We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Copper (RMDB00657)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-16 12:03:30
Update Date 2009-07-13 14:18:44
Accession Number RMDB00657
Common Name Copper
Description The catalytic activity of copper is used by the enzymes that it is associated with and is thus only toxic when unsequestered and unmediated. This increase in unmediated reactive radicals is generally termed oxidative stress and is an active area of research in a variety of diseases where copper may play an important but more subtle role than in acute toxicity. It is believed that zinc and copper compete for absorption in the digestive tract so that a diet that is excessive in one of these minerals may result in a deficiency in the other. Copper is an essential nutrient to all higher plants and animals. Physiologically, it exists as an ion in the body. In animals, it is found primarily in the bloodstream, as a cofactor in various enzymes, and in copper-based pigments. In sufficient amounts, copper can be poisonous or even fatal to organisms.
Synonyms
  1. Cu
  2. copper
Chemical IUPAC Name copper
Chemical Formula [Cu]2+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals; Enzyme co-factor
Application
Source
  • Exogenous
Average Molecular Weight 63.546
Monoisotopic Molecular Weight 62.929600
Isomeric SMILES [Cu++]
Canonical SMILES [Cu++]
KEGG Compound ID C00070 Link Image
BioCyc ID CUCL2 Link Image
BiGG ID Not Available
Wikipedia Link Copper Link Image
METLIN ID Not Available
PubChem Compound 23978 Link Image
PubChem Substance 3370 Link Image
ChEBI ID 30052 Link Image
CAS Registry Number 7440-50-8
InChI Identifier InChI=1/Cu/q+2
Synthesis Reference Not Available
Melting Point (Experimental) 1083 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 421 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.57 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 2.59 +/- 0.26 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Cytochrome c oxidase subunit 2
  2. Cytochrome c oxidase subunit 1
  3. Cytochrome c oxidase subunit 1
  4. Cytochrome c oxidase subunit 1
  5. Cytochrome c oxidase subunit 2
  6. Cytochrome c oxidase subunit 1
  7. Cytochrome c oxidase subunit 1
  8. Cytochrome c oxidase subunit 1
  9. Cytochrome c oxidase subunit 1
  10. Cytochrome c oxidase subunit 1
  11. Cytochrome c oxidase subunit 2
  12. Cytochrome c oxidase subunit 1
  13. Cytochrome c oxidase subunit 1
  14. Cytochrome c oxidase subunit 1
  15. Cytochrome c oxidase subunit 1
  16. Cytochrome c oxidase subunit 1
  17. Cytochrome c oxidase subunit 2
  18. Cytochrome c oxidase subunit 1
  19. Cytochrome c oxidase subunit 2
  20. Cytochrome c oxidase subunit 1
  21. Cytochrome c oxidase subunit 1
  22. Cytochrome c oxidase subunit 1
  23. Cytochrome c oxidase subunit 2
  24. Cytochrome c oxidase subunit 1
  25. Cytochrome c oxidase subunit 2
  26. Cytochrome c oxidase subunit 1
  27. Cytochrome c oxidase subunit 1
  28. Cytochrome c oxidase subunit 1
  29. Primary amine oxidase, liver isozyme
  30. Membrane primary amine oxidase
  31. Primary amine oxidase, lung isozyme
  32. Copper amine oxidase
  33. Superoxide dismutase [Cu-Zn]
  34. Superoxide dismutase [Cu-Zn]
  35. Superoxide dismutase [Cu-Zn]
  36. Superoxide dismutase [Cu-Zn]
  37. Superoxide dismutase [Cu-Zn]
  38. Dopamine beta-hydroxylase
  39. Cytochrome c oxidase subunit 2
  40. Cytochrome c oxidase subunit 2
  41. Lysyl oxidase homolog 1
  42. Protein-lysine 6-oxidase
  43. Lysyl oxidase homolog 4
  44. Cytochrome c oxidase assembly protein COX11, mitochondrial
  45. Tyrosinase
  46. Cytochrome c oxidase subunit 2
  47. 5,6-dihydroxyindole-2-carboxylic acid oxidase
  48. Peptidyl-glycine alpha-amidating monooxygenase
Enzyme 1 [top]
Enzyme 1 ID 3
Enzyme 1 Name Cytochrome c oxidase subunit 2
Enzyme 1 Synonyms
  1. Cytochrome c oxidase polypeptide II
Enzyme 1 Gene Name MT-CO2
Enzyme 1 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Enzyme 1 Number of Residues 227
Enzyme 1 Molecular Weight 26021.2
Enzyme 1 Theoretical pI 4.53
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Energy production and conversion
Enzyme 1 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 15-45 60-87
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 12801 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P68530 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name COX2_BOVIN Link Image
Enzyme 1 PDB ID 1OCZ Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 1 GenBank Gene ID V00654 Link Image
Enzyme 1 GeneCard ID MT-CO2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:MT
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 4
Enzyme 2 Name Cytochrome c oxidase subunit 1
Enzyme 2 Synonyms
  1. Cytochrome c oxidase polypeptide I
Enzyme 2 Gene Name MT-CO1
Enzyme 2 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 2 Number of Residues 514
Enzyme 2 Molecular Weight 57031.9
Enzyme 2 Theoretical pI 6.55
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Energy production and conversion
Enzyme 2 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 2 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 12-40 51-86 95-117 141-170 183-212 228-261 270-286 299-327 336-357 371-400 407-433 447-478
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 12801 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P00396 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name COX1_BOVIN Link Image
Enzyme 2 PDB ID 1OCZ Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 2 GenBank Gene ID V00654 Link Image
Enzyme 2 GeneCard ID MT-CO1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:MT
Enzyme 2 Locus Not Available
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 11
Enzyme 3 Name Cytochrome c oxidase subunit 1
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name COX1
Enzyme 3 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVEMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVG
VNMTFFPQHFLGLSGIPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 3 Number of Residues 514
Enzyme 3 Molecular Weight 57085.9
Enzyme 3 Theoretical pI 6.46
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Energy production and conversion
Enzyme 3 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 3 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 70988099 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q45LD5 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name Q45LD5_BOVIN Link Image
Enzyme 3 PDB ID 1OCZ Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 3 GenBank Gene ID DQ124416 Link Image
Enzyme 3 GeneCard ID COX1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Not Available
Enzyme 3 Locus Not Available
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 13
Enzyme 4 Name Cytochrome c oxidase subunit 1
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name Not Available
Enzyme 4 Protein Sequence >Cytochrome c oxidase subunit 1
TVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINIKPPAMSQYQTPLFV
Enzyme 4 Number of Residues 59
Enzyme 4 Molecular Weight 6166.1
Enzyme 4 Theoretical pI 7.69
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Energy production and conversion
Enzyme 4 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 4 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 28189555 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q862S6 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name Q862S6_BOVIN Link Image
Enzyme 4 PDB ID 1OCZ Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID AB098902 Link Image
Enzyme 4 GeneCard ID Not Available
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Not Available
Enzyme 4 Locus Not Available
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 20
Enzyme 5 Name Cytochrome c oxidase subunit 2
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name COX2
Enzyme 5 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Enzyme 5 Number of Residues 227
Enzyme 5 Molecular Weight 25987.2
Enzyme 5 Theoretical pI 4.53
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Energy production and conversion
Enzyme 5 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 157778608 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID B1P072 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name B1P072_BOVIN Link Image
Enzyme 5 PDB ID 1OCZ Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >956 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAACTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATA
Enzyme 5 GenBank Gene ID EU177857 Link Image
Enzyme 5 GeneCard ID COX2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Not Available
Enzyme 5 Locus Not Available
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 21
Enzyme 6 Name Cytochrome c oxidase subunit 1
Enzyme 6 Synonyms Not Available
Enzyme 6 Gene Name Not Available
Enzyme 6 Protein Sequence >Cytochrome c oxidase subunit 1
FGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNW
LVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGA
SVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPV
LAAGITMLLTDRNLNTTFFDPAGGGDP
Enzyme 6 Number of Residues 207
Enzyme 6 Molecular Weight 21944.8
Enzyme 6 Theoretical pI 4.51
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Energy production and conversion
Enzyme 6 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 6 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 60393205 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q5BP91 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name Q5BP91_BOVIN Link Image
Enzyme 6 PDB ID 1OCZ Link Image
Enzyme 6 PDB File Show
Enzyme 6 3D Structure
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence Not Available
Enzyme 6 GenBank Gene ID AY926483 Link Image
Enzyme 6 GeneCard ID Not Available
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Not Available
Enzyme 6 Locus Not Available
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 27
Enzyme 7 Name Cytochrome c oxidase subunit 1
Enzyme 7 Synonyms Not Available
Enzyme 7 Gene Name COXI
Enzyme 7 Protein Sequence >Cytochrome c oxidase subunit 1
GTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGA
PDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFS
LHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITML
LTDRNLNTT
Enzyme 7 Number of Residues 189
Enzyme 7 Molecular Weight 20163.9
Enzyme 7 Theoretical pI 5.43
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Energy production and conversion
Enzyme 7 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 7 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 148508615 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID A5YMV6 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name A5YMV6_BOVIN Link Image
Enzyme 7 PDB ID 1OCZ Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence Not Available
Enzyme 7 GenBank Gene ID EF568660 Link Image
Enzyme 7 GeneCard ID COXI Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Not Available
Enzyme 7 Locus Not Available
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 30
Enzyme 8 Name Cytochrome c oxidase subunit 1
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name COXI
Enzyme 8 Protein Sequence >Cytochrome c oxidase subunit 1
GAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWL
VPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGAS
VDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVL
AAGITMLLTDRNLNTT
Enzyme 8 Number of Residues 196
Enzyme 8 Molecular Weight 20836.7
Enzyme 8 Theoretical pI 5.43
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Energy production and conversion
Enzyme 8 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 8 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 148508577 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID A5YMT7 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name A5YMT7_BOVIN Link Image
Enzyme 8 PDB ID 1OCZ Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID EF568641 Link Image
Enzyme 8 GeneCard ID COXI Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Not Available
Enzyme 8 Locus Not Available
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 32
Enzyme 9 Name Cytochrome c oxidase subunit 1
Enzyme 9 Synonyms Not Available
Enzyme 9 Gene Name COXI
Enzyme 9 Protein Sequence >Cytochrome c oxidase subunit 1
LFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAG
ASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLP
VLAAGITMLLTDRNLNTTFFDPAGGGD
Enzyme 9 Number of Residues 207
Enzyme 9 Molecular Weight 21960.9
Enzyme 9 Theoretical pI 4.51
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Energy production and conversion
Enzyme 9 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 9 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 148508553 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID A5YMS5 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name A5YMS5_BOVIN Link Image
Enzyme 9 PDB ID 1OCZ Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence Not Available
Enzyme 9 GenBank Gene ID EF568629 Link Image
Enzyme 9 GeneCard ID COXI Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Not Available
Enzyme 9 Locus Not Available
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References Not Available
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 33
Enzyme 10 Name Cytochrome c oxidase subunit 1
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name COX1
Enzyme 10 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTSHKDIGTLYLLFDAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNAVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 10 Number of Residues 514
Enzyme 10 Molecular Weight 57034.8
Enzyme 10 Theoretical pI 6.46
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Energy production and conversion
Enzyme 10 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 10 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 42521313 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q6QTG9 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name Q6QTG9_BOVIN Link Image
Enzyme 10 PDB ID 1OCZ Link Image
Enzyme 10 PDB File Show
Enzyme 10 3D Structure
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTGGTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 10 GenBank Gene ID AY526085 Link Image
Enzyme 10 GeneCard ID COX1 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Not Available
Enzyme 10 Locus Not Available
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 34
Enzyme 11 Name Cytochrome c oxidase subunit 2
Enzyme 11 Synonyms Not Available
Enzyme 11 Gene Name COX2
Enzyme 11 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMNAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Enzyme 11 Number of Residues 227
Enzyme 11 Molecular Weight 26020.2
Enzyme 11 Theoretical pI 4.61
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Energy production and conversion
Enzyme 11 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 21305549 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q8M444 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name Q8M444_BOVIN Link Image
Enzyme 11 PDB ID 1OCZ Link Image
Enzyme 11 PDB File Show
Enzyme 11 3D Structure
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >684 bp
ATGGCATATCCCATACAACTAGGATTCCAAGATGCAACATCACCAATCATAGAAGAACTA
CTTCACTTTCATGACCACACGCTAATAATTGTCTTCTTAATTAGCTCATTAGTACTTTAC
ATTATTTCACTAATACTAACGACAAAGCTGACCCATACAAGCACGATAAATGCACAAGAA
GTAGAGACAATCTGAACCATTCTGCCCGCCATCATCTTAATTCTAATTGCTCTTCCTTCT
TTACGAATTCTATACATAATAGATGAAATCAATAACCCATCTCTTACAGTAAAAACCATA
GGACATCAGTGATACTGAAGCTATGAGTATACAGATTATGAGGACTTAAGCTTCGACTCC
TACATAATTCCAACATCAGAATTAAAGCCAGGGGAGCTACGACTATTAGAAGTCGATAAT
CGAGTTGTACTACCAATAGAAATAACAATCCGAATGTTAGTCTCCTCTGAAGACGTATTA
CACTCATGAGCTGTGCCCTCTCTAGGACTAAAAACAGACGCAATCCCAGGCCGTCTAAAC
CAAACAACCCTTATATCGTCCCGTCCAGGCTTATATTACGGTCAATGCTCAGAAATTTGC
GGGTCAAACCACAGTTTCATACCCATTGTCCTTGAGTTAGTCCCACTAAAGTACTTTGAA
AAATGATCTGCGTCAATATTATAA
Enzyme 11 GenBank Gene ID AF384026 Link Image
Enzyme 11 GeneCard ID COX2 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Not Available
Enzyme 11 Locus Not Available
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 35
Enzyme 12 Name Cytochrome c oxidase subunit 1
Enzyme 12 Synonyms Not Available
Enzyme 12 Gene Name COXI
Enzyme 12 Protein Sequence >Cytochrome c oxidase subunit 1
LFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGN
WLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAG
ASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLP
VLAAGITMLLTDRNLNTTFFDPAGGGDP
Enzyme 12 Number of Residues 208
Enzyme 12 Molecular Weight 22058.0
Enzyme 12 Theoretical pI 4.51
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Energy production and conversion
Enzyme 12 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 12 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 148508545 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID A5YMS1 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name A5YMS1_BOVIN Link Image
Enzyme 12 PDB ID 1OCZ Link Image
Enzyme 12 PDB File Show
Enzyme 12 3D Structure
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID EF568625 Link Image
Enzyme 12 GeneCard ID COXI Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Not Available
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 36
Enzyme 13 Name Cytochrome c oxidase subunit 1
Enzyme 13 Synonyms Not Available
Enzyme 13 Gene Name COI
Enzyme 13 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 13 Number of Residues 514
Enzyme 13 Molecular Weight 57031.9
Enzyme 13 Theoretical pI 6.55
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Energy production and conversion
Enzyme 13 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 13 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 37960015 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q7JAT4 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name Q7JAT4_BOVIN Link Image
Enzyme 13 PDB ID 1OCZ Link Image
Enzyme 13 PDB File Show
Enzyme 13 3D Structure
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 13 GenBank Gene ID AY308066 Link Image
Enzyme 13 GeneCard ID COI Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Not Available
Enzyme 13 Locus Not Available
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References
  1. [PubMed Link Image]
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 37
Enzyme 14 Name Cytochrome c oxidase subunit 1
Enzyme 14 Synonyms Not Available
Enzyme 14 Gene Name COX1
Enzyme 14 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFVIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 14 Number of Residues 514
Enzyme 14 Molecular Weight 57059.9
Enzyme 14 Theoretical pI 6.55
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Energy production and conversion
Enzyme 14 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 14 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 70987973 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q45LE8 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name Q45LE8_BOVIN Link Image
Enzyme 14 PDB ID 1OCZ Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 14 GenBank Gene ID DQ124407 Link Image
Enzyme 14 GeneCard ID COX1 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Not Available
Enzyme 14 Locus Not Available
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 38
Enzyme 15 Name Cytochrome c oxidase subunit 1
Enzyme 15 Synonyms Not Available
Enzyme 15 Gene Name COI
Enzyme 15 Protein Sequence >Cytochrome c oxidase subunit 1
IGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIM
IGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAG
NLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVL
LLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPG
Enzyme 15 Number of Residues 236
Enzyme 15 Molecular Weight 25404.0
Enzyme 15 Theoretical pI 4.89
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Energy production and conversion
Enzyme 15 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 15 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function Not Available
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 239618589 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID C5IS82 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name C5IS82_BOVIN Link Image
Enzyme 15 PDB ID 1OCZ Link Image
Enzyme 15 PDB File Show
Enzyme 15 3D Structure
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence Not Available
Enzyme 15 GenBank Gene ID FJ958332 Link Image
Enzyme 15 GeneCard ID COI Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Not Available
Enzyme 15 Locus Not Available
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References Not Available
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 39
Enzyme 16 Name Cytochrome c oxidase subunit 1
Enzyme 16 Synonyms Not Available
Enzyme 16 Gene Name COXI
Enzyme 16 Protein Sequence >Cytochrome c oxidase subunit 1
ELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNN
MSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSIL
GAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNT
Enzyme 16 Number of Residues 178
Enzyme 16 Molecular Weight 19066.6
Enzyme 16 Theoretical pI 4.75
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Energy production and conversion
Enzyme 16 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 16 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 148508727 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID A5YN12 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name A5YN12_BOVIN Link Image
Enzyme 16 PDB ID 1OCZ Link Image
Enzyme 16 PDB File Show
Enzyme 16 3D Structure
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence Not Available
Enzyme 16 GenBank Gene ID EF568716 Link Image
Enzyme 16 GeneCard ID COXI Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Not Available
Enzyme 16 Locus Not Available
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References Not Available
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 43
Enzyme 17 Name Cytochrome c oxidase subunit 2
Enzyme 17 Synonyms Not Available
Enzyme 17 Gene Name Not Available
Enzyme 17 Protein Sequence >Cytochrome c oxidase subunit 2
AGMAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDA
QEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSF
DSYMIPTSELKPGELRLLEVDNRVV
Enzyme 17 Number of Residues 145
Enzyme 17 Molecular Weight 16762.4
Enzyme 17 Theoretical pI 4.23
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Energy production and conversion
Enzyme 17 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 85812247 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID A1XEF2 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name A1XEF2_BOVIN Link Image
Enzyme 17 PDB ID 1OCZ Link Image
Enzyme 17 PDB File Show
Enzyme 17 3D Structure
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence Not Available
Enzyme 17 GenBank Gene ID DQ347627 Link Image
Enzyme 17 GeneCard ID Not Available
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Not Available
Enzyme 17 Locus Not Available
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 45
Enzyme 18 Name Cytochrome c oxidase subunit 1
Enzyme 18 Synonyms Not Available
Enzyme 18 Gene Name COX1
Enzyme 18 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPAYVNLK
Enzyme 18 Number of Residues 514
Enzyme 18 Molecular Weight 57001.9
Enzyme 18 Theoretical pI 6.55
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Energy production and conversion
Enzyme 18 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 18 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 70987987 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q45LN9 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name Q45LN9_BOVIN Link Image
Enzyme 18 PDB ID 1OCZ Link Image
Enzyme 18 PDB File Show
Enzyme 18 3D Structure
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 18 GenBank Gene ID DQ124408 Link Image
Enzyme 18 GeneCard ID COX1 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Not Available
Enzyme 18 Locus Not Available
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References Not Available
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 48
Enzyme 19 Name Cytochrome c oxidase subunit 2
Enzyme 19 Synonyms Not Available
Enzyme 19 Gene Name COII
Enzyme 19 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Enzyme 19 Number of Residues 227
Enzyme 19 Molecular Weight 26021.2
Enzyme 19 Theoretical pI 4.53
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Energy production and conversion
Enzyme 19 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 37960015 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q7JAT3 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name Q7JAT3_BOVIN Link Image
Enzyme 19 PDB ID 1OCZ Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 19 GenBank Gene ID AY308066 Link Image
Enzyme 19 GeneCard ID COII Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Not Available
Enzyme 19 Locus Not Available
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References
  1. [PubMed Link Image]
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 50
Enzyme 20 Name Cytochrome c oxidase subunit 1
Enzyme 20 Synonyms Not Available
Enzyme 20 Gene Name Not Available
Enzyme 20 Protein Sequence >Cytochrome c oxidase subunit 1
LPAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILP
GFGMISHIVTYYSGKK
Enzyme 20 Number of Residues 76
Enzyme 20 Molecular Weight 8406.9
Enzyme 20 Theoretical pI 6.79
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Energy production and conversion
Enzyme 20 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 20 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 28189905 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q85E88 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name Q85E88_BOVIN Link Image
Enzyme 20 PDB ID 1OCZ Link Image
Enzyme 20 PDB File Show
Enzyme 20 3D Structure
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence Not Available
Enzyme 20 GenBank Gene ID AB099077 Link Image
Enzyme 20 GeneCard ID Not Available
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Not Available
Enzyme 20 Locus Not Available
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 51
Enzyme 21 Name Cytochrome c oxidase subunit 1
Enzyme 21 Synonyms Not Available
Enzyme 21 Gene Name COI
Enzyme 21 Protein Sequence >Cytochrome c oxidase subunit 1
GTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMI
GGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGN
LAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLL
LLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGF
Enzyme 21 Number of Residues 236
Enzyme 21 Molecular Weight 25438.0
Enzyme 21 Theoretical pI 4.89
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Energy production and conversion
Enzyme 21 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 21 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function Not Available
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 239618595 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID C5IS85 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name C5IS85_BOVIN Link Image
Enzyme 21 PDB ID 1OCZ Link Image
Enzyme 21 PDB File Show
Enzyme 21 3D Structure
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence Not Available
Enzyme 21 GenBank Gene ID FJ958335 Link Image
Enzyme 21 GeneCard ID COI Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Not Available
Enzyme 21 Locus Not Available
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References Not Available
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 52
Enzyme 22 Name Cytochrome c oxidase subunit 1
Enzyme 22 Synonyms Not Available
Enzyme 22 Gene Name COXI
Enzyme 22 Protein Sequence >Cytochrome c oxidase subunit 1
LIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFP
RMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGV
SSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNL
NT
Enzyme 22 Number of Residues 182
Enzyme 22 Molecular Weight 19520.1
Enzyme 22 Theoretical pI 5.43
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Energy production and conversion
Enzyme 22 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 22 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • None
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 148508705 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID A5YN01 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name A5YN01_BOVIN Link Image
Enzyme 22 PDB ID 1OCZ Link Image
Enzyme 22 PDB File Show
Enzyme 22 3D Structure
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence Not Available
Enzyme 22 GenBank Gene ID EF568705 Link Image
Enzyme 22 GeneCard ID COXI Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Not Available
Enzyme 22 Locus Not Available
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 54
Enzyme 23 Name Cytochrome c oxidase subunit 2
Enzyme 23 Synonyms Not Available
Enzyme 23 Gene Name COX2
Enzyme 23 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QMTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Enzyme 23 Number of Residues 227
Enzyme 23 Molecular Weight 26051.3
Enzyme 23 Theoretical pI 4.53
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Energy production and conversion
Enzyme 23 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 56410965 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID Q3L5W1 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name Q3L5W1_BOVIN Link Image
Enzyme 23 PDB ID 1OCZ Link Image
Enzyme 23 PDB File Show
Enzyme 23 3D Structure
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >957 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATAA
Enzyme 23 GenBank Gene ID AY676860 Link Image
Enzyme 23 GeneCard ID COX2 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Not Available
Enzyme 23 Locus Not Available
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References
  1. [PubMed Link Image]
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 58
Enzyme 24 Name Cytochrome c oxidase subunit 1
Enzyme 24 Synonyms Not Available
Enzyme 24 Gene Name COXI
Enzyme 24 Protein Sequence >Cytochrome c oxidase subunit 1
LLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFG
NWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHA
GASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSL
PVLAAGITMLLTDRNLNTTFFDPAGGGDP
Enzyme 24 Number of Residues 209
Enzyme 24 Molecular Weight 22171.2
Enzyme 24 Theoretical pI 4.51
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Energy production and conversion
Enzyme 24 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 24 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • None
Enzyme 24 Transmembrane Regions
  • None
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 148508537 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID A5YMR7 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name A5YMR7_BOVIN Link Image
Enzyme 24 PDB ID 1OCZ Link Image
Enzyme 24 PDB File Show
Enzyme 24 3D Structure
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence Not Available
Enzyme 24 GenBank Gene ID EF568621 Link Image
Enzyme 24 GeneCard ID COXI Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Not Available
Enzyme 24 Locus Not Available
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 59
Enzyme 25 Name Cytochrome c oxidase subunit 2
Enzyme 25 Synonyms Not Available
Enzyme 25 Gene Name COII
Enzyme 25 Protein Sequence >Cytochrome c oxidase subunit 2
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS
YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMSSRPGLYYG
Enzyme 25 Number of Residues 194
Enzyme 25 Molecular Weight 22250.8
Enzyme 25 Theoretical pI 4.45
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Energy production and conversion
Enzyme 25 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 158905380 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID B2KPB9 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name B2KPB9_BOVIN Link Image
Enzyme 25 PDB ID 1OCZ Link Image
Enzyme 25 PDB File Show
Enzyme 25 3D Structure
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence Not Available
Enzyme 25 GenBank Gene ID EF693802 Link Image
Enzyme 25 GeneCard ID COII Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Not Available
Enzyme 25 Locus Not Available
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References
  1. [PubMed Link Image]
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 61
Enzyme 26 Name Cytochrome c oxidase subunit 1
Enzyme 26 Synonyms Not Available
Enzyme 26 Gene Name COXI
Enzyme 26 Protein Sequence >Cytochrome c oxidase subunit 1
LSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDM
AFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHL
AGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTD
RNLNT
Enzyme 26 Number of Residues 185
Enzyme 26 Molecular Weight 19833.5
Enzyme 26 Theoretical pI 5.43
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Energy production and conversion
Enzyme 26 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 26 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 148508637 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID A5YMW7 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name A5YMW7_BOVIN Link Image
Enzyme 26 PDB ID 1OCZ Link Image
Enzyme 26 PDB File Show
Enzyme 26 3D Structure
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence Not Available
Enzyme 26 GenBank Gene ID EF568671 Link Image
Enzyme 26 GeneCard ID COXI Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Not Available
Enzyme 26 Locus Not Available
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References Not Available
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 63
Enzyme 27 Name Cytochrome c oxidase subunit 1
Enzyme 27 Synonyms Not Available
Enzyme 27 Gene Name COI
Enzyme 27 Protein Sequence >Cytochrome c oxidase subunit 1
SSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPP
AMSQYQTPLFVWSVMITAVLLLLS
Enzyme 27 Number of Residues 84
Enzyme 27 Molecular Weight 8746.2
Enzyme 27 Theoretical pI 6.50
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Energy production and conversion
Enzyme 27 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 27 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 94483304 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID A1XP62 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name A1XP62_BOVIN Link Image
Enzyme 27 PDB ID 1OCZ Link Image
Enzyme 27 PDB File Show
Enzyme 27 3D Structure
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence Not Available
Enzyme 27 GenBank Gene ID DQ487094 Link Image
Enzyme 27 GeneCard ID COI Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Not Available
Enzyme 27 Locus Not Available
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References Not Available
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 65
Enzyme 28 Name Cytochrome c oxidase subunit 1
Enzyme 28 Synonyms Not Available
Enzyme 28 Gene Name COX1
Enzyme 28 Protein Sequence >Cytochrome c oxidase subunit 1
MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAVMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKR
EVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK
Enzyme 28 Number of Residues 514
Enzyme 28 Molecular Weight 57017.9
Enzyme 28 Theoretical pI 6.55
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Energy production and conversion
Enzyme 28 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B
Enzyme 28 Pathways
  • Energy metabolism
  • oxidative phosphorylation
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 157778468 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID B1NZU1 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name B1NZU1_BOVIN Link Image
Enzyme 28 PDB ID 1OCZ Link Image
Enzyme 28 PDB File Show
Enzyme 28 3D Structure
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >956 bp
ATGTTCATAATTAACATCTTAATACTAATTATTCCCATCCTATTGGCCGTAGCATTCCTT
ACGTTAGTGGAACGAAAAGTTCTAGGCTATATACAACTCCGAAAAGGTCCAAATGTCGTA
GGTCCATATGGCCTACTTCAACCCATCGCCGATGCAATCAAACTTTTCATTAAAGAACCA
CTACGACCCGCTACATCTTCAGCCTCAATATTTATCCTAGCACCTATCATAGCTTTAGGC
CTAGCCTTAACCATGTGAATTCCCCTACCAATACCCTATCCTCTTATCAACATAAACCTA
GGAGTCCTATTTATACTAGCCATATCAAGCCTAGCCGTATACTCCATTCTCTGATCAGGC
TGAGCTTCCAACTCAAAATACGCACTAATCGGAGCCCTACGAGCAGTAGCACAAACAATC
TCATACGAAGTAACGCTAGCAATTATCCTGTTATCAGTACTCCTAATAAGTGGGTCCTTT
ACCCTCTCCACATTAATTACTACACAAGAACAAATATGGTTAATCCTCCCAGCATGGCCT
CTAGCAATAATATGATTTATCTCAACACTAGCAGAAACAAACCGAGCTCCATTTGATTTA
ACTGAAGGAGAATCAGAGCTAGTCTCGGGCTTCAACGTAGAATATGCAGCAGGACCATTT
GCCCTCTTCTTCATAGCAGAGTACGCAAATATTATCATAATAAATATCTTTACAGCAATT
TTATTCCTAGGAACATCCCACAATCCACACATACCAGAACTCTACACAATCAATTTTACC
ATTAAATCCCTACTGCTCACAATATCCTTCCTATGAATCCGAGCATCCTACCCTCGATTT
CGCTATGACCAACTAATACACTTACTATGAAAAAATTTTCTACCTCTGACACTAGCCCTG
TGCATGTGACACGTATCCCTACCCATCCTTACATCAGGCATCCCACCACAAACATA
Enzyme 28 GenBank Gene ID EU177847 Link Image
Enzyme 28 GeneCard ID COX1 Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Not Available
Enzyme 28 Locus Not Available
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References
  1. [PubMed Link Image]
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 91
Enzyme 29 Name Primary amine oxidase, liver isozyme
Enzyme 29 Synonyms
  1. Copper amine oxidase
  2. Amine oxidase [copper-containing]
  3. Serum amine oxidase
  4. SAO
Enzyme 29 Gene Name Not Available
Enzyme 29 Protein Sequence >Primary amine oxidase, liver isozyme
MFIFIFLSLWTLLVMGREEGGVGSEEGVGKQCHPSLPPRCPSRSPSDQPWTHPDQSQLFA
DLSREELTTVMSFLTQQLGPDLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPPA
REALAIVFFGGQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRRPVLLREYLDIDQ
MIFNRELPQAAGVLHHCCSYKQGGQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLH
PVGLELLVDHKALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPDDGTGGFWS
LKSQVPPGPTPPLQFHPQGPRFSVQGNRVASSLWTFSFGLGAFSGPRVFDVRFQGERLAY
EISLQEAGAVYGGNTPAAMLTRYMDSGFGMGYFATPLIRGVDCPYLATYMDWHFVVESQT
PKTLHDAFCVFEQNKGLPLRRHHSDFLSHYFGGVAQTVLVFRSVSTMLNYDYVWDMVFYP
NGAIEVKLHATGYISSAFLFGAARRYGNQVGEHTLGPVHTHSAHYKVDLDVGGLENWVWA
EDMAFVPTAIPWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHPR
GYRIQTVSFAGGPMPQNSPMERAFSWGRYQLAITQRKETEPSSSSVFNQNDPWTPTVDFS
DFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDQEPSMDSAD
SIYFREGQDAGSCEINPLACLPQAATCAPDLPVFSHGGYPEY
Enzyme 29 Number of Residues 762
Enzyme 29 Molecular Weight 84756.1
Enzyme 29 Theoretical pI 5.82
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 29 Specific Function RCH(2)NH(2) + H(2)O + O(2) = RCHO + NH(3) + H(2)O(2)
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • 1-16
Enzyme 29 Transmembrane Regions
  • None
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 546216 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q29437 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name AOCX_BOVIN Link Image
Enzyme 29 PDB ID 1TU5 Link Image
Enzyme 29 PDB File Show
Enzyme 29 3D Structure
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >2289 bp
ATGTTCATCTTCATTTTTCTGTCCTTGTGGACTCTTCTGGTGATGGGCAGGGAGGAAGGT
GGTGTTGGGAGTGAGGAGGGAGTTGGGAAGCAATGTCATCCCAGCCTGCCTCCCCGCTGC
CCCTCCAGATCCCCTAGTGACCAGCCCTGGACACACCCTGACCAGAGCCAGCTGTTTGCA
GACCTGAGCCGAGAAGAGCTGACAACTGTGATGAGCTTCCTGACTCAGCAGCTGGGGCCA
GACCTGGTGGATGCAGCCCAGGCCCGACCCTCAGACAACTGTGTCTTCTCGGTAGAACTT
CAGCTGCCCCCCAAGGCTGCAGCCCTGGCCCACCTGGACAGGGGGAGCCCCCCACCTGCC
CGGGAGGCACTGGCCATCGTCTTCTTTGGCGGACAACCCCAGCCCAATGTGACTGAGCTG
GTAGTGGGGCCGCTGCCCCAGCCCTCCTACATGCGGGATGTGACCGTGGAGCGTCATGGC
GGCCCCCTGCCCTATTACCGACGCCCCGTGCTTCTCCGAGAGTACCTGGACATAGACCAG
ATGATCTTCAACAGAGAGCTGCCCCAGGCTGCTGGTGTCCTGCACCACTGCTGCTCCTAC
AAACAAGGAGGACAGAAACTGTTGACCATGAACTCAGCTCCCCGTGGAGTGCAGTCAGGT
GATAGGTCCACTTGGTTTGGCATCTACTATAACATCACAAAGGGTGGGCCTTACCTGCAC
CCCGTGGGGTTGGAGCTTCTGGTAGACCATAAGGCTCTGGACCCTGCCGATTGGACCGTC
CAGAAGGTGTTCTTTCAAGGCCGCTACTATGAAAATCTGGCCCAGCTGGAGGAGCAGTTT
GAGGCTGGCCAGGTGAATGTGGTGGTGATCCCAGACGATGGCACAGGTGGGTTCTGGTCC
CTGAAGTCCCAGGTGCCTCCGGGTCCAACTCCCCCTCTGCAGTTCCATCCTCAGGGCCCC
CGCTTCAGTGTCCAGGGCAATCGAGTGGCCTCCTCATTGTGGACTTTCTCCTTTGGCCTC
GGAGCTTTCAGTGGTCCTAGGGTCTTTGACGTTCGATTCCAGGGAGAACGGCTGGCTTAT
GAGATCAGCCTGCAAGAGGCTGGTGCTGTCTACGGTGGGAATACTCCAGCAGCAATGCTC
ACTCGCTATATGGATAGTGGCTTTGGCATGGGTTACTTCGCCACACCCCTGATTCGTGGC
GTAGACTGCCCTTACCTGGCCACCTACATGGACTGGCACTTCGTTGTGGAGTCCCAAACC
CCCAAGACACTACATGATGCCTTTTGTGTGTTTGAGCAGAACAAGGGCCTGCCCCTGAGG
CGACACCACTCAGATTTTCTTTCCCACTATTTTGGGGGCGTTGCACAGACAGTGCTGGTC
TTCAGGTCTGTGTCCACGATGCTCAACTATGACTATGTGTGGGATATGGTCTTCTACCCC
AATGGGGCCATAGAAGTCAAATTGCATGCCACGGGCTACATCAGCTCAGCGTTCCTCTTT
GGTGCTGCCCGAAGATACGGAAACCAGGTTGGGGAACACACGCTGGGCCCCGTCCACACC
CACAGTGCCCACTACAAGGTGGATCTGGACGTGGGAGGACTGGAAAACTGGGTCTGGGCT
GAGGATATGGCTTTTGTCCCCACGGCGATACCCTGGAGCCCTGAGCACCAGATACAGAGG
CTGCAGGTGACCCGGAAGCAGCTGGAGACCGAGGAGCAGGCTGCCTTCCCCCTGGGAGGG
GCTTCCCCTCGCTACCTGTACCTGGCCAGCAAGCAGAGCAACAAGTGGGGGCACCCTCGC
GGCTATCGCATCCAGACCGTCAGCTTTGCTGGGGGGCCGATGCCCCAGAACAGCCCCATG
GAGAGAGCCTTCAGCTGGGGGAGGTACCAGCTGGCCATAACCCAGAGGAAGGAGACAGAG
CCCAGCAGCTCCAGCGTCTTCAATCAGAATGACCCCTGGACTCCCACCGTGGACTTTTCT
GACTTCATCAACAATGAGACCATTGCTGGAAAGGACTTGGTGGCCTGGGTGACAGCCGGT
TTCCTGCACATCCCACATGCAGAGGATATTCCCAACACGGTGACGGTGGGGAACGGTGTG
GGCTTCTTCTTGAGACCCTACAACTTCTTTGACCAGGAGCCCTCCATGGATTCTGCTGAC
TCCATCTACTTCCGGGAAGGCCAGGATGCTGGGTCCTGTGAGATCAACCCCCTGGCTTGC
CTGCCCCAGGCTGCTACCTGTGCCCCTGACCTCCCTGTCTTCTCCCACGGGGGCTACCCT
GAGTACTAG
Enzyme 29 GenBank Gene ID S69583 Link Image
Enzyme 29 GeneCard ID Not Available
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Not Available
Enzyme 29 Locus Not Available
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References
  1. [PubMed Link Image]
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 95
Enzyme 30 Name Membrane primary amine oxidase
Enzyme 30 Synonyms
  1. Copper amine oxidase
  2. Semicarbazide-sensitive amine oxidase
  3. SSAO
  4. Vascular adhesion protein 1
  5. VAP-1
Enzyme 30 Gene Name AOC3
Enzyme 30 Protein Sequence >Membrane primary amine oxidase
MNQKTTLVLLALAVITIFALVCVLIAGRGGDGGEASQPHYCPSGTPSVQPWTHPGQNQLF
ADLSREELTAVMSFLTQKLGPDLVDAAQARPSDNCIFSVELQLPPKAAALAHLDRRSPPP
AREALAIVFFGGQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRRPVLLREYLDID
QMIFNRELPQAAGVLHHCCSYKQGGGNLVTMTTAPRGLQSGDRATWFGLYYNISGAGYYL
HPVGLELLVDHKALDPAQWTIQKVFFQGRYYESLAQLEEQFEAGRVNVVVIPNNGTGGSW
SLKSQVPPGPTPPLQFHPQGTRFSVQGSRVTSSLWTFSFGLGAFSGPRIFDIRFQGERLA
YEISLQEAVAIYGGNTPAAMLTRYMDGCFGMGKFATPLTRGVDCPYLATYVDWHFLLESQ
APRTLHDAFCVFEQNKGLPLRRHHSDFISQYFGGVVETVLVFRSVSTLLNYDYVWDMVFH
PNGAIEVKFHATGYISSAFFFGTAQKYGNQVRENTLGTVHTHSAHYKVDLDVGGLENWVW
AEDMAFVPTTVPWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHP
RGYRIQTVSFAGRPLPQNSSTERAISWGRYQLAVTQRKETEPSSSSVFNQNDPWTPTVDF
ADFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSINSA
DSIYFQKHQDAGSCEVNSLACLPKDPACAPDLPAFSHGGFFTN
Enzyme 30 Number of Residues 763
Enzyme 30 Molecular Weight 84499.9
Enzyme 30 Theoretical pI 6.51
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 30 Specific Function Cell adhesion protein that participates in lymphocyte recirculation by mediating the binding of lymphocytes to peripheral lymph node vascular endothelial cells in an L-selectin- independent fashion. Has a monoamine oxidase activity
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • None
Enzyme 30 Transmembrane Regions
  • 7-27
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 6682825 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID Q9TTK6 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name AOC3_BOVIN Link Image
Enzyme 30 PDB ID Not Available
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >2292 bp
ATGAACCAGAAGACCACCCTGGTGCTCCTTGCTCTGGCTGTCATCACCATCTTTGCCTTG
GTGTGTGTCTTAATAGCTGGCAGGGGAGGAGATGGGGGTGAAGCCAGCCAACCTCACTAC
TGCCCCTCCGGAACCCCCAGTGTCCAGCCCTGGACACACCCTGGCCAGAACCAGCTGTTT
GCAGACCTGAGCCGAGAAGAGCTGACAGCTGTGATGAGCTTCCTGACCCAGAAGCTGGGG
CCAGACCTGGTGGATGCAGCCCAGGCCCGACCCTCTGACAACTGCATCTTCTCGGTAGAG
CTGCAGCTGCCCCCCAAGGCTGCAGCCCTGGCCCACCTGGACAGGAGGAGCCCCCCACCT
GCCCGGGAGGCACTGGCCATCGTCTTCTTTGGTGGACAACCCCAGCCCAATGTGACTGAG
CTGGTGGTGGGGCCGCTGCCCCAGCCCTCCTACATGCGGGATGTGACCGTGGAGCGTCAT
GGGGGCCCCCTGCCCTATTACCGACGCCCCGTGCTTCTCCGAGAGTACCTGGACATAGAC
CAGATGATCTTCAACAGAGAGCTGCCCCAGGCTGCTGGTGTCCTGCACCACTGCTGCTCC
TACAAACAAGGAGGAGGGAACCTGGTGACCATGACCACAGCCCCCCGCGGTTTGCAATCA
GGTGACCGGGCCACCTGGTTTGGCCTCTACTACAACATCTCAGGGGCTGGGTACTATCTG
CACCCTGTGGGGTTAGAGCTGCTGGTAGATCACAAGGCTCTGGACCCTGCCCAGTGGACC
ATCCAGAAGGTGTTCTTTCAAGGCCGCTACTATGAAAGTCTGGCCCAGCTGGAGGAGCAG
TTTGAGGCTGGCCGGGTGAATGTGGTGGTGATCCCAAACAATGGCACAGGTGGGTCCTGG
TCCCTGAAGTCCCAGGTGCCCCCGGGTCCAACTCCACCTCTGCAGTTCCATCCTCAGGGC
ACCCGCTTCAGTGTCCAGGGCAGTCGAGTGACCTCCTCATTGTGGACTTTCTCCTTTGGC
CTCGGAGCTTTCAGTGGTCCTAGGATCTTTGACATTCGATTCCAAGGAGAACGACTGGCT
TATGAGATCAGCCTGCAAGAGGCCGTGGCTATTTATGGTGGGAATACCCCAGCAGCAATG
CTCACTCGCTATATGGATGGCTGCTTTGGCATGGGCAAGTTCGCCACGCCCCTGACCCGA
GGGGTGGACTGCCCCTATCTGGCCACCTATGTGGACTGGCACTTCCTTCTGGAGTCTCAA
GCCCCCAGGACCCTACATGATGCCTTTTGTGTGTTTGAGCAGAACAAGGGCCTGCCCCTG
AGGCGACACCACTCAGATTTTATTTCCCAGTATTTTGGGGGCGTTGTGGAGACAGTGCTG
GTCTTCAGATCTGTGTCAACCTTGCTCAACTATGACTATGTGTGGGATATGGTCTTTCAC
CCCAATGGGGCCATAGAAGTCAAATTCCATGCCACGGGCTATATCAGCTCAGCGTTCTTC
TTTGGTACTGCCCAAAAATACGGAAACCAGGTTCGGGAGAATACACTGGGCACCGTCCAC
ACCCACAGTGCCCACTACAAGGTGGATCTGGATGTGGGAGGACTGGAGAACTGGGTCTGG
GCTGAGGACATGGCTTTTGTCCCCACAACGGTACCCTGGAGCCCTGAGCACCAGATACAG
AGGCTGCAGGTGACCCGGAAGCAGCTGGAGACTGAGGAGCAGGCCGCCTTCCCCCTGGGA
GGGGCCTCCCCTCGCTACCTGTACCTGGCCAGCAAGCAGAGCAACAAGTGGGGGCACCCT
CGCGGCTATCGCATCCAGACGGTCAGCTTTGCTGGGAGGCCGCTGCCCCAGAACAGCTCC
ACAGAGAGAGCCATCAGCTGGGGGAGGTACCAGCTGGCCGTGACCCAGAGGAAGGAGACA
GAGCCCAGCAGCTCCAGCGTCTTCAATCAGAATGACCCCTGGACTCCCACTGTGGACTTT
GCTGACTTCATCAACAATGAGACCATTGCTGGAAAGGACTTGGTGGCCTGGGTGACAGCC
GGTTTCCTGCACATCCCTCATGCAGAGGACATTCCCAACACAGTGACAGTGGGGAACGGT
GTGGGCTTCTTTCTGCGACCCTACAACTTCTTTGATGAGGACCCCTCCATCAATTCTGCT
GACTCAATCTACTTCCAAAAACACCAGGATGCTGGGTCCTGTGAGGTCAACTCCCTGGCT
TGTCTGCCCAAGGATCCTGCCTGTGCCCCTGATCTCCCTGCCTTCTCCCACGGGGGCTTC
TTCACCAATTAG
Enzyme 30 GenBank Gene ID AB019242 Link Image
Enzyme 30 GeneCard ID AOC3 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:1
Enzyme 30 Locus 17q21
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References
  1. [PubMed Link Image]
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 96
Enzyme 31 Name Primary amine oxidase, lung isozyme
Enzyme 31 Synonyms
  1. Copper amine oxidase
  2. Amine oxidase [copper-containing]
  3. BOLAO
Enzyme 31 Gene Name Not Available
Enzyme 31 Protein Sequence >Primary amine oxidase, lung isozyme
MFIFIFLSLWTLLVMGREEGGVGSEEGVGKQCHPSLPPRCPSRSPSDQPWTHPDQSQLFA
DLSREELTAVMSFLTQKLGPDLVDAAQARPSDNCIFSVELQLPPKAAALAHLDRRSPPPA
REALAIVFFGGQPQPNVTELVVGPLPQPSYMRDVTVERHGGPLPYYRHTVLLREYLDIDQ
MIFNRELPQAAGVLHHCCSYKQGGGNLVTMTTAPPGLQSGDRATWFGLYYNISKAGYYLH
PVGLELLVDHKALDPAQWTIQKVFFQGRYYESLVQLEEQFEAGRVNVVVIPNNGTGGSWS
LKSQVPPGPTPPLQFHPQGTRFSVQGSRVTSSLWTFSFGLGAFSGPRIFDIRFQGERLAY
EISLQEAVAIYGGNTPAAMLTRYMDACFGMGKFATPLTRGVDCPYLATYVDWHFLLESQA
PKTLHDAFCVFEQNKGLPLRRHHSDFISQYFGGVVETVLVFRSVSTLLNYDYVWDMVFHP
NGAIEVKFHVTGYISSAFFFGTAQKYGNQVRENTLGTVHTHSAHYKVDLDVGGLENWVWA
EDMAFVPTTVPWSPEHQIQRLQVIRKQLETEEQAAFPLGGGSPRYLYLASKQSNKWGHPR
GYRIQTVSFAGRPLPQNSSTERAISWGRYQLAVTQRKETEPSSSSVFNQNDPWTPTVDFA
DFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDQEPSMDSAD
SIYFREGQDAGSCEINPLACLPQAATCAPDLPVFSHGGYPEY
Enzyme 31 Number of Residues 762
Enzyme 31 Molecular Weight 84882.4
Enzyme 31 Theoretical pI 6.16
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 31 Specific Function RCH(2)NH(2) + H(2)O + O(2) = RCHO + NH(3) + H(2)O(2)
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function
Enzyme 31 Signals
  • 1-16
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 2665358 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID O46406 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name AOCY_BOVIN Link Image
Enzyme 31 PDB ID 1TU5 Link Image
Enzyme 31 PDB File Show
Enzyme 31 3D Structure
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence >2289 bp
ATGTTCATCTTCATTTTTCTGTCCTTGTGGACTCTTCTGGTGATGGGCAGGGAGGAAGGT
GGTGTTGGGAGTGAGGAGGGAGTTGGGAAGCAATGTCATCCCAGCCTGCCTCCCCGCTGC
CCCTCCAGATCCCCTAGTGACCAGCCCTGGACACACCCTGACCAGAGCCAGCTGTTTGCA
GACCTGAGCCGAGAAGAGCTGACAGCTGTGATGAGCTTCCTGACCCAGAAGCTGGGGCCA
GACCTGGTGGATGCAGCCCAGGCCCGACCCTCTGACAACTGCATCTTCTCGGTAGAGCTG
CAGCTGCCCCCCAAGGCTGCAGCCCTGGCCCACCTGGACAGGAGGAGCCCCCCACCTGCC
CGGGAGGCACTGGCCATCGTCTTCTTTGGTGGACAACCCCAGCCCAATGTGACTGAGCTG
GTGGTGGGGCCGCTGCCCCAGCCCTCCTACATGCGGGATGTGACCGTGGAGCGTCATGGG
GGCCCCCTGCCCTATTACCGACACACCGTGCTTCTCCGAGAGTACCTGGACATAGACCAG
ATGATCTTCAACAGAGAGCTGCCCCAGGCTGCTGGTGTCCTGCACCACTGCTGCTCCTAC
AAACAAGGAGGAGGGAACCTGGTGACCATGACTACAGCCCCCCCCGGTTTGCAATCAGGT
GACCGGGCCACCTGGTTTGGCCTCTACTACAACATCTCAAAGGCTGGGTACTATCTGCAC
CCTGTGGGGTTAGAGCTGCTGGTAGATCACAAGGCTCTGGACCCTGCCCAGTGGACCATC
CAGAAGGTGTTCTTTCAAGGCCGCTACTATGAAAGTCTGGTCCAGCTGGAGGAGCAGTTT
GAGGCTGGCCGGGTGAATGTGGTGGTGATCCCAAACAATGGCACAGGTGGGTCCTGGTCC
CTGAAGTCCCAGGTGCCCCCGGGTCCAACTCCACCTCTGCAGTTCCATCCTCAGGGCACC
CGCTTCAGTGTCCAGGGCAGTCGAGTGACCTCCTCATTGTGGACTTTCTCCTTTGGCCTC
GGAGCTTTCAGTGGTCCTAGGATCTTTGACATTCGATTCCAAGGAGAACGACTGGCTTAT
GAGATCAGCCTGCAAGAGGCCGTGGCTATTTATGGTGGGAATACTCCAGCAGCAATGCTC
ACTCGCTATATGGATGCCTGCTTTGGCATGGGCAAGTTCGCCACGCCCCTGACCCGAGGG
GTGGACTGCCCCTATCTGGCCACCTATGTGGACTGGCACTTCCTTCTGGAGTCTCAAGCC
CCCAAGACCCTACATGATGCCTTTTGTGTGTTTGAGCAGAACAAGGGCCTGCCCCTGAGG
CGACACCACTCAGATTTTATTTCCCAGTATTTTGGGGGCGTTGTGGAGACAGTGCTGGTC
TTCAGATCTGTGTCAACCTTGCTCAACTATGACTATGTGTGGGATATGGTCTTTCACCCC
AATGGGGCCATAGAAGTCAAATTCCATGTCACGGGCTATATCAGCTCAGCGTTCTTCTTT
GGTACTGCCCAAAAATACGGAAACCAGGTTCGGGAGAATACACTGGGCACCGTCCACACC
CACAGTGCCCACTACAAGGTGGATCTGGATGTGGGAGGACTGGAGAACTGGGTCTGGGCT
GAGGACATGGCTTTTGTCCCCACAACGGTACCCTGGAGCCCTGAGCACCAGATACAGAGG
CTGCAGGTGATCCGGAAGCAGCTGGAGACTGAGGAGCAGGCCGCCTTCCCCCTGGGAGGG
GGTTCCCCTCGCTACCTGTACCTGGCCAGCAAGCAGAGCAACAAGTGGGGGCACCCTCGC
GGGTATCGCATCCAGACGGTCAGCTTTGCTGGGAGGCCGCTGCCCCAGAACAGCTCCACA
GAGAGAGCCATCAGCTGGGGGAGGTACCAGCTGGCCGTGACCCAGAGGAAGGAGACAGAG
CCCAGCAGCTCCAGCGTCTTCAATCAGAATGACCCCTGGACTCCCACTGTGGACTTTGCT
GACTTCATCAACAATGAGACCATTGCTGGAAAGGACTTGGTGGCCTGGGTGACAGCCGGT
TTCCTGCACATCCCACATGCAGAGGATATTCCCAACACGGTGACGGTGGGGAACGGTGTG
GGCTTCTTCTTGAGACCCTACAACTTCTTTGACCAGGAGCCCTCCATGGATTCTGCTGAC
TCCATCTACTTCCGGGAAGGCCAGGATGCTGGGTCCTGTGAGATCAACCCCCTGGCTTGT
CTGCCCCAGGCTGCTACCTGTGCCCCTGACCTCCCTGTCTTCTCCCACGGGGGCTACCCT
GAGTACTAG
Enzyme 31 GenBank Gene ID Y15774 Link Image
Enzyme 31 GeneCard ID Not Available
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Not Available
Enzyme 31 Locus Not Available
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References
  1. [PubMed Link Image]
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 98
Enzyme 32 Name Copper amine oxidase
Enzyme 32 Synonyms Not Available
Enzyme 32 Gene Name ABP1
Enzyme 32 Protein Sequence >Copper amine oxidase
MGREALALGWASAAILVLQTLAAAEGAPQTPGDKGRVFADLSAQELKAVHSFLWSQKELR
LEPSNTLTVAKNSVFLIEMLLPKKQHVLKFLDKGHRPPVREARAIIFFGAQEQPNITEFA
VGPLPRPRYLRHLPPRPRHQASWASRPISKAEYALLSHTLEEATKPLRAFFWRTAGAVFG
NCSQRCLTFTDVAPRGVASGQRRSWFILQLQIEGYFLHPTGMELLLDHGSPNPRDWTVER
VWYNGRFYRSPEELAQKYDDGEVDAVVLEDPLAKGKDGANLPEAALFSSYQLRGDLGVSK
SGPRLVQPQGARYSLDGHTVRYAGWSFSFRLRSSSGLQVLDVRFGGERVAYEVSVQEAVA
LYGGHTPAGMQTKYMDVGWGLGSVTYELAPGIDCPEMATFVDALHYYDDDGPVLYPRALC
LFEMPTGVPIRRHFNSNFNGGFNFYAGLKGQALVLRTTSTVYNYDYIWDFIFYPNGVMEA
KMHATGYIHATFYTPEGLRHGTRLHTHLIGNMHTHLVHYRVDLDVAGTKNSFQTLQMKLE
NITNPWSPGHRLVHPALQQMRYSRERQAAFRFGQTLPKYLLFTSPEQNPWGHQRSYRVQI
HSMADQVLPPGWQEERAVTWARYPLAVTKYRESERYSSSIYNQNDPWDPPVVFEEFLRNN
ENIEDEDLVAWVTVGFLHIPHAEDIPNTTTPGNSVGFLLRPFNFFPEDPSLASRDLIIVR
PLENGSTYTQSWMPEEEGDCLKPPSFSYNGTYRLV
Enzyme 32 Number of Residues 755
Enzyme 32 Molecular Weight 85532.2
Enzyme 32 Theoretical pI 7.21
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 32 Specific Function Not Available
Enzyme 32 Pathways Not Available
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • None
Enzyme 32 Transmembrane Regions
  • None
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 75773463 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID Q3MHQ1 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name Q3MHQ1_BOVIN Link Image
Enzyme 32 PDB ID Not Available
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >2268 bp
ATGGGGCGGGAGGCCCTGGCCCTCGGCTGGGCGAGCGCGGCCATCCTGGTGTTGCAGACG
CTGGCGGCGGCAGAGGGCGCCCCGCAGACCCCAGGCGACAAAGGCAGGGTATTTGCGGAC
CTGAGCGCCCAAGAGCTCAAGGCCGTGCACAGCTTCCTCTGGTCCCAGAAGGAGCTGAGA
CTGGAGCCGTCCAACACGCTGACCGTGGCCAAGAACTCCGTGTTCCTCATTGAGATGCTG
CTGCCCAAGAAGCAACACGTGCTCAAGTTTCTGGATAAAGGCCACCGGCCTCCCGTTCGG
GAGGCGCGAGCCATCATCTTCTTTGGAGCCCAGGAACAGCCCAACATCACCGAGTTTGCC
GTGGGGCCGCTGCCAAGGCCCCGTTACCTGCGACACCTGCCGCCCAGGCCCAGGCACCAG
GCCTCCTGGGCCTCCAGGCCCATCTCCAAGGCAGAGTATGCCCTTCTGAGTCACACCCTG
GAGGAGGCCACCAAGCCCCTCCGCGCGTTTTTCTGGCGCACCGCGGGCGCTGTGTTCGGA
AACTGCTCCCAGCGGTGCCTGACTTTCACCGACGTGGCACCCCGGGGCGTGGCCTCCGGC
CAGCGCCGCTCTTGGTTCATCCTGCAACTGCAAATCGAAGGCTACTTCCTGCACCCCACT
GGGATGGAGCTCCTGCTGGACCACGGAAGCCCGAACCCCCGGGACTGGACAGTGGAGCGG
GTCTGGTACAATGGGAGGTTCTACCGGAGCCCCGAGGAGCTGGCTCAGAAGTACGACGAC
GGAGAGGTGGATGCGGTGGTCTTGGAGGACCCGCTCGCCAAGGGCAAGGACGGAGCCAAC
CTGCCCGAGGCGGCCCTCTTCTCCTCCTACCAGTTACGCGGGGACTTGGGCGTCTCTAAG
AGCGGCCCCCGCCTGGTGCAGCCCCAGGGCGCGCGCTACAGCCTGGACGGCCACACGGTG
CGCTACGCCGGCTGGAGCTTCTCCTTCCGCCTGCGCTCATCCTCGGGGCTGCAAGTCCTG
GATGTGCGCTTTGGCGGTGAGCGCGTAGCCTACGAGGTGAGCGTGCAGGAGGCCGTGGCA
CTGTACGGAGGACACACGCCGGCCGGCATGCAGACCAAGTATATGGATGTGGGCTGGGGC
TTGGGCAGCGTCACTTATGAGCTGGCCCCTGGCATCGATTGCCCGGAGATGGCCACCTTC
GTGGACGCCCTCCACTACTACGACGACGACGGCCCCGTCCTCTACCCCCGGGCTCTCTGT
CTCTTCGAGATGCCCACAGGGGTGCCTATCCGGCGGCACTTTAACTCCAACTTCAACGGT
GGCTTCAATTTCTATGCGGGGCTCAAGGGTCAGGCGCTGGTGCTAAGGACCACGTCGACG
GTCTACAACTATGACTACATCTGGGACTTCATCTTCTACCCCAACGGGGTGATGGAGGCC
AAGATGCACGCCACCGGCTACATCCATGCCACCTTCTACACCCCCGAGGGGCTGCGCCAC
GGGACCCGCCTGCACACCCACCTCATCGGCAACATGCACACCCACCTTGTGCATTACCGC
GTCGACCTGGATGTGGCAGGCACCAAGAATAGCTTCCAGACCCTGCAGATGAAGCTGGAA
AACATCACCAACCCCTGGAGCCCAGGACACCGCCTAGTCCATCCAGCTCTCCAGCAGATG
CGGTATTCTCGGGAGCGCCAGGCAGCCTTCCGCTTCGGACAGACTCTGCCCAAATACCTG
CTTTTTACTAGCCCTGAACAGAACCCCTGGGGCCACCAGCGCAGCTACCGAGTGCAGATC
CACTCCATGGCTGACCAAGTGCTGCCCCCAGGCTGGCAAGAGGAGCGGGCCGTCACCTGG
GCCAGGTACCCCCTGGCAGTGACCAAATACCGGGAGTCAGAGAGATACAGCAGCAGCATC
TACAACCAGAACGACCCCTGGGACCCACCTGTCGTCTTTGAGGAGTTTCTTCGCAACAAT
GAGAACATTGAAGACGAGGACCTGGTGGCCTGGGTCACAGTGGGCTTCCTGCACATCCCC
CACGCAGAAGACATCCCCAACACGACCACGCCCGGGAACTCCGTGGGCTTTCTGCTCCGA
CCCTTCAACTTCTTCCCAGAGGACCCGTCCCTGGCATCCAGAGACCTCATAATCGTGAGA
CCTCTGGAAAATGGCTCCACCTACACCCAGAGCTGGATGCCTGAGGAAGAGGGGGACTGC
TTGAAGCCTCCCTCTTTCAGCTACAATGGAACCTACAGGCTTGTGTGA
Enzyme 32 GenBank Gene ID BC105152 Link Image
Enzyme 32 GeneCard ID ABP1 Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:7
Enzyme 32 Locus 7q34-q36
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References Not Available
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 587
Enzyme 33 Name Superoxide dismutase [Cu-Zn]
Enzyme 33 Synonyms Not Available
Enzyme 33 Gene Name SOD1
Enzyme 33 Protein Sequence >Superoxide dismutase [Cu-Zn]
XAXKGXGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPL
SKKHGGPKDEERHVGDLGNVTADKNGVAXVDIVDPLISLSGE
Enzyme 33 Number of Residues 102
Enzyme 33 Molecular Weight 10295.2
Enzyme 33 Theoretical pI 5.81
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Inorganic ion transport and metabolism
Enzyme 33 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 33 Pathways Not Available
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • None
Enzyme 33 Transmembrane Regions
  • None
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 134289051 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID A4URH1 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name A4URH1_BOVIN Link Image
Enzyme 33 PDB ID 1SXZ Link Image
Enzyme 33 PDB File Show
Enzyme 33 3D Structure
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence Not Available
Enzyme 33 GenBank Gene ID EF471304 Link Image
Enzyme 33 GeneCard ID SOD1 Link Image
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Chromosome:2
Enzyme 33 Locus 21q22.1|21q22.11
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References Not Available
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 589
Enzyme 34 Name Superoxide dismutase [Cu-Zn]
Enzyme 34 Synonyms Not Available
Enzyme 34 Gene Name ECSOD
Enzyme 34 Protein Sequence >Superoxide dismutase [Cu-Zn]
MLALLCASVVLVAYASADQIQQQMGSNTEEQIRDMHAKVTEIWQEMMQRQAAAIDPDAAL
HAVCRVLPSATLEAEQPRVSGLVLFRQLRPGALLEAFFHLEGFPNEPNGTNRAIHVHQFG
DLSQGCDSTGPHYNPMSVPHPQHPGDFGNFAVRDGQVWKYRSGLAASLTGPHSIAGRAVV
VHAGEDDMGRGGNQASLENGNAGRRLACCVVGLCGPGPWARQTQEHAERKKRRRESECKA
V
Enzyme 34 Number of Residues 241
Enzyme 34 Molecular Weight 26176.4
Enzyme 34 Theoretical pI 7.09
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Inorganic ion transport and metabolism
Enzyme 34 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 34 Pathways Not Available
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • None
Enzyme 34 Transmembrane Regions
  • None
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 63034211 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID A3KLR9 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name A3KLR9_BOVIN Link Image
Enzyme 34 PDB ID Not Available
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >726 bp
ATGCTGGCGCTGCTCTGTGCCTCTGTGGTCCTGGTGGCCTATGCCTCGGCCGACCAGATC
CAGCAGCAGATGGGCTCCAACACGGAGGAGCAGATCCGCGACATGCACGCCAAGGTGACG
GAGATCTGGCAGGAGATGATGCAGCGGCAGGCGGCGGCCATCGACCCGGACGCGGCGCTC
CATGCCGTCTGCCGGGTGCTGCCGTCGGCCACGCTGGAGGCGGAGCAGCCCCGGGTCAGC
GGCCTCGTGCTCTTCCGGCAGCTCCGGCCTGGCGCCCTGCTGGAGGCCTTCTTCCACCTT
GAGGGCTTCCCGAACGAGCCCAACGGCACAAACCGTGCCATCCACGTGCACCAGTTTGGG
GACCTGAGCCAGGGCTGCGACTCCACCGGGCCGCACTACAACCCGATGTCCGTGCCGCAC
CCGCAGCACCCGGGCGACTTCGGCAACTTCGCCGTGCGCGATGGCCAGGTCTGGAAGTAC
CGCTCCGGCCTGGCTGCCTCGCTCACCGGCCCGCATTCGATCGCGGGCCGTGCCGTGGTG
GTCCACGCGGGCGAGGACGACATGGGCCGCGGCGGCAATCAGGCCAGTCTGGAGAACGGT
AACGCCGGCCGCCGGCTTGCCTGCTGCGTGGTGGGTCTGTGTGGCCCCGGGCCCTGGGCA
CGCCAAACGCAGGAGCACGCGGAGCGCAAGAAGCGGCGGCGCGAGAGCGAGTGTAAAGCC
GTCTGA
Enzyme 34 GenBank Gene ID AY957404 Link Image
Enzyme 34 GeneCard ID ECSOD Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Not Available
Enzyme 34 Locus Not Available
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References Not Available
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 590
Enzyme 35 Name Superoxide dismutase [Cu-Zn]
Enzyme 35 Synonyms Not Available
Enzyme 35 Gene Name Not Available
Enzyme 35 Protein Sequence >Superoxide dismutase [Cu-Zn]
VVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVT
ADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGV
IGIAK
Enzyme 35 Number of Residues 125
Enzyme 35 Molecular Weight 12926.3
Enzyme 35 Theoretical pI 6.13
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Inorganic ion transport and metabolism
Enzyme 35 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • None
Enzyme 35 Transmembrane Regions
  • None
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 28189795 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID Q861T4 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name Q861T4_BOVIN Link Image
Enzyme 35 PDB ID 1SXZ Link Image
Enzyme 35 PDB File Show
Enzyme 35 3D Structure
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence Not Available
Enzyme 35 GenBank Gene ID AB099022 Link Image
Enzyme 35 GeneCard ID Not Available
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Not Available
Enzyme 35 Locus Not Available
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References
  1. [PubMed Link Image]
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 591
Enzyme 36 Name Superoxide dismutase [Cu-Zn]
Enzyme 36 Synonyms Not Available
Enzyme 36 Gene Name SOD1
Enzyme 36 Protein Sequence >Superoxide dismutase [Cu-Zn]
MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAG
PHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHE
KPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Enzyme 36 Number of Residues 152
Enzyme 36 Molecular Weight 15682.5
Enzyme 36 Theoretical pI 6.30
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Inorganic ion transport and metabolism
Enzyme 36 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 36 Pathways Not Available
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein Not Available
Enzyme 36 UniProtKB/Swiss-Prot ID P00442 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name SODC_BOVIN Link Image
Enzyme 36 PDB ID 1SXZ Link Image
Enzyme 36 PDB File Show
Enzyme 36 3D Structure
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence Not Available
Enzyme 36 GenBank Gene ID X54799 Link Image
Enzyme 36 GeneCard ID SOD1 Link Image
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Chromosome:2
Enzyme 36 Locus 21q22.1|21q22.11
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References
  1. [PubMed Link Image]
Enzyme 36 Metabolite References Not Available
Enzyme 37 [top]
Enzyme 37 ID 592
Enzyme 37 Name Superoxide dismutase [Cu-Zn]
Enzyme 37 Synonyms Not Available
Enzyme 37 Gene Name Not Available
Enzyme 37 Protein Sequence >Superoxide dismutase [Cu-Zn]
AVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTHGGPKDEERHVGDLGNVTADKNGVAI
VDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNTGNAGSRLACGVIGIAK
Enzyme 37 Number of Residues 112
Enzyme 37 Molecular Weight 11343.8
Enzyme 37 Theoretical pI 5.54
Enzyme 37 GO Classification
Function
Process
Component
Enzyme 37 General Function Inorganic ion transport and metabolism
Enzyme 37 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 37 Pathways Not Available
Enzyme 37 Reactions Not Available
Enzyme 37 Pfam Domain Function
Enzyme 37 Signals
  • None
Enzyme 37 Transmembrane Regions
  • None
Enzyme 37 Essentiality Not Available
Enzyme 37 GenBank ID Protein Not Available
Enzyme 37 UniProtKB/Swiss-Prot ID Q9TS96 Link Image
Enzyme 37 UniProtKB/Swiss-Prot Entry Name Q9TS96_BOVIN Link Image
Enzyme 37 PDB ID Not Available
Enzyme 37 Cellular Location Not Available
Enzyme 37 Gene Sequence Not Available
Enzyme 37 GenBank Gene ID Not Available
Enzyme 37 GeneCard ID Not Available
Enzyme 37 GenAtlas ID Not Available
Enzyme 37 HGNC ID Not Available
Enzyme 37 Chromosome Location Not Available
Enzyme 37 Locus Not Available
Enzyme 37 SNPs SNPJam Report Link Image
Enzyme 37 General References
  1. [PubMed Link Image]
Enzyme 37 Metabolite References Not Available
Enzyme 38 [top]
Enzyme 38 ID 655
Enzyme 38 Name Dopamine beta-hydroxylase
Enzyme 38 Synonyms
  1. Dopamine beta-monooxygenase
  2. Soluble dopamine beta-hydroxylase
Enzyme 38 Gene Name DBH
Enzyme 38 Protein Sequence >Dopamine beta-hydroxylase
MQVPSPSVREAASMYGTAVAVFLVILVAALQGSAPAESPFPFHIPLDPEGTLELSWNISY
AQETIYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS
QQDYQLLRAQRTPEGLYLLFKRPFGTCDPNDYLIEDGTVHLVYGFLEEPLRSLESINTSG
LHTGLQRVQLLKPSIPKPALPADTRTMEIRAPDVLIPGQQTTYWCYVTELPDGFPRHHIV
MYEPIVTEGNEALVHHMEVFQCAAEFETIPHFSGPCDSKMKPQRLNFCRHVLAAWALGAK
AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVITGRRDSSGIRLYYTAALRRFDAGIMEL
GLAYTPVMAIPPQETAFVLTGYCTDKCTQLALPASGIHIFASQLHTHLTGRKVVTVLARD
GRETEIVNRDNHYSPHFQEIRMLKKVVSVQPGDVLITSCTYNTEDRRLATVGGFGILEEM
CVNYVHYYPQTQLELCKSAVDPGFLHKYFRLVNRFNSEEVCTCPQASVPEQFASVPWNSF
NREVLKALYGFAPISMHCNRSSAVRFQGEWNRQPLPEIVSRLEEPTPHCPASQAQSPAGP
TVLNISGGKG
Enzyme 38 Number of Residues 610
Enzyme 38 Molecular Weight 68140.2
Enzyme 38 Theoretical pI 6.23
Enzyme 38 GO Classification
Function
Process
Component
Enzyme 38 General Function Involved in copper ion binding
Enzyme 38 Specific Function Conversion of dopamine to noradrenaline
Enzyme 38 Pathways
  • Catecholamine biosynthesis
  • (R)-noradrenaline biosynthesis
  • (R)-noradrenaline from dopamine:step 1/1
Enzyme 38 Reactions Not Available
Enzyme 38 Pfam Domain Function
Enzyme 38 Signals
  • None
Enzyme 38 Transmembrane Regions
  • 10-30
Enzyme 38 Essentiality Not Available
Enzyme 38 GenBank ID Protein 162611 Link Image
Enzyme 38 UniProtKB/Swiss-Prot ID P15101 Link Image
Enzyme 38 UniProtKB/Swiss-Prot Entry Name DOPO_BOVIN Link Image
Enzyme 38 PDB ID Not Available
Enzyme 38 Cellular Location Not Available
Enzyme 38 Gene Sequence >1833 bp
ATGCAGGTCCCCAGCCCCAGCGTGCGCGAGGCGGCCTCCATGTACGGCACCGCGGTGGCC
GTCTTCCTGGTCATCCTCGTGGCTGCACTGCAGGGCTCGGCCCCCGCCGAGAGCCCCTTC
CCCTTCCACATCCCCCTGGACCCCGAGGGGACCCTGGAGCTGTCCTGGAACATCAGCTAT
GCGCAGGAGACCATCTACTTCCAGCTCCTGGTGCGGGAGCTCAAGGCTGGTGTCCTGTTT
GGGATGTCGGACCGAGGGGAGCTGGAGAATGCTGACTTGGTGGTGCTCTGGACTGACAGG
GACGGCGCCTACTTTGGGGATGCCTGGAGTGACCAGAAGGGGCAGGTCCACCTGGACTCC
CAGCAGGATTACCAGCTTCTGCGGGCACAGAGGACTCCAGAAGGCCTGTACCTGCTCTTC
AAGAGGCCTTTTGGCACCTGTGACCCCAACGACTACCTCATCGAGGACGGCACCGTCCAC
CTGGTGTATGGATTCCTGGAGGAGCCGCTCCGGTCGCTGGAGTCCATCAACACATCCGGC
TTGCACACGGGGCTGCAGAGGGTGCAGCTGCTGAAGCCCAGCATCCCGAAGCCGGCCCTG
CCCGCGGACACGTGCACCATGGAGATCCGCGCCCCCGACGTCCTCATCCCCGGCCAGCAG
ACCACGTACTGGTGCTACGTGACCGAGCTCCCGGACGGCTTCCCCCGGCACCACATCGTC
ATGTACGAGCCCATCGTCACCGAGGGCAACGAGGCGCTGGTGCACCACATGGAGGTCTTT
CAGTGCGCCGCCGAGTTTCGAGACCATCCCCACTTCAGCGGGCCCTGCGACTCCAAGATG
AAGCCGCAGCGGCTCAACTTCTGCCGTCACGTGCTGGCCGCCTGGGCCCTGGGCGCCAAG
GCCTTTTACTACCCAGAGGAAGCAGGCCTGGCCTTCGGGGGGCCCGGCTCCTCCAGATTT
CTCCGCCTGGAAGTTCACTACCACAACCCACTGGTGATAACAGGCCGGCGCGACTCCTCG
GGCATCCGCCTGTACTACACGGCTGCGCTGCGGCGCTTCGACGCGGGCATCATGGAGCTG
GGCCTGGCGTACACGCCCGTGATGGCCATCCCCCCGCAGGAGACGGCCTTCGTCCTCACC
GGCTACTGCACGGACAAGTGCACCCAGCTGGCCCTGCCCGCCTCAGGGATTCACATCTTC
GCCTCTCAGCTCCACACGCACCTGACCGGCCGGAAGGTGGTCACAGTGCTGGCCAGGGAC
GGCCGGGAGACAGAGATCGTGAACAGGGACAACCACTACAGCCCACACTTCCAGGAGATC
CGCATGTTGAAGAAGGTCGTGTCTGTCCAGCCGGGAGACGTGCTCATCACCTCTTGCACA
TACAACACGGAAGACAGGAGGCTGGCCACCGTGGGGGGCTTCGGGATCCTGGAGGAGATG
TGCGTCAACTATGTGCACTACTACCCCCAGACGCAGCTGGAGCTCTGCAAGAGCGCCGTG
GACCCTGGCTTCCTGCACAAGTACTTCCGCCTCGTGAACAGGTTCAACAGCGAGGAAGTC
TGCACCTGCCCCCAGGCGTCTGTCCCTGAGCAGTTTGCCTCCGTGCCCTGGAACTCCTTC
AACCGCGAGGTGCTCAAGGCCCTGTACGGCTTCGCACCCATCTCCATGCACTGCAACAGG
TCCTCGGCCGTCCGCTTCCAGGGCGAGTGGAATCGGCAGCCCCTGCCTGAGATCGTGTCC
AGGTTGGAAGAGCCCACCCCTCAGTGCCCAGCCAGCCAGGCTCAGAGCCCCGCCGGCCCC
ACCGTGCTGAACATCAGTGGGGGCAAAGGCTGA
Enzyme 38 GenBank Gene ID J02890 Link Image
Enzyme 38 GeneCard ID DBH Link Image
Enzyme 38 GenAtlas ID Not Available
Enzyme 38 HGNC ID Not Available
Enzyme 38 Chromosome Location Chromosome:9
Enzyme 38 Locus 9q34
Enzyme 38 SNPs SNPJam Report Link Image
Enzyme 38 General References
  1. [PubMed Link Image]
Enzyme 38 Metabolite References Not Available
Enzyme 39 [top]
Enzyme 39 ID 656
Enzyme 39 Name Cytochrome c oxidase subunit 2
Enzyme 39 Synonyms Not Available
Enzyme 39 Gene Name Not Available
Enzyme 39 Protein Sequence >Cytochrome c oxidase subunit 2
LPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSN
HSFMPIVLELVPLKY
Enzyme 39 Number of Residues 75
Enzyme 39 Molecular Weight 8324.7
Enzyme 39 Theoretical pI 6.50
Enzyme 39 GO Classification
Function
Process
Component
Enzyme 39 General Function Energy production and conversion
Enzyme 39 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 39 Pathways Not Available
Enzyme 39 Reactions Not Available
Enzyme 39 Pfam Domain Function
Enzyme 39 Signals
  • None
Enzyme 39 Transmembrane Regions
  • None
Enzyme 39 Essentiality Not Available
Enzyme 39 GenBank ID Protein 85812243 Link Image
Enzyme 39 UniProtKB/Swiss-Prot ID A1XEF0 Link Image
Enzyme 39 UniProtKB/Swiss-Prot Entry Name A1XEF0_BOVIN Link Image
Enzyme 39 PDB ID 1OCZ Link Image
Enzyme 39 PDB File Show
Enzyme 39 3D Structure
Enzyme 39 Cellular Location Not Available
Enzyme 39 Gene Sequence Not Available
Enzyme 39 GenBank Gene ID DQ347625 Link Image
Enzyme 39 GeneCard ID Not Available
Enzyme 39 GenAtlas ID Not Available
Enzyme 39 HGNC ID Not Available
Enzyme 39 Chromosome Location Not Available
Enzyme 39 Locus Not Available
Enzyme 39 SNPs SNPJam Report Link Image
Enzyme 39 General References Not Available
Enzyme 39 Metabolite References Not Available
Enzyme 40 [top]
Enzyme 40 ID 657
Enzyme 40 Name Cytochrome c oxidase subunit 2
Enzyme 40 Synonyms Not Available
Enzyme 40 Gene Name Not Available
Enzyme 40 Protein Sequence >Cytochrome c oxidase subunit 2
VLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGS
NHSFMPIVLELVPLK
Enzyme 40 Number of Residues 75
Enzyme 40 Molecular Weight 8260.6
Enzyme 40 Theoretical pI 6.50
Enzyme 40 GO Classification
Function
Process
Component
Enzyme 40 General Function Energy production and conversion
Enzyme 40 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 40 Pathways Not Available
Enzyme 40 Reactions Not Available
Enzyme 40 Pfam Domain Function
Enzyme 40 Signals
  • None
Enzyme 40 Transmembrane Regions
  • None
Enzyme 40 Essentiality Not Available
Enzyme 40 GenBank ID Protein 85812235 Link Image
Enzyme 40 UniProtKB/Swiss-Prot ID A1XEE6 Link Image
Enzyme 40 UniProtKB/Swiss-Prot Entry Name A1XEE6_BOVIN Link Image
Enzyme 40 PDB ID 1OCZ Link Image
Enzyme 40 PDB File Show
Enzyme 40 3D Structure
Enzyme 40 Cellular Location Not Available
Enzyme 40 Gene Sequence Not Available
Enzyme 40 GenBank Gene ID DQ347621 Link Image
Enzyme 40 GeneCard ID Not Available
Enzyme 40 GenAtlas ID Not Available
Enzyme 40 HGNC ID Not Available
Enzyme 40 Chromosome Location Not Available
Enzyme 40 Locus Not Available
Enzyme 40 SNPs SNPJam Report Link Image
Enzyme 40 General References Not Available
Enzyme 40 Metabolite References Not Available
Enzyme 41 [top]
Enzyme 41 ID 658
Enzyme 41 Name Lysyl oxidase homolog 1
Enzyme 41 Synonyms
  1. Lysyl oxidase-like protein 1
Enzyme 41 Gene Name LOXL1
Enzyme 41 Protein Sequence >Lysyl oxidase homolog 1
MALALTGWQLVWGACVCVLVHGQQAPPGQGSDPGRWRQLIQWENNGQVYSLLNSGAEYVP
PGPQGSEANSRVLLAGAPQAPPRRRGGLRRRQAPSLPLPGRVGSDTVRGQARHPFGFGQV
PDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASASAFASTYRQPSSFPQQQFPYPQ
APFVSQYETYDPSTRTYDQGYVYYRSASGGLGAAAVASAGVVYPFQPRARYEEYGGGGGE
EQPEYPPQGFYPAAPERPYAPQPADGLDRRYSHSLYHEGTAGLEPAYPDPGPDAAQPNGG
GGGGTYGGGGGDPRLGWYPPYGNMPPEAYSPPRVVEPQPPFRVLEPPYLPVRSSDAPPPG
SERNGAQQGRLSVGSVYRPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLA
STAYAPEATDYDVRVLLRFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMDEFSHYDL
LDAATGKKVAEGHKASFCLEDSTCDFGNLKRYACTSHTQGLSPGCYDTYNADIDCQWIDI
TDVQPGNYILKVHVNPKYIVLESDFTNNVVRCNIHYTGRYVSTTNCKIVQS
Enzyme 41 Number of Residues 591
Enzyme 41 Molecular Weight 64495.9
Enzyme 41 Theoretical pI 7.20
Enzyme 41 GO Classification
Function
Process
Component
Enzyme 41 General Function Involved in copper ion binding
Enzyme 41 Specific Function Active on elastin and collagen substrates
Enzyme 41 Pathways Not Available
Enzyme 41 Reactions Not Available
Enzyme 41 Pfam Domain Function
Enzyme 41 Signals
  • 1-22
Enzyme 41 Transmembrane Regions
  • None
Enzyme 41 Essentiality Not Available
Enzyme 41 GenBank ID Protein 16033743 Link Image
Enzyme 41 UniProtKB/Swiss-Prot ID Q95L39 Link Image
Enzyme 41 UniProtKB/Swiss-Prot Entry Name LOXL1_BOVIN Link Image
Enzyme 41 PDB ID Not Available
Enzyme 41 Cellular Location Not Available
Enzyme 41 Gene Sequence >1776 bp
ATGGCTCTGGCCCTAACTGGCTGGCAGCTGGTGTGGGGCGCCTGCGTCTGCGTCCTGGTG
CACGGGCAGCAGGCGCCGCCAGGGCAGGGCTCGGACCCGGGACGTTGGCGGCAGCTGATC
CAGTGGGAGAACAACGGGCAGGTGTACAGCCTGCTCAACTCGGGCGCGGAGTACGTGCCG
CCGGGGCCTCAGGGCTCCGAGGCTAATTCCCGGGTGCTGCTGGCGGGCGCGCCCCAGGCC
CCTCCGCGGCGCCGGGGGGGCCTCCGGCGTCGGCAGGCCCCGTCCCTGCCCCTGCCCGGG
CGCGTCGGCTCGGACACCGTGCGCGGCCAGGCGCGGCACCCCTTCGGCTTCGGCCAGGTG
CCCGACAACTGGCGCGAGGTGGCCGTCGGGGACAGCACGGGCATGGCCCGGGCCCGCACC
TCCGTCTCCCAGCAACGGCACGGGGGCTCCGCCTCCTCGGTCTCGGCCTCTGCCTCTGCC
TTCGCCAGCACCTACCGCCAGCCGTCCTCCTTCCCGCAGCAGCAGTTCCCCTACCCACAG
GCGCCCTTCGTCAGCCAGTACGAGACGTACGACCCCTCGACGCGGACCTACGACCAGGGC
TACGTGTACTACCGCAGCGCGAGCGGCGGCCTGGGCGCGGCGGCCGTGGCCTCGGCGGGG
GTCGTCTACCCCTTCCAGCCGCGGGCGCGCTACGAGGAGTACGGAGGTGGCGGCGGCGAG
GAGCAGCCCGAGTACCCGCCGCAGGGCTTCTATCCGGCCGCCCCGGAGAGGCCGTACGCG
CCGCAGCCCGCCGACGGCCTGGACCGGCGCTACTCGCACAGCCTGTACCACGAGGGCACC
GCGGGCCTCGAGCCGGCCTACCCCGACCCGGGCCCCGACGCTGCGCAGCCCAACGGCGGC
GGGGGCGGCGGCACATACGGCGGCGGCGGGGGCGACCCCCGCCTCGGCTGGTACCCACCC
TATGGCAACATGCCGCCCGAGGCCTACAGCCCGCCGCGGGTCGTGGAGCCGCAGCCCCCC
TTCCGCGTGCTGGAGCCTCCCTACCTGCCGGTGCGCAGCTCCGACGCGCCCCCGCCGGGC
TCCGAGCGCAACGGCGCGCAGCAGGGCCGCCTGAGCGTGGGCAGCGTGTACCGGCCCAAC
CAGAACGGTCGAGGTCTCCCTGACTTGGTCCCAGACCCCAACTACGTGCAAGCGTCCACT
TACGTCCAGAGAGCCCACCTGTACTCCCTGCGCTGTGCTGCGGAGGAGAAGTGCCTGGCC
AGCACAGCCTACGCCCCTGAGGCCACCGACTACGACGTGCGCGTGCTGCTGCGTTTCCCC
CAGCGTGTGAAGAACCAGGGCACAGCGGACTTCCTCCCGAACCGGCCACGGCATACCTGG
GAGTGGCACAGCTGCCACCAGCACTACCACAGCATGGATGAGTTCAGCCACTACGACCTG
CTGGACGCAGCCACGGGCAAGAAGGTGGCCGAGGGCCACAAGGCCAGCTTCTGCCTGGAG
GACAGCACCTGCGACTTCGGCAACCTCAAGCGCTACGCCTGCACCTCGCACACCCAGGGC
CTGAGCCCAGGCTGCTATGACACATACAACGCAGACATCGATTGCCAGTGGATTGACATC
ACCGACGTACAGCCCGGGAACTACATCCTCAAGGTGCATGTGAACCCAAAGTACATCGTT
TTGGAGTCTGACTTCACCAACAATGTCGTGAGATGCAACATCCATTATACAGGTCGCTAC
GTTTCTACAACAAACTGCAAAATTGTCCAATCCTGA
Enzyme 41 GenBank Gene ID AF421185 Link Image
Enzyme 41 GeneCard ID LOXL1 Link Image
Enzyme 41 GenAtlas ID Not Available
Enzyme 41 HGNC ID Not Available
Enzyme 41 Chromosome Location Chromosome:1
Enzyme 41 Locus 15q24-q25|15q22
Enzyme 41 SNPs SNPJam Report Link Image
Enzyme 41 General References
  1. [PubMed Link Image]
Enzyme 41 Metabolite References Not Available
Enzyme 42 [top]
Enzyme 42 ID 659
Enzyme 42 Name Protein-lysine 6-oxidase
Enzyme 42 Synonyms
  1. Lysyl oxidase
Enzyme 42 Gene Name LOX
Enzyme 42 Protein Sequence >Protein-lysine 6-oxidase
MRFAWTALLGSLQLCALVRCAPPAASHRQPPREQAAAPGAWRQKIQWENNGQVFSLLSLG
SQYQPQRRRDPGATAPGAANATAPQMRTPILLLRNNRTAAARVRTAGPSAAAAGRPRPAA
RHWFQAGYSTSGAHDAGTSRADNQTAPGEVPTLSNLRPPNRVEVDGMVGDDPYNPYKYTD
DNPYYNYYDTYERPRPGSRYRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMAMYNLRCA
AEENCLASSAYRXDVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMD
EFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYNADI
DCQWIDITDVKPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY
Enzyme 42 Number of Residues 418
Enzyme 42 Molecular Weight 47060.8
Enzyme 42 Theoretical pI 8.27
Enzyme 42 GO Classification
Function
Process
Component
Enzyme 42 General Function Involved in copper ion binding
Enzyme 42 Specific Function Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin
Enzyme 42 Pathways Not Available
Enzyme 42 Reactions Not Available
Enzyme 42 Pfam Domain Function
Enzyme 42 Signals
  • 1-20
Enzyme 42 Transmembrane Regions
  • None
Enzyme 42 Essentiality Not Available
Enzyme 42 GenBank ID Protein 16033746 Link Image
Enzyme 42 UniProtKB/Swiss-Prot ID P33072 Link Image
Enzyme 42 UniProtKB/Swiss-Prot Entry Name LYOX_BOVIN Link Image
Enzyme 42 PDB ID Not Available
Enzyme 42 Cellular Location Not Available
Enzyme 42 Gene Sequence >1257 bp
ATGCGCTTCGCCTGGACCGCACTCCTCGGGTCGCTGCAGCTCTGCGCACTCGTGCGCTGC
GCCCCGCCGGCCGCCAGCCACCGGCAGCCCCCTCGCGAACAGGCGGCGGCTCCCGGCGCC
TGGCGCCAGAAGATCCAATGGGAGAACAACGGGCAGGTGTTCAGCCTGCTGAGCCTGGGC
TCACAGTACCAGCCGCAACGGCGACGGGACCCCGGCGCCACCGCCCCGGGGGCCGCCAAC
GCCACTGCCCCACAGATGCGCACACCAATCCTGCTGCTCCGCAACAACCGCACCGCGGCG
GCGCGAGTGCGGACGGCCGGCCCCTCTGCGGCCGCAGCTGGCCGCCCCAGGCCCGCCGCC
CGCCACTGGTTCCAAGCTGGCTACTCGACGTCCGGGGCCCACGACGCTGGGACCTCGCGC
GCTGATAACCAGACGGCACCGGGAGAGGTCCCGACGCTCAGTAACCTGCGACCGCCCAAC
CGCGTGGAAGTGGACGGCATGGTGGGCGACGACCCGTACAACCCCTATAAGTACACCGAC
GACAACCCCTATTACAACTATTACGACACGTACGAAAGGCCCAGGCCTGGGAGCAGGTAC
CGGCCCGGATACGGCACCGGCTACTTCCAGTATGGTCTTCCGGACCTGGTGCCCGATCCC
TACTACATCCAGGCGTCCACATACGTGCAAAAGATGGCCATGTACAACCTTAGATGCGCT
GCGGAGGAAAACTGCTTGGCCAGCTCAGCATACAGGGNGGATGTCAGAGATTATGATCAC
AGGGTGCTGCTAAGATTTCCCCAGAGAGTGAAAAACCAAGGGACATCTGATTTCCTACCA
AGTCGACCAAGATATTCCTGGGAATGGCACAGTTGTCACCAGCATTACCACAGCATGGAT
GAATTCAGCCACTATGACCTGCTTGATGCCAGCACCCAGAGGAGAGTGGCTGAGGGCCAT
AAAGCGAGTTTCTGTCTTGAGGACACATCGTGCGACTACGGCTACCACAGGCGATTTGCA
TGTACTGCACACACACAGGGCTTGAGTCCTGGCTGCTATGATACCTATAATGCAGACATA
GACTGCCAATGGATTGATATCACTGATGTCAAACCTGGAAACTATATTCTCAAGGTCAGT
GTGAATCCCAGCTATTTGGTGCCTGAGTCGGATTATTCCAACAATGTCGTCCGCTGTGAA
ATTCGCTACACAGGACATCACGCATATGCCTCGGGCTGCACAATTTCACCGTATTAG
Enzyme 42 GenBank Gene ID AF421186 Link Image
Enzyme 42 GeneCard ID LOX Link Image
Enzyme 42 GenAtlas ID Not Available
Enzyme 42 HGNC ID Not Available
Enzyme 42 Chromosome Location Chromosome:5
Enzyme 42 Locus 5q23.2
Enzyme 42 SNPs SNPJam Report Link Image
Enzyme 42 General References
  1. [PubMed Link Image]
Enzyme 42 Metabolite References Not Available
Enzyme 43 [top]
Enzyme 43 ID 660
Enzyme 43 Name Lysyl oxidase homolog 4
Enzyme 43 Synonyms
  1. Lysyl oxidase-like protein 4
Enzyme 43 Gene Name LOXL4
Enzyme 43 Protein Sequence >Lysyl oxidase homolog 4
MWFLPAALPLLPLLLLLGQAPPSRPQSLGTMKLRLVGPGSGPEEGRLEVLHQGQWGTVCD
DDFALQEATVACRQLGFEGALTWAHSAKYGSGEGPIWLDNVHCVGTESSLDQCGSNGWGV
SDCTHSEDVGVVCNPQRHRGSVSERVSNALGPQDRRLEEVRLKPILASAKRQSPVTEGAV
EVKYEGHWRQVCDQGWTRNNSRVVCGMLGFPSEAPVDSHHYRKVWDSKMKDPNSRLKSLT
KKNSFWIHRVNCLGTEPHMANCQVQVAPAQGKLRPACPGGMHAVVSCVAGPRFRPPKAKP
GRKESRAEEMKVRLRSGAQVGEGRVEVLMNRQWGTVCDHGWNLISASVVCRQLGFGSARE
ALFGAQLGQALGPIHLSEVRCRGYERTLSDCPSLEGSQNGCQHDNDAAVRCNIPNMGFQD
QVRLAGGRSPEEGVVEVQVEVNGVQRWGAVCSDHWGLSEAMVACRQLGLGFASHAIKDTW
YWQGTPGAREVVMSGVHCSGTELALQQCQRHGPVHCSHGTGRFSAGVSCTDSAPDLVMNA
QLVQETAYLEDRPLSLLYCAHEENCLSQSADRMDWPYGHRRLLRFSSQIHNLGRADFRPK
MGRHGWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGMQRRYACA
NFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVNPKFEVAESDFSNNMMRCRC
KYDGQRVWLHNCHTGDSYRANTELSQEQEQRLRNNLI
Enzyme 43 Number of Residues 757
Enzyme 43 Molecular Weight 84049.4
Enzyme 43 Theoretical pI 7.33
Enzyme 43 GO Classification
Function
Process
Component
Enzyme 43 General Function Involved in copper ion binding
Enzyme 43 Specific Function May modulate the formation of a collagenous extracellular matrix
Enzyme 43 Pathways Not Available
Enzyme 43 Reactions Not Available
Enzyme 43 Pfam Domain Function
Enzyme 43 Signals
  • 1-25
Enzyme 43 Transmembrane Regions
  • None
Enzyme 43 Essentiality Not Available
Enzyme 43 GenBank ID Protein 22208523 Link Image
Enzyme 43 UniProtKB/Swiss-Prot ID Q8MJ24 Link Image
Enzyme 43 UniProtKB/Swiss-Prot Entry Name LOXL4_BOVIN Link Image
Enzyme 43 PDB ID Not Available
Enzyme 43 Cellular Location Not Available
Enzyme 43 Gene Sequence >2274 bp
ATGTGGTTCCTACCAGCCGCCCTCCCCCTGCTCCCGTTGCTCCTGCTGCTGGGCCAGGCC
CCTCCCAGCAGGCCACAGTCACTGGGCACCATGAAGCTACGGTTGGTGGGTCCTGGCAGC
GGGCCGGAGGAGGGCCGCCTGGAGGTGCTGCACCAGGGCCAGTGGGGCACTGTGTGTGAT
GACGATTTCGCCCTTCAGGAGGCCACAGTGGCCTGCCGCCAGCTAGGCTTTGAGGGTGCC
TTGACCTGGGCCCACAGCGCCAAGTATGGCTCAGGGGAGGGACCCATCTGGCTGGACAAT
GTGCACTGTGTGGGCACCGAGAGCTCCCTGGACCAGTGTGGGTCTAACGGCTGGGGTGTC
AGTGACTGCACTCACTCAGAGGACGTCGGGGTGGTATGCAATCCCCAGCGCCACCGTGGC
TCCGTTTCTGAGAGGGTCTCCAATGCCCTCGGGCCCCAGGACCGGCGGCTGGAGGAGGTG
CGGCTCAAGCCCATCCTCGCCAGCGCCAAGCGGCAGAGCCCGGTGACCGAGGGAGCCGTG
GAGGTGAAGTACGAGGGCCACTGGCGGCAGGTGTGTGACCAGGGCTGGACCAGGAACAAC
AGCAGGGTGGTGTGCGGCATGCTGGGCTTCCCCAGCGAGGCACCTGTCGACAGCCACCAC
TACAGGAAAGTCTGGGATTCAAAGATGAAGGACCCCAACTCTAGACTGAAGAGCCTAACG
AAGAAGAATTCCTTCTGGATCCACCGTGTCAACTGCCTGGGCACAGAGCCCCACATGGCC
AACTGCCAGGTGCAGGTGGCGCCAGCCCAGGGCAAGCTGCGGCCAGCCTGCCCGGGTGGC
ATGCATGCTGTGGTCAGCTGTGTGGCAGGGCCCCGCTTCCGTCCTCCGAAGGCGAAGCCA
GGGCGCAAGGAGTCCAGGGCAGAGGAGATGAAGGTGCGCCTCCGCTCGGGGGCCCAGGTG
GGCGAGGGCCGGGTGGAGGTGCTCATGAACCGCCAGTGGGGCACCGTCTGTGACCATGGA
TGGAACCTCATCTCCGCAAGCGTCGTGTGCCGCCAACTCGGCTTCGGCTCTGCTCGGGAG
GCCCTCTTTGGGGCCCAGCTGGGCCAGGCGCTGGGGCCCATCCACCTGAGTGAAGTACGC
TGCAGGGGATATGAGCGGACCCTCAGCGATTGCCCTTCCCTGGAAGGCTCCCAGAATGGT
TGCCAACATGACAATGATGCTGCCGTGAGATGCAACATCCCTAACATGGGCTTCCAGGAC
CAGGTGCGTCTGGCTGGTGGGCGCAGCCCCGAGGAGGGGGTGGTGGAGGTGCAGGTGGAG
GTGAACGGCGTCCAGCGCTGGGGGGCCGTGTGCAGTGACCACTGGGGCCTCAGCGAAGCC
ATGGTGGCCTGTCGACAGCTTGGCCTGGGCTTTGCCAGCCATGCCATCAAGGACACCTGG
TACTGGCAGGGGACGCCGGGAGCCAGAGAAGTGGTCATGAGCGGGGTGCATTGCTCAGGC
ACAGAGCTGGCCCTGCAGCAGTGTCAGAGGCACGGGCCAGTGCACTGCTCCCACGGCACG
GGGCGCTTCTCAGCCGGAGTCTCCTGCACAGACAGTGCCCCAGACCTCGTGATGAACGCC
CAGCTGGTACAGGAGACGGCGTACCTGGAGGACCGCCCGCTCAGCCTGCTGTACTGCGCC
CACGAAGAGAACTGCCTGTCTCAGTCCGCTGACCGCATGGACTGGCCCTACGGACACCGG
CGTCTGCTGCGCTTCTCCTCACAGATCCACAACCTGGGCCGGGCCGACTTCCGTCCCAAG
ATGGGGCGCCACGGCTGGATTTGGCACCAGTGCCACAGGCACTACCACAGCATTGAGGTC
TTCACCCACTACGACCTCCTCACTCTCAACGGCTCCAAGGTGGCTGAGGGGCACAAGGCC
AGCTTCTGCCTAGAGGACACAAACTGCCCCACAGGAATGCAAAGGCGCTATGCGTGTGCC
AACTTTGGGGAACAGGGAGTGACCGTTGGCTGCTGGGATACCTACCGACATGACATTGAT
TGCCAGTGGGTGGATATCACCGATGTGGGCCCTGGGGATTACATCTTCCAGGTGGTCGTG
AACCCCAAGTTCGAGGTGGCAGAGTCAGATTTCTCAAACAACATGATGCGGTGCCGCTGC
AAGTACGACGGGCAACGGGTCTGGCTGCACAACTGCCACACAGGGGACTCATACCGAGCT
AACACAGAGCTGTCCCAGGAGCAGGAGCAGCGTCTCAGGAACAACCTCATCTGA
Enzyme 43 GenBank Gene ID AF529202 Link Image
Enzyme 43 GeneCard ID LOXL4 Link Image
Enzyme 43 GenAtlas ID Not Available
Enzyme 43 HGNC ID Not Available
Enzyme 43 Chromosome Location Chromosome:1
Enzyme 43 Locus 10q24
Enzyme 43 SNPs SNPJam Report Link Image
Enzyme 43 General References Not Available
Enzyme 43 Metabolite References Not Available
Enzyme 44 [top]
Enzyme 44 ID 661
Enzyme 44 Name Cytochrome c oxidase assembly protein COX11, mitochondrial
Enzyme 44 Synonyms Not Available
Enzyme 44 Gene Name COX11
Enzyme 44 Protein Sequence >Cytochrome c oxidase assembly protein COX11, mitochondrial
MGGLWRPAWRRVVFCGWSWSHLGRPTRAAERAEPCLRPGRSGPAGTEQGLRRLGTWRRPS
PAEQPARRPKSTNPYTRSQEEDWRRRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTG
LGGSAVAGHASDQIENMVPVKDRIIKITFNADVHASLQWNFRPQQTEIYVVPGETALAFY
KAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAE
DPRMVNVDLITLSYTFFEAKEGHTLPVPGYNSNQQLSPASNL
Enzyme 44 Number of Residues 282
Enzyme 44 Molecular Weight 31823.9
Enzyme 44 Theoretical pI 8.89
Enzyme 44 GO Classification
Function
Process
Component
Enzyme 44 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 44 Specific Function Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I
Enzyme 44 Pathways Not Available
Enzyme 44 Reactions Not Available
Enzyme 44 Pfam Domain Function
Enzyme 44 Signals
  • None
Enzyme 44 Transmembrane Regions
  • 91-109
Enzyme 44 Essentiality Not Available
Enzyme 44 GenBank ID Protein 126717455 Link Image
Enzyme 44 UniProtKB/Swiss-Prot ID A3KMZ6 Link Image
Enzyme 44 UniProtKB/Swiss-Prot Entry Name COX11_BOVIN Link Image
Enzyme 44 PDB ID Not Available
Enzyme 44 Cellular Location Not Available
Enzyme 44 Gene Sequence >849 bp
ATGGGAGGGCTCTGGCGTCCGGCTTGGAGACGCGTCGTTTTCTGCGGGTGGTCTTGGAGC
CACCTTGGGCGCCCAACCCGGGCTGCTGAGAGGGCAGAGCCGTGTCTCCGGCCGGGGAGG
AGCGGGCCGGCGGGTACTGAGCAGGGGCTGAGGCGGCTTGGGACATGGAGGCGCCCGAGC
CCGGCGGAGCAGCCGGCTCGGCGGCCGAAGAGCACGAACCCCTACACGCGCTCGCAGGAG
GAGGACTGGCGGCGGCGGAACAAGACGGTCCTCACCTACATGGCCGCGGCGGCGGTGGGC
ATGCTGGGCGCGTCCTACGCCGCCGTGCCCCTTTACCGGCTCTACTGCCAGACTACTGGA
CTTGGAGGATCAGCAGTAGCAGGTCATGCGTCAGACCAGATTGAAAACATGGTACCTGTT
AAGGATCGCATCATTAAAATCACCTTTAATGCAGATGTGCATGCAAGTCTCCAGTGGAAC
TTTAGACCTCAGCAAACAGAAATATATGTAGTGCCAGGAGAGACAGCACTGGCGTTTTAT
AAAGCTAAGAATCCTACTGACAAACCAGTAATCGGAATTTCTACATACAATGTTGTACCA
TTTGAAGCTGGACAGTACTTCAATAAAATACAGTGCTTCTGCTTTGAAGAACAAAGGCTT
AATCCACAAGAGGAAGTAGATATGCCAGTATTTTTCTACATAGATCCTGAATTTGCTGAA
GATCCAAGAATGGTGAATGTTGATCTCATCACTCTTTCTTACACTTTTTTTGAAGCAAAG
GAGGGGCATACGTTGCCAGTCCCAGGCTATAATTCAAATCAGCAACTAAGTCCTGCTTCA
AATTTGTGA
Enzyme 44 GenBank Gene ID BC133444 Link Image
Enzyme 44 GeneCard ID COX11 Link Image
Enzyme 44 GenAtlas ID Not Available
Enzyme 44 HGNC ID Not Available
Enzyme 44 Chromosome Location Chromosome:1
Enzyme 44 Locus 17q22
Enzyme 44 SNPs SNPJam Report Link Image
Enzyme 44 General References Not Available
Enzyme 44 Metabolite References Not Available
Enzyme 45 [top]
Enzyme 45 ID 662
Enzyme 45 Name Tyrosinase
Enzyme 45 Synonyms
  1. Monophenol monooxygenase
Enzyme 45 Gene Name TYR
Enzyme 45 Protein Sequence >Tyrosinase
MLLAALYCLLWSFRTSAGHFPRACASSKSLTEKECCPPWAGDGSPCGRLSGRGSCQDVIL
STAPLGPQFPFTGVDDRESWPSIFYNRTCQCFSNFMGFNCGSCKFGFRGPRCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNHGTTPLFNDVSVYDLFVWMH
YYVSRDTLLGDSEVWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AENCDVCTDEYMGGRNPANPNLLSPASFFSSWQIVCSRLEEYNSRQALCNGTSEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFADPVTGIADASQS
SMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRKYHPLQDVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDXGYDYSYLQDSEPDIFQDYIKPYLEQAQRIWPWLIG
AAVVGSVLTAVLGGLTSLLCRRKRNQLPEEKQPLLMEKEDYHNLMYQSHL
Enzyme 45 Number of Residues 530
Enzyme 45 Molecular Weight 60249.4
Enzyme 45 Theoretical pI 5.71
Enzyme 45 GO Classification
Function
Process
Component
Enzyme 45 General Function Involved in copper ion binding
Enzyme 45 Specific Function This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone
Enzyme 45 Pathways Not Available
Enzyme 45 Reactions Not Available
Enzyme 45 Pfam Domain Function
Enzyme 45 Signals
  • 1-17
Enzyme 45 Transmembrane Regions
  • 474-494
Enzyme 45 Essentiality Not Available
Enzyme 45 GenBank ID Protein 25990265 Link Image
Enzyme 45 UniProtKB/Swiss-Prot ID Q8MIU0 Link Image
Enzyme 45 UniProtKB/Swiss-Prot Entry Name TYRO_BOVIN Link Image
Enzyme 45 PDB ID Not Available
Enzyme 45 Cellular Location Not Available
Enzyme 45 Gene Sequence >1593 bp
ATGCTCCTGGCTGCCCTGTACTGCCTACTGTGGAGTTTCCGAACCTCCGCTGGCCACTTC
CCTCGAGCCTGTGCCTCCTCCAAGAGCCTGACGGAGAAGGAGTGCTGCCCGCCCTGGGCG
GGCGATGGGAGCCCCTGTGGCCGGCTCTCAGGCAGGGGCTCCTGCCAGGACGTCATTCTG
TCCACGGCACCACTCGGACCTCAGTTCCCCTTCACGGGGGTGGACGACCGCGAGTCTTGG
CCCTCCATCTTTTATAACAGAACCTGCCAGTGCTTTAGCAACTTCATGGGATTCAATTGC
GGAAGTTGTAAGTTTGGATTTAGGGGACCCCGCTGCACAGAAAGGCGACTTTTGGTGAGA
AGAAACATCTTTGATTTGAGTGTCCCAGAGAAGAACAAGTTTCTTGCCTATCTCACTTTG
GCAAAACATACCACCAGCCCAGACTACGTCATCCCCACGGGCACCTATGGCCAAATGAAT
CATGGAACAACACCCCTGTTTAATGACGTCAGTGTTTACGACCTCTTTGTCTGGATGCAT
TATTATGTGTCAAGGGACACGCTGCTTGGGGACTCTGAAGTCTGGAGAGACATTGATTTT
GCTCATGAAGCCCCAGGTTTCCTGCCTTGGCATAGACTCTTCCTGCTGCTGTGGGAACAG
GAAATCCAGAAGCTGACCGGGGATGAGAACTTCACGATTCCATACTGGGACTGGAGAGAT
GCAGAAAACTGTGACGTTTGCACAGATGAGTACATGGGAGGGCGCAACCCTGCAAACCCT
AATCTACTCAGCCCAGCATCCTTCTTCTCCTCTTGGCAGATCGTCTGCAGCAGACTGGAG
GAGTACAACAGTCGCCAGGCTTTATGCAACGGGACGTCTGAGGGACCATTACTGCGCAAT
CCTGGAAACCACGACAAAGCCAGGACCCCGAGGCTCCCCTCCTCGGCTGATGTGGAGTTT
TGCCTGAGTTTGACCCAGTATGAATCAGGTTCCATGGATAAAGCTGCCAATTTCAGCTTT
AGAAATACCCTGGAAGGATTTGCTGATCCAGTTACTGGGATAGCAGATGCCTCTCAAAGC
AGTATGCACAATGCCTTGCACATCTACATGAACGGAACGATGTCTCAGGTACCAGGATCT
GCCAATGATCCCATCTTCCTTCTTCATCACGCGTTTGTTGACAGTATTTTTGAACAGTGG
CTTCGAAAGTATCATCCTCTTCAAGATGTTTATCCAGAAGCTAATGCACCCATTGGGCAC
AACCGGGAATCCTACATGGTTCCTTTCATCCCTCTCTACAGAAACGGTGACTTCTTTATT
TCATCCAAAGATNTAGGCTACGACTATAGCTACCTACAAGATTCAGAACCGGACATTTTT
CAAGATTACATTAAGCCCTACTTAGAACAAGCGCAACGAATCTGGCCGTGGCTCATTGGG
GCAGCTGTGGTTGGGTCCGTCCTTACTGCTGTGCTGGGAGGACTTACTAGCCTGTTATGT
CGTCGAAAGAGAAACCAGCTTCCAGAAGAAAAGCAGCCCCTGCTCATGGAAAAAGAGGAT
TACCACAATTTGATGTATCAGAGCCATTTATGA
Enzyme 45 GenBank Gene ID AY046527 Link Image
Enzyme 45 GeneCard ID TYR Link Image
Enzyme 45 GenAtlas ID Not Available
Enzyme 45 HGNC ID Not Available
Enzyme 45 Chromosome Location Chromosome:1
Enzyme 45 Locus 11q14-q21
Enzyme 45 SNPs SNPJam Report Link Image
Enzyme 45 General References
  1. [PubMed Link Image]
Enzyme 45 Metabolite References Not Available
Enzyme 46 [top]
Enzyme 46 ID 663
Enzyme 46 Name Cytochrome c oxidase subunit 2
Enzyme 46 Synonyms Not Available
Enzyme 46 Gene Name Not Available
Enzyme 46 Protein Sequence >Cytochrome c oxidase subunit 2
PMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNH
SFMPIVLELVPLK
Enzyme 46 Number of Residues 73
Enzyme 46 Molecular Weight 8048.4
Enzyme 46 Theoretical pI 6.50
Enzyme 46 GO Classification
Function
Process
Component
Enzyme 46 General Function Energy production and conversion
Enzyme 46 Specific Function Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1
Enzyme 46 Pathways Not Available
Enzyme 46 Reactions Not Available
Enzyme 46 Pfam Domain Function
Enzyme 46 Signals
  • None
Enzyme 46 Transmembrane Regions
  • None
Enzyme 46 Essentiality Not Available
Enzyme 46 GenBank ID Protein 85812241 Link Image
Enzyme 46 UniProtKB/Swiss-Prot ID A1XEE9 Link Image
Enzyme 46 UniProtKB/Swiss-Prot Entry Name A1XEE9_BOVIN Link Image
Enzyme 46 PDB ID 1OCZ Link Image
Enzyme 46 PDB File Show
Enzyme 46 3D Structure
Enzyme 46 Cellular Location Not Available
Enzyme 46 Gene Sequence Not Available
Enzyme 46 GenBank Gene ID DQ347624 Link Image
Enzyme 46 GeneCard ID Not Available
Enzyme 46 GenAtlas ID Not Available
Enzyme 46 HGNC ID Not Available
Enzyme 46 Chromosome Location Not Available
Enzyme 46 Locus Not Available
Enzyme 46 SNPs SNPJam Report Link Image
Enzyme 46 General References Not Available
Enzyme 46 Metabolite References Not Available
Enzyme 47 [top]
Enzyme 47 ID 664
Enzyme 47 Name 5,6-dihydroxyindole-2-carboxylic acid oxidase
Enzyme 47 Synonyms
  1. DHICA oxidase
  2. Tyrosinase-related protein 1
  3. TRP-1
  4. TRP1
Enzyme 47 Gene Name TYRP1
Enzyme 47 Protein Sequence >5,6-dihydroxyindole-2-carboxylic acid oxidase
MKSPTLLSLGYMFLVLLFFQQAWAQFPRECATIEALRNGVCCPDLSPLSGPGSDRCGLSS
GRGRCEVVIADSRPHSHHYPHDGRDDREGWPTRSFNRTCHCNGNFSGHNCGTCRPGWGGA
ACDQRVLTVRRNLLDLSTEEKNRFVRALDMAKRTTHPQFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGAGQESFGEVDFSHEGPAFLTWHRYHLLQLERDMQEMLQ
DPSFSLPYWNFATGKNTCDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCESLEDYDTLG
TLCNSTEGGPIKRNPAGNVARPMVQRLPKPQDVAQCLEVGSYDTPPFYSNSTNSFRNTVE
GYSHPTGRYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
DISTYPLENAPIGHNRQYNMVPFWPPVTNIEMFVTAPDNLGYTYEVQWPSRSFSISEIVT
IAVVAALSLVAVIFAGASCLIRARSNMDEANQPLLTDQYQHYIEEYEKIHNPNQSVV
Enzyme 47 Number of Residues 537
Enzyme 47 Molecular Weight 60616.4
Enzyme 47 Theoretical pI 6.19
Enzyme 47 GO Classification
Function
Process
Component
Enzyme 47 General Function Involved in copper ion binding
Enzyme 47 Specific Function Oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. May regulate or influence the type of melanin synthesized
Enzyme 47 Pathways
  • Pigment biosynthesis
  • melanin biosynthesis
Enzyme 47 Reactions Not Available
Enzyme 47 Pfam Domain Function
Enzyme 47 Signals
  • 1-24
Enzyme 47 Transmembrane Regions
  • 478-501
Enzyme 47 Essentiality Not Available
Enzyme 47 GenBank ID Protein 29835128 Link Image
Enzyme 47 UniProtKB/Swiss-Prot ID Q8WN57 Link Image
Enzyme 47 UniProtKB/Swiss-Prot Entry Name TYRP1_BOVIN Link Image
Enzyme 47 PDB ID Not Available
Enzyme 47 Cellular Location Not Available
Enzyme 47 Gene Sequence >1614 bp
ATGAAATCTCCTACACTCCTCTCTCTGGGTTACATGTTCCTAGTCCTGCTTTTTTTCCAG
CAGGCCTGGGCTCAGTTCCCAAGAGAGTGTGCTACCATTGAGGCTTTGAGGAATGGCGTG
TGTTGCCCAGACCTGTCCCCACTGTCTGGGCCTGGGTCTGACCGCTGCGGTCTCTCATCA
GGGAGGGGCAGATGTGAGGTGGTGATAGCCGACTCCCGGCCCCACAGCCACCACTACCCG
CACGATGGCAGAGATGACCGAGAGGGCTGGCCCACACGCTCCTTCAACAGGACATGCCAC
TGCAATGGCAATTTCTCAGGACACAACTGTGGAACCTGCCGCCCTGGCTGGGGAGGGGCT
GCCTGTGACCAGAGGGTTCTCACAGTCAGGAGAAACCTTCTGGACTTAAGCACAGAAGAA
AAGAACCGCTTTGTCCGGGCCCTGGATATGGCAAAGCGCACCACTCACCCTCAGTTTGTC
ATTGCCACAAGGAGGTCAGAAGAAATACTGGGGCCAGATGGCAACACACCGCAGTTTGAG
AACATTTCCATTTATAACTACTTCGTTTGGACACACTACTACTCAGTCAAAAAGACTTTC
TTGGGAGCAGGACAGGAAAGCTTTGGTGAGGTGGATTTCTCTCACGAGGGACCAGCATTT
CTCACCTGGCACAGGTACCACCTGCTGCAGCTGGAGAGAGACATGCAGGAAATGTTGCAG
GATCCTTCTTTCTCCCTCCCTTACTGGAATTTTGCCACTGGGAAGAACACCTGCGACATT
TGCACCGATGACTTGATGGGATCAAGAAGCAACTTTGATTCCACTCTTATAAGCCCGAAC
TCTGTCTTTTCTCAATGGCGAGTGGTCTGCGAATCCTTGGAAGATTATGATACCCTGGGA
ACCCTTTGCAACAGCACTGAGGGTGGGCCAATTAAGAGAAACCCAGCTGGAAATGTGGCC
AGGCCAATGGTGCAACGTCTTCCTAAACCACAGGATGTCGCGCAGTGCTTGGAAGTTGGT
TCATATGACACACCTCCTTTTTATTCTAATTCTACAAACAGCTTCCGAAACACAGTGGAA
GGTTACAGTCATCCCACAGGAAGGTATGACCCTGCTGTGCGAAGCCTTCACAATTTGGCT
CATCTATTCCTGAATGGAACAGGGGGACAAACTCATTTATCTCCCAATGATCCTATTTTT
GTCCTCCTACATACATTCACTGATGCAGTATTTGATGAATGGCTGAGGCGATACAATGCT
GATATATCCACATATCCACTGGAAAATGCCCCTATTGGACATAACAGACAATACAATATG
GTACCATTTTGGCCTCCAGTTACCAACATAGAAATGTTTGTTACTGCTCCAGACAACCTG
GGCTATACTTACGAAGTTCAATGGCCAAGTCGGAGTTTTAGCATTTCTGAGATTGTCACC
ATAGCAGTAGTGGCTGCATTATCACTGGTTGCGGTCATTTTTGCGGGCGCTTCTTGTCTG
ATTCGTGCCAGAAGCAACATGGATGAAGCAAATCAGCCTCTCCTTACTGATCAGTATCAA
CACTACATTGAAGAATATGAAAAAATCCATAATCCTAACCAGTCTGTGGTCTAG
Enzyme 47 GenBank Gene ID AF445638 Link Image
Enzyme 47 GeneCard ID TYRP1 Link Image
Enzyme 47 GenAtlas ID Not Available
Enzyme 47 HGNC ID Not Available
Enzyme 47 Chromosome Location Chromosome:9
Enzyme 47 Locus 9p23
Enzyme 47 SNPs SNPJam Report Link Image
Enzyme 47 General References Not Available
Enzyme 47 Metabolite References Not Available
Enzyme 48 [top]
Enzyme 48 ID 665
Enzyme 48 Name Peptidyl-glycine alpha-amidating monooxygenase
Enzyme 48 Synonyms
  1. PAM
  2. Peptidylglycine alpha-hydroxylating monooxygenase
  3. PHM
  4. Peptidyl-alpha-hydroxyglycine alpha-amidating lyase
  5. Peptidylamidoglycolate lyase
  6. PAL
Enzyme 48 Gene Name PAM
Enzyme 48 Protein Sequence >Peptidyl-glycine alpha-amidating monooxygenase
MAGFRSLLVLLLVFPSGCVGFRSPLSVFKRFKETTRSFSNECLGTTRPVIPIDSSDFALD
IRMPGVTPKQSDTYFCMSVRLPMDEEAFVIDFKPRASMDTVHHMLLFGCNMPASTGNYWF
CDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKD
CSGVSLHLTRLPQPLIAGMYLMMSVDTVIPPGGKVVNSDISCHYKKYPMHVFAYRVHTHH
LGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTH
IGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDIFRTIPPEANIPIPVKSDMVMMHG
HHKETENKDKTSLLQQPKREEEGVLEQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESES
DLVAEIANVVQKKDLGRSDTRESAEQERGNAILVRDRIHKFHRLVSTLRPAESRVLSLQQ
PLPGEGTWEPEHTGDFHVEEALDWPGVYLLPGQVSGVALDPQNNLVIFHRGDHVWDGNSF
DSKFVYQQRGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVALH
QVFKLDPKSKEGPLLTLGRSMQPGSDQNHFCQPTDVAVDPDTGTIYVSDGYCNSRLVQFS
PSGKFITQWGEASLESSPKPGQFRVPHSLALVPPLGQLCVADRENGRIQCFKTDTKEFVR
EIKHPSFGRNVFAISYIPGLLFAVNGKPYFEDQEPVQGFVMNFSSGEIIDVFKPVRKHFD
MPHDIAASEDGTVYVGDAHTNTVWKFTSTEKMEHRSVKKAGIEVQEIKESEAVVETKMEN
KPASSELQKIQEKQKLVKEPGSGVPAVLITTLLVIPVVVLLAIALFIRWKKSRAFGDSER
KLEASSGRVLGRLRGKGGGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKDEDASESEEE
YSAPPPAPAPSS
Enzyme 48 Number of Residues 972
Enzyme 48 Molecular Weight 108176.1
Enzyme 48 Theoretical pI 6.59
Enzyme 48 GO Classification
Function
Process
Component
Enzyme 48 General Function Involved in copper ion binding
Enzyme 48 Specific Function Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity
Enzyme 48 Pathways Not Available
Enzyme 48 Reactions Not Available
Enzyme 48 Pfam Domain Function
Enzyme 48 Signals
  • 1-20
Enzyme 48 Transmembrane Regions
  • 874-897
Enzyme 48 Essentiality Not Available
Enzyme 48 GenBank ID Protein 163482 Link Image
Enzyme 48 UniProtKB/Swiss-Prot ID P10731 Link Image
Enzyme 48 UniProtKB/Swiss-Prot Entry Name AMD_BOVIN Link Image
Enzyme 48 PDB ID 1SDW Link Image
Enzyme 48 PDB File Show
Enzyme 48 3D Structure
Enzyme 48 Cellular Location Not Available
Enzyme 48 Gene Sequence >2919 bp
ATGGCTGGCTTTCGGAGCCTGCTAGTTCTTCTCCTCGTGTTTCCCAGTGGCTGTGTGGGC
TTCCGAAGCCCACTTTCTGTCTTTAAGAGGTTTAAAGAAACTACCAGATCATTTTCCAAT
GAATGTCTTGGTACCACCAGACCAGTAATTCCTATCGATTCATCAGATTTTGCGTTGGAT
ATTCGCATGCCTGGGGTCACACCCAAACAGTCTGATACGTACTTCTGCATGTCAGTGCGT
TTGCCAATGGATGAGGAAGCCTTCGTGATTGACTTCAAACCCCGTGCCAGCATGGATACT
GTCCATCATATGTTACTGTTTGGATGCAATATGCCAGCGTCCACTGGAAATTACTGGTTT
TGTGATGAAGGCACCTGTACAGATAAAGCCAATATTCTCTATGCCTGGGCAAGAAATGCT
CCCCCAACGAGACTCCCCAAAGGTGTTGGATTCAGAGTTGGAGGAGAGACTGGAAGCAAA
TACTTTGTACTCCAAGTACACTATGGGGATATTAGTGCTTTTAGAGATAATCACAAGGAC
TGCTCTGGTGTTTCCTTACACCTCACACGCCTGCCACAGCCTTTAATTGCTGGCATGTAC
CTTATGATGTCTGTTGACACTGTTATACCACCAGGAGGGAAAGTGGTGAATTCTGATATT
TCATGCCATTATAAAAAGTATCCAATGCATGTCTTTGCCTACAGAGTTCACACTCACCAT
TTAGGCAAGGTAGTCAGTGGATACAGAGTAAGAAATGGACAGTGGACCCTGATTGGACGC
CAAAGCCCCCAACTGCCACAGGCCTTCTACCCAGTAGAGCACCCAGTGGATGTGAGTTTT
GGTGACATCCTGGCAGCAAGATGTGTGTTCACTGGGGAAGGGAGGACAGAAGTCACACAC
ATTGGTGGCACGTCTAGTGATGAAATGTGCAACTTATACATTATGTATTACATGGAAGCC
AAGCATGCAGTTTCTTTCATGACCTGTACACAGAATGTAGCTCCAGATATATTCAGAACC
ATACCACCAGAGGCCAATATTCCAATTCCTGTGAAATCCGATATGGTTATGATGCATGGA
CATCACAAAGAAACAGAGAACAAAGACAAGACTTCTTTACTACAGCAGCCCAAACGAGAA
GAAGAAGGAGTGTTAGAACAGGGTGATTTCTATTCACTACTTTCCAAGCTGCTAGGAGAA
AGGGAAGATGTTGTTCATGTGCATAAATATAATCCTACAGAAAAGGCAGAATCAGAGTCT
GACCTGGTAGCTGAGATTGCAAACGTAGTCCAAAAGAAGGATCTTGGTCGGTCCGATACC
AGAGAGAGTGCAGAACAGGAGAGGGGCAATGCTATTCTTGTCAGAGACAGAATTCACAAA
TTCCACAGACTAGTGTCTACCTTGAGGCCTGCAGAGAGCAGAGTTCTGTCGTTACAGCAG
CCCCTACCTGGTGAAGGCACCTGGGAACCAGAACACACAGGAGATTTCCATGTAGAAGAG
GCACTGGATTGGCCTGGAGTATACTTGTTACCAGGCCAGGTTTCTGGGGTGGCTCTGGAC
CCTCAGAATAATCTCGTGATTTTCCACCGAGGTGACCACGTCTGGGATGGAAACTCTTTT
GATAGCAAGTTTGTTTACCAGCAAAGAGGTCTTGGACCAATTGAAGAAGACACTATTCTT
GTCATAGATCCAAATAATGCTGCAGTACTCCAGTCCAGTGGAAAAAATCTGTTTTACTTG
CCACATGGCTTGAGTATAGATAAAGATGGAAATTATTGGGTCACAGACGTGGCGCTTCAT
CAGGTGTTCAAACTAGATCCAAAGAGTAAAGAAGGCCCTCTGCTAACCCTGGGAAGGAGC
ATGCAACCAGGCAGTGACCAGAATCACTTCTGTCAGCCCACCGATGTGGCTGTGGATCCA
GACACCGGAACCATCTATGTGTCAGATGGCTACTGCAACAGTCGCCTTGTGCAGTTTTCA
CCAAGTGGAAAATTCATCACACAGTGGGGAGAAGCGTCTCTAGAGAGCAGTCCTAAACCA
GGCCAGTTCAGAGTTCCTCACAGCTTGGCCCTGGTGCCTCCCCTGGGCCAGCTGTGTGTG
GCAGACCGGGAAAACGGTCGGATCCAGTGTTTCAAAACCGACACCAAAGAATTTGTGCGC
GAGATTAAGCACCCATCGTTTGGAAGAAATGTGTTTGCAATTTCATACATACCAGGTTTG
CTCTTTGCGGTGAATGGAAAGCCTTACTTTGAGGACCAAGAACCCGTGCAAGGATTTGTG
ATGAACTTTTCCAGCGGGGAAATTATCGATGTCTTCAAGCCAGTGCGCAAGCACTTCGAC
ATGCCCCACGACATTGCTGCGTCCGAGGACGGGACCGTGTATGTCGGAGACGCTCACACC
AACACCGTGTGGAAGTTCACCTCGACCGAAAAAATGGAACATCGATCAGTTAAGAAGGCT
GGCATTGAGGTTCAGGAAATCAAAGAATCCGAGGCAGTTGTTGAAACCAAAATGGAGAAC
AAGCCCGCCTCCTCAGAATTGCAGAAGATACAAGAGAAACAGAAGCTGGTCAAAGAGCCG
GGCTCCGGAGTGCCGGCTGTTCTCATTACAACCCTTCTGGTTATTCCTGTGGTTGTCCTG
CTGGCCATTGCCTTATTTATTCGGTGGAAAAAATCAAGGGCCTTTGGAGATTCTGAACGT
AAACTTGAGGCCAGTTCGGGAAGAGTTCTGGGAAGACTTAGAGGAAAGGGAGGCGGAGGC
CTAAACCTGGGCAACTTCTTCGCCAGCCGGAAGGGCTACAGCCGGAAGGGGTTCGACCGC
CTCAGCACGGAAGGAAGCGACCAGGAGAAAGATGAGGACGCAAGCGAGTCCGAAGAAGAG
TACTCGGCCCCGCCGCCCGCCCCTGCCCCTTCCTCCTGA
Enzyme 48 GenBank Gene ID M18683 Link Image
Enzyme 48 GeneCard ID PAM Link Image
Enzyme 48 GenAtlas ID Not Available
Enzyme 48 HGNC ID Not Available
Enzyme 48 Chromosome Location Chromosome:5
Enzyme 48 Locus 5q14-q21
Enzyme 48 SNPs SNPJam Report Link Image
Enzyme 48 General References
  1. [PubMed Link Image]
Enzyme 48 Metabolite References Not Available