAAGAGAAGAAGAGCTGCGGGCAGGTGGTTGAGGAGTGGAAGGAGTTC
GTGTGGAACCCGAGGACGCACCAGTTCATGGGCCGCACAGGGACCAGCTGGGCCTTTATC
CTCCTCTTCTACCTCGTCTTCTATGGCTTCCTCACCGCCATGTTCACCCTCACCATGTGG
GTGATGCTGCAGACAGTCTCCGACCACACCCCCAAGTACCAGGACCGATTGGCTACACCA
GGCTTGATGATTCGCCCTAAGACTGAGAACCTCGATGTCATTGTCAATGTCAGTGACACT
GAAAGCTGGGACCAGCATGTTCAGAAACTCAATAAGTTCTTGGAGCCTTACAATGACTCC
ATCCAAGCCCAGAAGAATGATGTCTGCCGCCCTGGTCGCTATTACGAACAACCAGATAAC
GGAGTTCTAAACTACCCAAAACGTGCTTGCCAGTTCAACCGGACCCAGCTGGGTGACTGC
TCTGGCATTGGGGACCCCACCCACTATGGTTACAGCACTGGACAGCCCTGTGTCTTCATC
AAGATGAACCGGGTCATCAGCTTCTATGCAGGAGCAAACCAGAGCATGAATGTTACCTGC
GTGGGGAAGCGAGATGAAGATGCCGAGAATCTCGGCAACTTCGTTATGTTCCCTGCAAAC
GGCAATATCGACCTCATATACTTCCCCTACTATGGCAAGAAGTTTCACGTGAACTACACA
CAGCCCCTGGTGGCCGTCAAGTTCCTGAATGTGACCCCCAACGTGGAGGTGAACGTGGAG
TGCCGCATCAATGCTGCCAACATTGCCACTGACGATGAGCGAGACAAGTTCGCCCCCCGT
GTGGCCTTCAAACTCCGCATCAACAAAACCTGA
Enzyme 16 GenBank Gene ID U45944 Link Image
Enzyme 16 GeneCard ID ATP1B2 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:1
Enzyme 16 Locus 17p13.1
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 1032
Enzyme 17 Name Sodium/potassium-transporting ATPase subunit beta-3
Enzyme 17 Synonyms
  1. Sodium/potassium-dependent ATPase subunit beta-3
  2. ATPB-3
  3. CD298 antigen
Enzyme 17 Gene Name ATP1B3
Enzyme 17 Protein Sequence >Sodium/potassium-transporting ATPase subunit beta-3
MTKTDKKSFNQSLAEWKLFIYNRTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWA
MLQTLNDEVPKYRDQIPSPGLMVFPKPVSALDFSFSLSDAESYQGYIDDLKKFLKPYGLE
EQKNLTDCTNGTFFEQKGPEYTACQFPLALLEACSGVDDPTFGYQEGKPCILVKMNRIIG
LKPQGEPRIECTGKSESTAFLSTYPSNGTIDLKYFPYYGKKLHGNYLQPLVAVQVGFGSD
ADVREVMVECKIDGSPNLKTQNDRDKFLGRVAFKITMHA
Enzyme 17 Number of Residues 279
Enzyme 17 Molecular Weight 31521.0
Enzyme 17 Theoretical pI 7.20
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in potassium ion binding
Enzyme 17 Specific Function This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • 36-56
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 74354619 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q3T0C6 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name AT1B3_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >840 bp
ATGACGAAGACAGACAAGAAGTCCTTCAACCAGAGCCTGGCCGAGTGGAAGCTCTTCATC
TACAACCGGACAACCGGAGAGTTCCTGGGGCGCACCGCCAAGAGCTGGGGTTTGATCTTG
CTCTTCTACCTAGTCTTTTATGGGTTCCTGGCTGCACTCTTTTCATTCACAATGTGGGCC
ATGCTTCAGACTCTGAATGATGAGGTTCCAAAATATCGTGACCAGATTCCTAGTCCAGGA
CTTATGGTTTTTCCAAAACCAGTGTCAGCGTTGGATTTTTCATTCAGCCTGTCTGATGCA
GAATCCTATCAAGGGTACATTGATGACCTTAAGAAATTTCTAAAGCCATATGGCTTAGAA
GAACAGAAGAATCTCACAGATTGTACCAATGGAACCTTTTTTGAGCAGAAGGGTCCAGAA
TACACAGCATGTCAGTTTCCTCTTGCCTTACTTGAAGCATGCAGTGGTGTGGATGATCCC
ACGTTTGGCTACCAAGAAGGAAAGCCTTGTATTCTTGTGAAAATGAACAGAATAATTGGA
TTAAAGCCTCAAGGAGAACCAAGGATAGAATGTACTGGAAAGAGCGAAAGCACAGCATTT
CTATCAACTTATCCTTCCAATGGAACGATAGATTTAAAATATTTTCCATATTATGGGAAA
AAACTGCATGGGAACTACCTGCAGCCACTAGTTGCCGTCCAGGTCGGCTTTGGTAGTGAT
GCTGACGTAAGAGAAGTAATGGTTGAGTGCAAGATCGATGGATCACCCAACCTAAAAACC
CAGAATGACCGTGACAAGTTTTTAGGACGAGTTGCATTCAAGATCACCATGCATGCATAG
Enzyme 17 GenBank Gene ID BC102454 Link Image
Enzyme 17 GeneCard ID ATP1B3 Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:3
Enzyme 17 Locus 3q23
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 1033
Enzyme 18 Name Sodium/potassium-transporting ATPase gamma chain
Enzyme 18 Synonyms
  1. Sodium pump gamma chain
  2. Na(+)/K(+) ATPase subunit gamma
  3. FXYD domain-containing ion transport regulator 2
Enzyme 18 Gene Name FXYD2
Enzyme 18 Protein Sequence >Sodium/potassium-transporting ATPase gamma chain
MVAVQGTEDPFYYDYETVRNGGLIFAALAFIVGLVIILSKRFRCGAKRQHRQIPEDGL
Enzyme 18 Number of Residues 58
Enzyme 18 Molecular Weight 6544.5
Enzyme 18 Theoretical pI 8.49
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in ion channel activity
Enzyme 18 Specific Function May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • 20-39
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 397 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q04645 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name ATNG_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >177 bp
ATGGTGGCTGTGCAGGGGACCGAGGACCCATTCTACTATGACTACGAGACCGTCCGTAAT
GGGGGCCTGATCTTCGCCGCCCTGGCCTTCATCGTGGGGCTCGTCATCATCCTCAGCAAA
AGATTCCGCTGCGGGGCCAAGAGGCAGCACCGGCAAATTCCTGAAGATGGGCTCTAA
Enzyme 18 GenBank Gene ID X70059 Link Image
Enzyme 18 GeneCard ID FXYD2 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:1
Enzyme 18 Locus 11q23
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 1205
Enzyme 19 Name Cell division protein kinase 2
Enzyme 19 Synonyms Not Available
Enzyme 19 Gene Name CDK2
Enzyme 19 Protein Sequence >Cell division protein kinase 2
MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINADGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Enzyme 19 Number of Residues 298
Enzyme 19 Molecular Weight 33873.1
Enzyme 19 Theoretical pI 8.99
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Involved in ATP binding
Enzyme 19 Specific Function Involved in the control of the cell cycle. Interacts with cyclins A, B1, B3, D, or E. Activity of CDK2 is maximal during S phase and G2
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 59857945 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q5E9Y0 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name CDK2_BOVIN Link Image
Enzyme 19 PDB ID 1V1K Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >897 bp
ATGGAGAACTTCCAAAAAGTGGAAAAGATCGGAGAGGGAACGTACGGAGTTGTGTACAAA
GCCAAAAACAAGTTGACGGGAGAAGTGGTGGCGCTTAAAAAAATCCGCCTGGACACTGAG
ACAGAGGGTGTACCCAGTACTGCCATACGAGAGATCTCTCTGCTTAAGGAGCTTAATCAC
CCTAATATTGTCAAGCTGCTGGATGTCATTCACACAGAAAACAAACTCTACCTGGTTTTT
GAGTTTCTGCACCAGGATCTCAAGAAATTCATGGATGCCTCTGCGCTCACTGGCATTCCT
CTTCCGCTCATAAAGAGCTACTTGTTCCAGCTGCTCCAGGGCCTAGCTTTCTGCCACTCT
CATCGAGTCCTGCACCGAGACCTTAAACCTCAGAACCTGCTTATCAACGCAGATGGGTCC
ATCAAGCTAGCAGACTTTGGACTAGCCAGAGCTTTTGGGGTCCCTGTTCGTACTTATACC
CACGAGGTGGTGACTCTGTGGTACCGAGCACCGGAAATCCTTCTGGGCTGCAAATACTAC
TCCACAGCAGTGGACATATGGAGCCTCGGTTGCATCTTTGCTGAGATGGTGACCCGCCGG
GCCCTATTCCCCGGAGATTCTGAGATCGACCAACTCTTCCGGATCTTTCGGACCCTGGGA
ACCCCAGATGAGGTGGTTTGGCCAGGAGTTACTTCTATGCCTGATTATAAGCCAAGTTTC
CCCAAGTGGGCCAGGCAGGATTTTAGCAAAGTGGTGCCTCCCCTGGATGAAGATGGACGG
AGCTTGTTATCGCAAATGCTGCACTACGACCCTAACAAGCGGATTTCAGCCAAGGCAGCT
CTGGCTCACCCTTTCTTCCAAGATGTGACCAAGCCAGTACCTCACCTTCGACTCTGA
Enzyme 19 GenBank Gene ID BT020790 Link Image
Enzyme 19 GeneCard ID CDK2 Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:1
Enzyme 19 Locus 12q13
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References
  1. [PubMed Link Image]
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 1244
Enzyme 20 Name Caseinolytic peptidase B protein homolog
Enzyme 20 Synonyms
  1. Suppressor of potassium transport defect 3
Enzyme 20 Gene Name CLPB
Enzyme 20 Protein Sequence >Caseinolytic peptidase B protein homolog
MLGSLVSKRTAPAPRLLLQLLRSPSLRSHESATGQSVTTGGRGEPQWLRAAVGGRHGTSP
ALLTGGGAATGGRQRGRTETPCLAAATWGRLPSPEDTLPGQDSWNGVLSRAGLGVWALAT
ALVVHCYSKSPSSKDAALMEAARANNVQEVSRLLSEGADVNARHRLGWTALMVAAINRND
SVVQVLLAAGADPNLGDDFSSVYKTAKDQGIHSLEVLVTREDDFNNRLNNRASFKGCTAL
HYAVLADDYRTVKELLDGGANPLQRNEMGHTPLDYAREGEVMKLLRTSETKYQEKQRKRE
AEERRRFPLEQRLKEHIIGQESAIATVGAAIRRKENGWYDEEHPLVFLFLGSSGIGKTEL
AKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFIGSPPGYIGHEEGGQLTKKLKQCPNAV
VLFDEVDKAHPDVLTIMLQLFDEGRLTDGKGKTIDCKDAIFIMTSNVASDEIAQHALQLR
QEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLP
FCHSELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVEGYNVHYGARSIKHEVERRV
VNQLAAAYEQDLLPGGCTLRITVEDSDKQLLRSPELSSSQAERRPPKLRLEIIDKDSKTH
KLDIQAPLHPEKVCHTL
Enzyme 20 Number of Residues 677
Enzyme 20 Molecular Weight 75439.1
Enzyme 20 Theoretical pI 8.68
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 20 Specific Function May function as a regulatory ATPase and be related to secretion/protein trafficking process
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 59858135 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q5E9N5 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name CLPB_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >2034 bp
ATGCTGGGGTCCCTGGTGTCGAAGAGAACAGCGCCAGCGCCGCGGCTCCTTCTTCAGCTG
CTTAGGTCCCCATCGCTCCGGAGCCACGAAAGTGCCACCGGCCAGAGTGTGACCACCGGG
GGTCGCGGGGAGCCTCAGTGGCTGAGGGCGGCCGTCGGGGGGCGCCATGGAACGTCGCCG
GCCCTACTCACCGGAGGAGGGGCAGCCACTGGAGGGCGCCAGAGAGGACGTACCGAGACC
CCCTGCCTTGCAGCTGCCACGTGGGGACGTCTTCCTAGCCCCGAAGACACACTCCCTGGG
CAGGACAGCTGGAATGGAGTCCTCAGCAGAGCCGGCTTGGGCGTGTGGGCCCTGGCCACG
GCGCTGGTGGTTCATTGTTACAGCAAGAGCCCGTCCAGCAAGGATGCAGCCCTGATGGAA
GCTGCTCGAGCCAACAATGTCCAAGAAGTCAGCAGACTATTGTCGGAAGGTGCAGATGTC
AATGCAAGGCACAGACTTGGCTGGACAGCACTAATGGTGGCAGCCATCAACCGAAACGAC
AGTGTGGTGCAGGTCCTGCTTGCTGCTGGTGCTGACCCAAACCTTGGGGACGATTTTAGC
AGTGTATACAAGACCGCCAAGGATCAGGGAATCCATTCTTTAGAAGTCCTGGTCACCCGA
GAGGATGACTTCAACAACCGGCTGAACAACCGCGCCAGCTTCAAGGGTTGCACAGCCCTA
CACTACGCTGTCCTCGCTGATGACTACCGGACCGTCAAGGAGCTGCTTGATGGAGGAGCC
AATCCCTTGCAGAGGAATGAAATGGGACACACACCCTTGGATTATGCCCGAGAAGGGGAG
GTGATGAAGCTTTTAAGGACTTCTGAGACCAAGTACCAAGAGAAGCAGCGGAAGCGGGAG
GCCGAGGAGCGGCGCCGCTTTCCCCTGGAGCAGCGGCTGAAGGAGCACATCATTGGCCAG
GAGAGCGCCATCGCCACAGTGGGCGCAGCGATCCGGAGGAAGGAGAATGGCTGGTACGAC
GAAGAACACCCCCTGGTCTTCCTCTTCTTGGGATCATCTGGAATAGGAAAAACAGAACTG
GCCAAGCAGACAGCTAAATATATGCACAAAGATGCCAAAAAGGGTTTCATCAGGCTAGAC
ATGTCTGAGTTCCAGGAGCGGCATGAGGTAGCCAAGTTCATCGGGTCCCCACCAGGCTAC
ATTGGCCACGAGGAGGGTGGCCAGCTGACCAAGAAGCTGAAGCAGTGCCCCAACGCCGTG
GTGCTCTTTGATGAGGTAGACAAAGCCCACCCAGATGTGCTCACCATCATGCTGCAGCTG
TTTGATGAGGGCCGGCTGACAGATGGAAAAGGCAAGACCATCGACTGCAAGGACGCCATC
TTCATCATGACCTCAAACGTGGCCAGTGACGAGATAGCACAGCATGCGCTGCAGCTGAGG
CAGGAAGCTTTGGAGATGAGCCGTAACCGGATTGCCGAGAACCTTGGGGACGTCCAGATC
AGTGACAAGATCACCATCTCAAAGAACTTCAAGGAAAACGTGATTCGCCCCATCCTAAAA
GCTCACTTCCGGAGAGATGAGTTTCTGGGACGAATCAATGAGATCGTCTACTTCCTCCCC
TTCTGCCACTCGGAGCTCATCCAGCTCGTCAACAAGGAGTTGAATTTCTGGGCCAAAAGA
GCTAAGCAAAGGCACAACATCACTCTGCTCTGGGACCGTGAGGTGGCAGACGTGTTGGTC
GAAGGCTACAATGTGCACTATGGCGCCCGCTCCATCAAGCATGAGGTGGAGCGCCGAGTG
GTGAACCAGCTGGCGGCTGCCTATGAGCAGGACCTGCTGCCGGGGGGCTGCACCCTGCGC
ATCACTGTGGAGGACTCGGACAAGCAGCTGCTCAGGAGTCCTGAACTGTCCTCATCCCAG
GCCGAGAGGCGTCCCCCCAAGCTGCGGCTGGAGATCATCGATAAGGACAGCAAGACCCAC
AAATTGGACATCCAGGCACCACTCCACCCTGAGAAGGTGTGCCACACCCTCTAG
Enzyme 20 GenBank Gene ID BT020885 Link Image
Enzyme 20 GeneCard ID CLPB Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:1
Enzyme 20 Locus 11q13.4
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available