We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Sodium (RMDB00588)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-15 23:07:35
Update Date 2009-08-20 16:30:02
Accession Number RMDB00588
Common Name Sodium
Description Sodium ions are necessary for regulation of blood and body fluids, transmission of nerve impulses, heart activity, and certain metabolic functions. Physiologically, it exists as an ion in the body. Sodium is needed by animals, which maintain high concentrations in their blood and extracellular fluids, but the ion is not needed by plants. The human requirement for sodium in the diet is less than 500 mg per day, which is typically less than a tenth as much as many diets "seasoned to taste." Most people consume far more sodium than is physiologically needed. For certain people with salt-sensitive blood pressure, this extra intake may cause a negative effect on health.
Synonyms
  1. Sodium
  2. Sodium ion
Chemical IUPAC Name sodium
Chemical Formula [Na]+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals
Application
Source
  • Exogenous
Average Molecular Weight 22.990
Monoisotopic Molecular Weight 22.989771
Isomeric SMILES [Na+]
Canonical SMILES [Na+]
KEGG Compound ID C01330 Link Image
BioCyc ID Not Available
BiGG ID 37376 Link Image
Wikipedia Link Sodium Link Image
METLIN ID 3192 Link Image
PubChem Compound 923 Link Image
PubChem Substance 14710388 Link Image
ChEBI ID 26708 Link Image
CAS Registry Number 7440-23-5
InChI Identifier InChI=1/Na/q+1
Synthesis Reference Not Available
Melting Point (Experimental) 97.82 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 445 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.77 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • golgi apparatus
  • peroxisome
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 113362.44 +/- 3434.15 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 115283 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Sodium/potassium-transporting ATPase subunit alpha-1
  2. Sodium/potassium-transporting ATPase subunit alpha-2
  3. DNA polymerase beta
  4. Ubiquitin-conjugating enzyme E2 E3
  5. Protein tyrosine phosphatase type IVA 3
  6. Sodium/potassium-transporting ATPase subunit beta-2
  7. Sodium/potassium-transporting ATPase subunit beta-3
  8. Sodium/potassium-transporting ATPase gamma chain
Enzyme 1 [top]
Enzyme 1 ID 145
Enzyme 1 Name Sodium/potassium-transporting ATPase subunit alpha-1
Enzyme 1 Synonyms
  1. Sodium pump subunit alpha-1
  2. Na(+)/K(+) ATPase alpha-1 subunit
Enzyme 1 Gene Name ATP1A1
Enzyme 1 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-1
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAVLCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALS
RIAGLCNRAVFQANQDNLPILKRAVAGDASESALLKCIEVCCGSVKEMRERYTKIVEIPF
NSTNKYQLSIHKNANAGEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDARA
CVVHGSDLKDMTPEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPQTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPNHLLGIRVTWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
Enzyme 1 Number of Residues 1021
Enzyme 1 Molecular Weight 112641.7
Enzyme 1 Theoretical pI 5.19
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Inorganic ion transport and metabolism
Enzyme 1 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 771-790 801-821 842-864 917-936 950-968 984-1004
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 115305284 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q08DA1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name AT1A1_BOVIN Link Image
Enzyme 1 PDB ID 1MO8 Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >3066 bp
ATGGGGAAGGGGGTTGGACGTGATAAATATGAACCGGCAGCTGTTTCAGAGCATGGGGAC
AAGAAAAAAGCCAAGAAAGAGAGGGATATGGACGAGCTGAAGAAAGAAGTTTCTATGGAT
GATCATAAACTTAGCCTTGATGAACTTCATCGCAAATATGGAACAGACTTGAGCCGAGGC
TTAACAACTGCTCGAGCTGCCGAGATCCTAGCCAGAGATGGACCCAACGCCCTCACGCCC
CCTCCCACGACCCCTGAATGGGTCAAGTTCTGTCGACAGCTGTTTGGGGGGTTCTCAATG
TTACTGTGGATTGGAGCAGTTCTTTGCTTCCTGGCCTATGGTATCCAAGCTGCTACAGAA
GAGGAACCTCAAAATGATAATCTGTACCTTGGTGTGGTGCTGTCTGCTGTCGTCATCATA
ACCGGGTGTTTCTCCTACTATCAAGAAGCTAAAAGCTCAAAGATCATGGAGTCCTTCAAA
AACATGGTTCCTCAGCAAGCCCTCGTGATTCGAAATGGTGAGAAAATGAGCATAAATGCG
GAAGAGGTTGTCGTCGGAGATCTGGTGGAAGTGAAAGGAGGGGATCGAATTCCTGCCGAT
CTCAGGATCATTTCTGCAAATGGCTGCAAGGTGGATAACTCCTCACTCACGGGAGAATCA
GAGCCACAGACCAGGTCTCCGGATTTCACCAATGAAAATCCCCTGGAGACACGGAACATT
GCCTTTTTTTCAACTAACTGTGTTGAAGGCACTGCACGTGGCATTGTCGTGTATACTGGG
GATCGAACCGTGATGGGCAGAATTGCCACGCTGGCTTCTGGGCTGGAGGGGGGCCAGACT
CCCATCGCTGCGGAAATTGAACATTTTATCCACATCATCACGGGTGTGGCTGTGTTCCTG
GGCGTGTCGTTCTTCATCCTTTCTCTGATCCTTGAGTACACCTGGCTGGAGGCTGTCATC
TTCCTCATCGGCATCATTGTAGCCAACGTGCCAGAGGGTTTGCTGGCCACCGTCACGGTG
TGCCTGACGCTGACTGCAAAGCGCATGGCCAGGAAAAACTGCTTAGTGAAGAACCTGGAG
GCTGTGGAGACCTTGGGATCCACGTCCACCATCTGCTCAGACAAAACTGGAACTCTGACC
CAGAACCGAATGACAGTGGCCCACATGTGGTTCGACAACCAAATCCACGAGGCGGACACG
ACAGAGAATCAGAGCGGTGTTTCATTTGACAAGACTTCGGCCACGTGGCTCGCTCTGTCC
AGAATTGCAGGTCTTTGTAACAGGGCCGTGTTTCAGGCTAACCAGGATAACCTGCCTATC
CTGAAGCGGGCTGTAGCGGGTGATGCCTCAGAGTCTGCGCTCCTGAAGTGCATTGAGGTG
TGCTGCGGTTCTGTGAAGGAGATGAGAGAGAGATACACCAAGATCGTCGAGATCCCATTC
AACTCCACCAACAAGTACCAGTTATCCATCCACAAGAACGCCAATGCAGGTGAGCCCCGG
CACCTACTGGTGATGAAAGGTGCCCCAGAAAGGATCTTGGACCGCTGCAGCTCCATCCTC
ATCCATGGCAAGGAGCAGCCCCTGGACGAGGAGCTGAAGGACGCTTTTCAGAATGCCTAC
CTGGAGCTGGGTGGCCTCGGAGAGCGTGTGCTGGGTTTTTGCCACTTGCTGCTGCCAGAT
GAGCAGTTTCCTGAAGGCTTCCAGTTTGACACCGACGATGTGAACTTCCCTGTTGATAAT
CTCTGCTTCGTGGGACTCATCTCCATGATTGACCCACCACGGGCTGCTGTCCCAGATGCT
GTGGGCAAATGCCGAAGTGCTGGAATCAAGGTCATCATGGTCACCGGAGACCATCCCATC
ACTGCCAAAGCCATTGCCAAAGGTGTGGGGATCATCTCAGAAGGTAATGAGACTGTAGAA
GACATTGCTGCCCGCCTCAACATCCCAGTGAGCCAGGTGAACCCCAGGGATGCCCGGGCC
TGCGTGGTGCATGGAAGTGATCTGAAGGACATGACTCCCGAGCAGCTGGATGACATCTTG
AAGTACCACACAGAGATTGTGTTCGCCAGGACCTCTCCGCAGCAGAAGCTCATCATTGTG
GAAGGCTGCCAGAGACAGGGTGCCATCGTGGCTGTAACTGGAGACGGTGTCAATGACTCC
CCGGCTTTGAAGAAGGCAGACATTGGGGTTGCCATGGGGATTGCAGGCTCAGACGTGTCT
AAGCAAGCTGCTGACATGATTCTCCTAGATGACAACTTTGCCTCAATTGTGACTGGAGTA
GAGGAAGGTCGTCTGATCTTTGATAACTTGAAGAAATCCATTGCTTATACCCTCACCAGT
AACATTCCTGAGATTACCCCCTTCCTGATATTTATTATTGCAAACATTCCACTCCCTCTG
GGGACCGTCACCATCCTCTGCATCGACTTGGGAACGGACATGGTCCCTGCTATCTCCTTG
GCTTATGAGCAGGCTGAGAGCGACATCATGAAGAGGCAGCCCAGAAACCCCCAGACGGAC
AAACTCGTGAACGAGCGGCTGATCAGCATGGCCTATGGACAGATTGGTATGATCCAGGCC
CTGGGGGGCTTCTTCACTTACTTTGTTATCATGGCTGAGAACGGCTTCCTCCCAAATCAC
CTGCTGGGCATCCGAGTGACCTGGGATGACCGTTGGATCAACGATGTGGAGGACAGCTAT
GGGCAGCAGTGGACCTATGAACAGAGGAAGATTGTGGAGTTCACCTGCCACACGGCCTTC
TTTGTCAGTATCGTGGTGGTGCAGTGGGCTGACCTGGTCATCTGCAAGACCAGGAGGAAT
TCTGTCTTCCAGCAGGGGATGAAGAACAAGATCTTAATATTTGGCCTCTTTGAAGAGACA
GCCCTTGCTGCTTTCCTTTCCTACTGCCCTGGAATGGGTGTTGCCCTGAGGATGTATCCC
CTCAAACCTACCTGGTGGTTCTGTGCCTTCCCCTACTCTCTTCTCATCTTCGTGTATGAC
GAAGTCCGGAAGCTCATCATCAGGCGACGTCCTGGCGGTTGGGTGGAGAAGGAGACCTAC
TACTAG
Enzyme 1 GenBank Gene ID BC123864 Link Image
Enzyme 1 GeneCard ID ATP1A1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 1p21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 158
Enzyme 2 Name Sodium/potassium-transporting ATPase subunit alpha-2
Enzyme 2 Synonyms
  1. Sodium pump subunit alpha-2
  2. Na(+)/K(+) ATPase alpha-2 subunit
Enzyme 2 Gene Name ATP1A2
Enzyme 2 Protein Sequence >Sodium/potassium-transporting ATPase subunit alpha-2
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAFGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYL
ELGGLGERVLGFCQLNLPSAKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
Enzyme 2 Number of Residues 1020
Enzyme 2 Molecular Weight 112178.3
Enzyme 2 Theoretical pI 5.33
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Inorganic ion transport and metabolism
Enzyme 2 Specific Function This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium, providing the energy for active transport of various nutrients
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 86-106 130-150 287-306 319-336 770-789 800-820 841-863 916-935 949-967 983-1003
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 124829106 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A2VDL6 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AT1A2_BOVIN Link Image
Enzyme 2 PDB ID 1Q3I Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >3063 bp
ATGGGCCGTGGGGCTGGCCGCGAGTACTCGCCTGCAGCCACCACTGCGGAAAATGGGGGC
GGCAAGAAGAAACAGAAAGAGAAGGAGCTGGATGAGCTGAAGAAGGAAGTGGCCATGGAT
GACCACAAGCTGTCCTTGGATGAGCTGGGCCGCAAGTACCAAGTGGATCTGTCCAAGGGC
CTCACCAACCAGCGGGCCCAGGACATTCTGGCTCGGGATGGACCCAATGCCCTCACCCCA
CCCCCAACCACCCCTGAGTGGGTCAAGTTCTGTCGTCAGCTTTTCGGGGGCTTCTCCATC
CTACTGTGGATTGGGGCCATCCTCTGCTTCCTGGCCTTTGGCATCCAGGCTGCCATGGAG
GATGAACCGTCCAACGACAATCTTTATCTGGGCGTGGTGCTGGCAGCTGTGGTCATCGTC
ACTGGCTGCTTCTCCTACTACCAGGAGGCCAAGAGCTCCAAGATCATGGATTCCTTCAAG
AACATGGTGCCTCAGCAAGCCCTTGTGGTGCGAGAAGGAGAGAAGATGCAGATCAACGCG
GAGGAGGTGGTGGTGGGCGACCTGGTGGAGGTGAAGGGTGGGGACCGCGTGCCCGCTGAC
CTCCGGATCATCTCTTCTCACGGCTGCAAGGTGGACAACTCCTCCCTGACAGGCGAGTCA
GAACCCCAGACCCGCTCCCCTGAGTTCACCCACGAGAATCCCCTGGAGACCCGCAATATC
TGTTTCTTCTCTACCAACTGTGTGGAAGGCACTGCCAGGGGCATCGTGATTGCCACAGGT
GACCGGACGGTGATGGGCCGTATAGCCACTCTGGCCTCAGGCCTGGAGGTCGGGCGGACG
CCCATAGCCATGGAGATTGAGCACTTCATTCAGCTGATCACAGGGGTGGCCGTCTTCCTG
GGGGTCTCCTTCTTCGTGCTGTCCCTCATCCTGGGCTACAGCTGGCTGGAGGCGGTCATC
TTCCTTATCGGCATCATTGTGGCCAACGTGCCTGAGGGTCTGCTGGCCACTGTCACCGTG
TGTCTGACCCTGACAGCCAAGCGCATGGCTCGGAAGAACTGCCTGGTGAAGAACCTGGAG
GCGGTGGAGACTCTGGGCTCCACCTCCACCATCTGCTCCGACAAGACCGGAACCCTCACC
CAGAACCGCATGACCGTCGCCCACATGTGGTTCGACAATCAGATCCATGAGGCCGACACC
ACGGAAGATCAGTCTGGGGCCACTTTTGACAAACGATCCCCGACATGGACTGCCCTATCC
CGGATTGCTGGTCTCTGCAACCGTGCTGTGTTCAAGGCAGGGCAGGAAAACATCTCTGTG
TCTAAGCGGGACACAGCAGGTGATGCCTCCGAGTCAGCTCTCCTCAAGTGCATTGAGCTG
TCCTGCGGCTCCGTGAGGAAGATGAGGGATAGAAACCCCAAGGTGGCAGAGATCCCTTTC
AACTCAACCAATAAGTACCAGCTGTCCATCCACGAGCGAGAAGACAGCCCCCAGAGCCAC
GTGCTGGTGATGAAGGGGGCCCCTGAGCGCATCCTGGACCGTTGCTCCTCCATCCTGGTG
CAGGGCAAGGAGATCCCTCTGGACAAGGAGATGCAAGATGCCTTCCAGAATGCCTACCTG
GAGCTGGGAGGGCTCGGGGAGCGCGTCCTGGGCTTCTGTCAACTGAATCTGCCTTCTGCA
AAGTTTCCTCGGGGCTTCAAATTTGACACGGATGAGCTGAACTTTCCCACAGAGAAGCTC
TGCTTCGTGGGGCTCATGTCCATGATTGACCCTCCACGGGCTGCCGTTCCCGATGCTGTG
GGCAAGTGCCGGAGTGCAGGCATCAAGGTGATCATGGTGACCGGTGACCACCCCATCACA
GCCAAGGCCATTGCCAAAGGCGTGGGCATCATCTCAGAAGGCAACGAGACAGTGGAGGAC
ATTGCCGCCCGGCTCAACATTCCTGTTAGCCAAGTCAACCCCAGAGAAGCCAAGGCGTGT
GTGGTGCACGGCTCTGACCTGAAAGATATGACGTCGGAGCAGCTGGACGAGATCCTCAAG
AATCACACGGAGATCGTCTTTGCCCGGACGTCTCCTCAGCAGAAGCTCATCATCGTGGAG
GGCTGCCAGAGGCAGGGAGCCATTGTGGCGGTGACGGGGGATGGGGTGAATGACTCCCCG
GCGCTAAAGAAGGCGGACATTGGCATCGCCATGGGCATCGCTGGCTCCGACGTTTCTAAG
CAGGCCGCCGACATGATCCTGCTGGATGACAACTTTGCCTCCATCGTCACTGGCGTGGAG
GAGGGCCGCCTGATCTTTGACAACCTGAAGAAATCCATCGCCTACACCCTGACCAGTAAC
ATCCCCGAGATCACCCCTTTCCTGCTGTTCATCATCGCCAACATCCCCCTGCCTCTGGGC
ACCGTGACCATCCTCTGCATTGACCTGGGCACTGATATGGTCCCTGCCATCTCCTTGGCC
TATGAGGCAGCTGAGAGTGACATCATGAAGCGGCAGCCACGCAACCCGCAGACGGACAAG
CTGGTGAACGAGAGGCTCATCAGCATGGCCTATGGACAGATCGGGATGATCCAGGCTCTG
GGTGGCTTCTTCACCTACTTTGTGATCCTGGCAGAGAATGGTTTTCTACCTTCGCGGCTT
CTGGGAATCCGCCTGGACTGGGATGACCGGTCCATGAATGACTTGGAGGACAGCTACGGA
CAGGAGTGGACCTATGAACAGCGGAAGGTGGTGGAGTTCACATGCCACACGGCTTTCTTT
GCCAGCATTGTGGTCGTGCAATGGGCTGACCTCATCATCTGCAAGACCCGCCGCAACTCA
GTTTTCCAGCAGGGAATGAAAAACAAGATTCTGATTTTTGGGCTCCTGGAGGAGACAGCA
CTGGCGGCCTTTCTGTCTTACTGCCCGGGCATGGGCGTGGCTCTCCGAATGTACCCGCTC
AAGGTCACCTGGTGGTTCTGCGCCTTCCCCTACAGTCTCCTTATCTTCATCTACGATGAG
GTCCGAAAGCTGATCCTGCGGCGATATCCGGGTGGCTGGGTGGAGAAGGAGACCTACTAC
TGA
Enzyme 2 GenBank Gene ID BC133297 Link Image
Enzyme 2 GeneCard ID ATP1A2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1q21-q23
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 472
Enzyme 3 Name DNA polymerase beta
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name POLB
Enzyme 3 Protein Sequence >DNA polymerase beta
MSKRKAPQETLNGGITDMLTELANFEKNVNQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLSEVKKVDSEYIATVCGS
FRRGAESSGDMDVLLTHPSFTSESAKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQ
LPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Enzyme 3 Number of Residues 335
Enzyme 3 Molecular Weight 38266.5
Enzyme 3 Theoretical pI 9.53
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Replication, recombination and repair
Enzyme 3 Specific Function Repair polymerase. Conducts "gap-filling" DNA synthesis in a stepwise distributive fashion rather than in a processive fashion as for other DNA polymerases. Has a 5'-deoxyribose-5- phosphate lyase (dRP lyase) activity
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 73587414 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q27958 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name DPOLB_BOVIN Link Image
Enzyme 3 PDB ID 8ICK Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1008 bp
ATGAGCAAACGGAAGGCGCCGCAGGAGACTCTCAACGGGGGCATCACCGACATGCTCACA
GAACTCGCAAACTTTGAGAAGAACGTGAACCAGGCTATCCACAAATACAATGCCTACAGA
AAAGCAGCATCTGTGATAGCAAAGTACCCACACAAAATAAAGAGTGGAGCGGAAGCTAAG
AAACTGCCTGGAGTAGGAACAAAAATTGCTGAAAAAATTGATGAGTTTTTAGCTACTGGA
AAATTGCGTAAACTGGAAAAGATTCGGCAGGATGATACGAGTTCATCCATCAATTTCCTG
ACTCGAGTTAGTGGCATTGGTCCATCTGCTGCAAGGAAGTTTGTAGATGAAGGAATTAAG
ACATTAGAAGATCTCAGAAAAAATGAAGATAAATTGAACCATCATCAACGAATTGGGCTA
AAATATTTTGAGGACTTTGAGAAAAGAATTCCTCGTGAAGAAATGTTACAAATGCAAGAT
ATTGTACTAAGTGAAGTTAAAAAAGTGGATTCTGAATACATTGCTACAGTCTGTGGCAGT
TTCAGAAGAGGTGCAGAGTCCAGTGGTGACATGGATGTCCTTCTCACCCATCCAAGCTTT
ACCTCTGAGTCAGCCAAACAGCCCAAACTGTTACATCGTGTTGTGGAGCAGTTACAAAAG
GTCCGTTTCATTACAGACACTCTGTCAAAGGGTGAAACAAAGTTCATGGGTGTTTGCCAG
CTTCCCAGTAAAAACGATGAAAAGGAATATCCACACAGGAGAATTGATATCAGGTTGATA
CCCAAGGATCAGTATTACTGCGGTGTCCTCTATTTCACTGGGAGTGATATTTTCAATAAG
AATATGAGAGCTCATGCCCTAGAAAAAGGCTTCACAATCAATGAATACACAATCCGTCCC
CTGGGTGTCACTGGCGTTGCCGGGGAGCCCCTGCCCGTGGACAGTGAGAAGGACATCTTC
GACTACATCCAGTGGAAATACCGTGAGCCCAAGGACCGAAGCGAGTGA
Enzyme 3 GenBank Gene ID BC103229 Link Image
Enzyme 3 GeneCard ID POLB Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:8
Enzyme 3 Locus 8p11.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 966
Enzyme 4 Name Ubiquitin-conjugating enzyme E2 E3
Enzyme 4 Synonyms
  1. Ubiquitin-protein ligase E3
  2. Ubiquitin carrier protein E3
Enzyme 4 Gene Name UBE2E3
Enzyme 4 Protein Sequence >Ubiquitin-conjugating enzyme E2 E3
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
GSIATQYLTNRAEHDRIARQWTKRYAT
Enzyme 4 Number of Residues 207
Enzyme 4 Molecular Weight 22912.3
Enzyme 4 Theoretical pI 7.25
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in ATP binding
Enzyme 4 Specific Function Catalyzes the covalent attachment of ubiquitin to other proteins. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest
Enzyme 4 Pathways
  • Protein modification
  • protein ubiquitination
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 83405477 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q2T9X7 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name UB2E3_BOVIN Link Image
Enzyme 4 PDB ID 1Y6L Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >624 bp
ATGTCCAGTGATCGGCAGAGATCCGATGATGAGAGTCCCAGCACCAGCAGCGGTAGCTCA
GATGCAGACCAGCGAGACCCAGCCGCTCCAGAGCCTGAAGAACAAGAAGAAAGAAAACCG
TCTGCCACCCAGCAGAAGAAAAACACCAAACTCTCTAGCAAAACCACTGCTAAATTATCC
ACTAGTGCTAAAAGAATTCAGAAGGAGCTAGCTGAAATAACCCTTGATCCTCCTCCTAAC
TGCAGTGCTGGGCCTAAAGGAGATAACATTTATGAATGGAGATCGACTATACTTGGTCCA
CCAGGTTCTGTATATGAAGGTGGTGTGTTTTTTCTGGATATCACATTTTCATCCGATTAT
CCATTTAAGCCACCAAAGGTTACTTTCCGCACCAGAATCTATCACTGCAACATCAATAGT
CAGGGAGTCATCTGCCTGGACATCCTTAAAGACAACTGGAGTCCTGCTTTGACTATTTCA
AAGGTTTTGCTGTCAATTTGTTCTCTTTTGACAGACTGCAACCCTGCGGATCCTCTGGTT
GGAAGCATAGCCACTCAGTATTTGACCAACAGAGCAGAACATGACAGGATAGCCAGACAG
TGGACCAAGCGATACGCAACATAA
Enzyme 4 GenBank Gene ID BC111218 Link Image
Enzyme 4 GeneCard ID UBE2E3 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:2
Enzyme 4 Locus 2q32.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 1006
Enzyme 5 Name Protein tyrosine phosphatase type IVA 3
Enzyme 5 Synonyms
  1. Protein-tyrosine phosphatase 4a3
Enzyme 5 Gene Name PTP4A3
Enzyme 5 Protein Sequence >Protein tyrosine phosphatase type IVA 3
MARMNRPAPVEVSYKNMRFLITHNPTNATLSSFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKNKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHAHKTKCCIM
Enzyme 5 Number of Residues 173
Enzyme 5 Molecular Weight 19510.6
Enzyme 5 Theoretical pI 9.44
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Signal transduction mechanisms
Enzyme 5 Specific Function Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 124829080 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID A2VDT1 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name TP4A3_BOVIN Link Image
Enzyme 5 PDB ID 1V3A Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >522 bp
ATGGCGCGGATGAACCGGCCGGCCCCTGTGGAGGTCAGCTACAAGAACATGCGCTTCCTC
ATCACGCACAACCCCACCAATGCCACCCTCAGCAGCTTCATCGAGGACCTGAAGAAGTAC
GGGGCCACCACCGTGGTGCGCGTGTGTGAGGTGACCTACGACAAGGCCCCGCTGGAGAAG
GACGGCATCACGGTTGTGGACTGGCCGTTTGATGATGGGGCACCCCCGCCCGGCAAAGTG
GTGGAGGACTGGCTGAGCCTGCTGAAGAACAAGTTCTGTGATGACCCCGGCAGCTGCGTG
GCTGTGCACTGCGTGGCTGGCCTGGGGCGGGCTCCCGTCCTCGTGGCGCTGGCCCTCATC
GAGAGCGGGATGAAGTATGAGGACGCCATCCAGTTCATCCGACAGAAGCGGCGCGGAGCC
ATCAACAGCAAACAGCTCACCTACCTGGAAAAATACCGGCCGAAGCAGAGACTGCGGTTC
AAGGACCCCCACGCGCACAAGACCAAGTGCTGCATCATGTAG
Enzyme 5 GenBank Gene ID BC133386 Link Image
Enzyme 5 GeneCard ID PTP4A3 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:8
Enzyme 5 Locus 8q24.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 1031
Enzyme 6 Name Sodium/potassium-transporting ATPase subunit beta-2
Enzyme 6 Synonyms
  1. Sodium/potassium-dependent ATPase subunit beta-2
Enzyme 6 Gene Name ATP1B2
Enzyme 6 Protein Sequence >Sodium/potassium-transporting ATPase subunit beta-2
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVISFYAGANQSMNVTCVGKRDEDAENLGNFVMFPANGNIDLIYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAPRVAFKLRINKT
Enzyme 6 Number of Residues 290
Enzyme 6 Molecular Weight 33401.0
Enzyme 6 Theoretical pI 8.25
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in potassium ion binding
Enzyme 6 Specific Function This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-2 subunit is not known
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • 40-67
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 1314361 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q28030 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name AT1B2_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >873 bp
ATGGTCATCCAGAAAGAGAAGAAGAGCTGCGGGCAGGTGGTTGAGGAGTGGAAGGAGTTC
GTGTGGAACCCGAGGACGCACCAGTTCATGGGCCGCACAGGGACCAGCTGGGCCTTTATC
CTCCTCTTCTACCTCGTCTTCTATGGCTTCCTCACCGCCATGTTCACCCTCACCATGTGG
GTGATGCTGCAGACAGTCTCCGACCACACCCCCAAGTACCAGGACCGATTGGCTACACCA
GGCTTGATGATTCGCCCTAAGACTGAGAACCTCGATGTCATTGTCAATGTCAGTGACACT
GAAAGCTGGGACCAGCATGTTCAGAAACTCAATAAGTTCTTGGAGCCTTACAATGACTCC
ATCCAAGCCCAGAAGAATGATGTCTGCCGCCCTGGTCGCTATTACGAACAACCAGATAAC
GGAGTTCTAAACTACCCAAAACGTGCTTGCCAGTTCAACCGGACCCAGCTGGGTGACTGC
TCTGGCATTGGGGACCCCACCCACTATGGTTACAGCACTGGACAGCCCTGTGTCTTCATC
AAGATGAACCGGGTCATCAGCTTCTATGCAGGAGCAAACCAGAGCATGAATGTTACCTGC
GTGGGGAAGCGAGATGAAGATGCCGAGAATCTCGGCAACTTCGTTATGTTCCCTGCAAAC
GGCAATATCGACCTCATATACTTCCCCTACTATGGCAAGAAGTTTCACGTGAACTACACA
CAGCCCCTGGTGGCCGTCAAGTTCCTGAATGTGACCCCCAACGTGGAGGTGAACGTGGAG
TGCCGCATCAATGCTGCCAACATTGCCACTGACGATGAGCGAGACAAGTTCGCCCCCCGT
GTGGCCTTCAAACTCCGCATCAACAAAACCTGA
Enzyme 6 GenBank Gene ID U45944 Link Image
Enzyme 6 GeneCard ID ATP1B2 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 17p13.1
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1032
Enzyme 7 Name Sodium/potassium-transporting ATPase subunit beta-3
Enzyme 7 Synonyms
  1. Sodium/potassium-dependent ATPase subunit beta-3
  2. ATPB-3
  3. CD298 antigen
Enzyme 7 Gene Name ATP1B3
Enzyme 7 Protein Sequence >Sodium/potassium-transporting ATPase subunit beta-3
MTKTDKKSFNQSLAEWKLFIYNRTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWA
MLQTLNDEVPKYRDQIPSPGLMVFPKPVSALDFSFSLSDAESYQGYIDDLKKFLKPYGLE
EQKNLTDCTNGTFFEQKGPEYTACQFPLALLEACSGVDDPTFGYQEGKPCILVKMNRIIG
LKPQGEPRIECTGKSESTAFLSTYPSNGTIDLKYFPYYGKKLHGNYLQPLVAVQVGFGSD
ADVREVMVECKIDGSPNLKTQNDRDKFLGRVAFKITMHA
Enzyme 7 Number of Residues 279
Enzyme 7 Molecular Weight 31521.0
Enzyme 7 Theoretical pI 7.20
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in potassium ion binding
Enzyme 7 Specific Function This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 36-56
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 74354619 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q3T0C6 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name AT1B3_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >840 bp
ATGACGAAGACAGACAAGAAGTCCTTCAACCAGAGCCTGGCCGAGTGGAAGCTCTTCATC
TACAACCGGACAACCGGAGAGTTCCTGGGGCGCACCGCCAAGAGCTGGGGTTTGATCTTG
CTCTTCTACCTAGTCTTTTATGGGTTCCTGGCTGCACTCTTTTCATTCACAATGTGGGCC
ATGCTTCAGACTCTGAATGATGAGGTTCCAAAATATCGTGACCAGATTCCTAGTCCAGGA
CTTATGGTTTTTCCAAAACCAGTGTCAGCGTTGGATTTTTCATTCAGCCTGTCTGATGCA
GAATCCTATCAAGGGTACATTGATGACCTTAAGAAATTTCTAAAGCCATATGGCTTAGAA
GAACAGAAGAATCTCACAGATTGTACCAATGGAACCTTTTTTGAGCAGAAGGGTCCAGAA
TACACAGCATGTCAGTTTCCTCTTGCCTTACTTGAAGCATGCAGTGGTGTGGATGATCCC
ACGTTTGGCTACCAAGAAGGAAAGCCTTGTATTCTTGTGAAAATGAACAGAATAATTGGA
TTAAAGCCTCAAGGAGAACCAAGGATAGAATGTACTGGAAAGAGCGAAAGCACAGCATTT
CTATCAACTTATCCTTCCAATGGAACGATAGATTTAAAATATTTTCCATATTATGGGAAA
AAACTGCATGGGAACTACCTGCAGCCACTAGTTGCCGTCCAGGTCGGCTTTGGTAGTGAT
GCTGACGTAAGAGAAGTAATGGTTGAGTGCAAGATCGATGGATCACCCAACCTAAAAACC
CAGAATGACCGTGACAAGTTTTTAGGACGAGTTGCATTCAAGATCACCATGCATGCATAG
Enzyme 7 GenBank Gene ID BC102454 Link Image
Enzyme 7 GeneCard ID ATP1B3 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:3
Enzyme 7 Locus 3q23
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1033
Enzyme 8 Name Sodium/potassium-transporting ATPase gamma chain
Enzyme 8 Synonyms
  1. Sodium pump gamma chain
  2. Na(+)/K(+) ATPase subunit gamma
  3. FXYD domain-containing ion transport regulator 2
Enzyme 8 Gene Name FXYD2
Enzyme 8 Protein Sequence >Sodium/potassium-transporting ATPase gamma chain
MVAVQGTEDPFYYDYETVRNGGLIFAALAFIVGLVIILSKRFRCGAKRQHRQIPEDGL
Enzyme 8 Number of Residues 58
Enzyme 8 Molecular Weight 6544.5
Enzyme 8 Theoretical pI 8.49
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in ion channel activity
Enzyme 8 Specific Function May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • 20-39
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 397 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q04645 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name ATNG_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >177 bp
ATGGTGGCTGTGCAGGGGACCGAGGACCCATTCTACTATGACTACGAGACCGTCCGTAAT
GGGGGCCTGATCTTCGCCGCCCTGGCCTTCATCGTGGGGCTCGTCATCATCCTCAGCAAA
AGATTCCGCTGCGGGGCCAAGAGGCAGCACCGGCAAATTCCTGAAGATGGGCTCTAA
Enzyme 8 GenBank Gene ID X70059 Link Image
Enzyme 8 GeneCard ID FXYD2 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 11q23
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available