We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Leucine (RMDB00687)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:58:12
Accession Number RMDB00687
Common Name L-Leucine
Description Branched chain amino acids (BCAA) are essential amino acids whose carbon structure is marked by a branch point. These three amino acids are critical to human life and are particularly involved in stress, energy and muscle metabolism. BCAA supplementation as therapy, both oral and intravenous, in human health and disease holds great promise. 'BCAA' denotes valine, isoleucine and leucine which are branched chain essential amino acids. Despite their structural similarities, the branched amino acids have different metabolic routes, with valine going solely to carbohydrates, leucine solely to fats and isoleucine to both. The different metabolism accounts for different requirements for these essential amino acids in humans: 12 mg/kg, 14 mg/kg and 16 mg/kg of valine, leucine and isoleucine respectively. Furthermore, these amino acids have different deficiency symptoms. Valine deficiency is marked by neurological defects in the brain, while isoleucine deficiency is marked by muscle tremors. Many types of inborn errors of BCAA metabolism exist, and are marked by various abnormalities. The most common form is the maple syrup urine disease, marked by a characteristic urinary odor. Other abnormalities are associated with a wide range of symptoms, such as mental retardation, ataxia, hypoglycemia, spinal muscle atrophy, rash, vomiting and excessive muscle movement. Most forms of BCAA metabolism errors are corrected by dietary restriction of BCAA and at least one form is correctable by supplementation with 10 mg of biotin daily. BCAA are useful because they are metabolized primarily by muscle. Stress state- e.g surgery, trauma, cirrhosis, infections, fever and starvation--require proportionately more BCAA than other amino acids and probably proportionately more leucine than either valine or isoleucine. BCAA and other amino acids are frequently fed intravenously (TPN) to malnourished surgical patients and in some cases of severe trauma. BCAA, particularly leucine, stimulate protein synthesis, increase reutilization of amino acids in many organs and reduce protein breakdown. Furthermore, leucine can be an important source of calories, and is superior as fuel to the ubiquitous intravenous glucose (dextrose). Leucine also stimulates insulin release, which in turn stimulates protein synthesis and inhibits protein breakdown. These effects are particularly useful in athletic training. BCAA should also replace the use of steroids as commonly used by weightlifters. Huntington's chorea and anorexic disorders both are characterized by low serum BCAA. These diseases, as well as forms of Parkinson's, may respond to BCAA therapy. BCAA, and particularly leucine, are among the amino acids most essential for muscle health. (http://www.dcnutrition.com)
Synonyms
  1. (2S)-2-Amino-4-methylpentanoate
  2. (2S)-2-Amino-4-methylpentanoic acid
  3. (S)-(+)-Leucine
  4. (S)-2-Amino-4-methylpentanoate
  5. (S)-2-Amino-4-methylpentanoic acid
  6. (S)-2-Amino-4-methylvalerate
  7. (S)-2-Amino-4-methylvaleric acid
  8. (S)-Leucine
  9. 4-methyl-L-Norvaline
  10. L-(+)-Leucine
  11. L-a-Aminoisocaproate
  12. L-a-Aminoisocaproic acid
  13. Leu
  14. L-alpha-Aminoisocaproate
  15. L-alpha-Aminoisocaproic acid
  16. Leucine
Chemical IUPAC Name (2S)-2-amino-4-methyl-pentanoic acid
Chemical Formula C6H13NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Essential amino acids; Protein component
Application
Source
  • Exogenous
Average Molecular Weight 131.173
Monoisotopic Molecular Weight 131.094635
Isomeric SMILES CC(C)C[C@H](N)C(O)=O
Canonical SMILES CC(C)CC(N)C(O)=O
KEGG Compound ID C00123 Link Image
BioCyc ID LEU Link Image
BiGG ID 33942 Link Image
Wikipedia Link Leucine Link Image
METLIN ID 24 Link Image
PubChem Compound 6106 Link Image
PubChem Substance 832925 Link Image
ChEBI ID 15603 Link Image
CAS Registry Number 61-90-5
InChI Identifier InChI=1/C6H13NO2/c1-4(2)3-5(7)6(8)9/h4-5H,3,7H2,1-2H3,(H,8,9)/t5-/m0/s1
Synthesis Reference Leuchtenberger, Wolfgang; Karrenbauer, Michael; Ploecker, Ulf. Scale-up of an enzyme membrane reactor process for the manufacture of L-enantiomeric compounds. Annals of the New York Academy of Sciences (1984), 434(Enzyme Eng.), 78-86.
Melting Point (Experimental) 268-288
Experimental Water Solubility 21.5 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 69.8 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -1.52 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.82 [Predicted by ALOGPS]; -1.4 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1F2O Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • mitochondria
Biofluid Location
  • Blood
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 145.2 +/- 46.1 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 104.1 +/- 6.9 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • Metabolomics reveals unhealthy alterations in rumen metabolism with increased proportion of cereal grain in the diet of dairy cows. Burim N. Ametaj, Qendrim Zebeli, Fozia Saleem, Nikolaos Psychogios, Michael J. Lewis, Suzanna M. Dunn, Jianguo Xia and David S. Wishart Metabolomics 2010;6(4):583-594
Concentrations (Abnormal)
Biofluid Rumen
Value 119 +/- 17 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 183 +/- 76 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 191 +/- 44 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Branched-chain-amino-acid aminotransferase
  2. Branched-chain-amino-acid aminotransferase, mitochondrial
  3. Branched-chain-amino-acid aminotransferase
  4. Branched-chain-amino-acid aminotransferase
Enzyme 1 [top]
Enzyme 1 ID 226
Enzyme 1 Name Branched-chain-amino-acid aminotransferase
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name BCAT1
Enzyme 1 Protein Sequence >Branched-chain-amino-acid aminotransferase
MKDCNNGCSAEGTGEGGSKETVETFKAEDLIITRATVLKEKPDSSTLVFGTVFTDHMLTV
EWSLELGWEKPRIKPLQNLSLHPGSSAFHYAVELFEGLKAFRGVDNKIRLFRPNLNMDRM
YRSAMRATLPAFDKKELLECIQQLVKLDEEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
ALLFVILSPVGPYFSTGSFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVEN
ACQQVLWLYGEDNQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRQSILDLAHK
WGEFKVSERYLTMDDLTTAVEENRVREMFGSGTACVVCPVSTILYKDETIHIPTMENGPK
LASRILEKLTDIQYGREESDWTITVA
Enzyme 1 Number of Residues 386
Enzyme 1 Molecular Weight 43185.0
Enzyme 1 Theoretical pI 4.78
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function 2-oxoglutaric acid + L-isoleucine = (S)-3- methyl-2-oxopentanoic acid + L-glutamic acid
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 134025168 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A4IFQ7 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name A4IFQ7_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1161 bp
ATGAAGGATTGCAATAATGGATGCTCCGCAGAAGGTACCGGAGAAGGCGGATCCAAAGAG
ACGGTGGAGACTTTCAAGGCTGAAGATCTAATAATCACACGAGCCACCGTTTTAAAGGAA
AAACCAGACTCCAGTACTCTGGTTTTTGGAACGGTTTTTACAGATCACATGTTAACAGTG
GAGTGGTCCTTGGAGCTTGGATGGGAGAAACCACGCATCAAACCTCTTCAAAACCTCTCA
CTGCATCCGGGTTCATCGGCTTTCCACTATGCTGTGGAATTATTTGAAGGGTTGAAGGCA
TTTCGAGGAGTAGATAATAAAATTCGTCTGTTTCGGCCAAACCTCAACATGGATAGGATG
TACCGATCTGCTATGAGGGCCACTTTGCCGGCGTTTGACAAGAAAGAGCTTTTAGAGTGT
ATTCAGCAGCTCGTGAAATTGGATGAGGAATGGGTCCCCTACTCAACATCTGCGAGTCTA
TATATCCGTCCTACGTTCATTGGAACTGAGCCTTCTCTGGGGGTCAAGAAGCCGACTAAA
GCCCTGCTCTTTGTAATCTTGAGCCCAGTGGGACCTTATTTTTCCACTGGAAGCTTTAAT
CCTGTGTCCCTGTGGGCCAACCCGAAGTATGTAAGAGCCTGGAAAGGTGGGACCGGAGAC
TGCAAGATGGGAGGGAATTATGGCTCATCTCTTTTTGCCCAATGTGAAGCCGTGGAAAAT
GCATGTCAGCAGGTTCTGTGGCTCTATGGAGAAGATAATCAAATAACTGAAGTTGGAACT
ATGAATCTTTTTCTTTATTGGATAAATGAAGATGGAGAAGAAGAACTGGCAACTCCTCCG
CTAGATGGCATCATTCTTCCAGGAGTGACGAGGCAGAGCATCCTGGACTTGGCACACAAG
TGGGGTGAATTTAAGGTATCAGAGAGATACCTCACCATGGATGACTTGACCACCGCTGTG
GAGGAGAACCGGGTGAGGGAGATGTTTGGTTCAGGCACCGCCTGTGTTGTTTGCCCTGTT
TCGACTATACTGTACAAGGATGAGACTATACACATTCCAACTATGGAGAATGGTCCTAAG
CTTGCAAGCCGCATCTTAGAAAAACTGACTGATATTCAGTACGGAAGAGAAGAGAGCGAC
TGGACAATCACGGTAGCCTGA
Enzyme 1 GenBank Gene ID BC134713 Link Image
Enzyme 1 GeneCard ID BCAT1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 12p12.1
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 227
Enzyme 2 Name Branched-chain-amino-acid aminotransferase, mitochondrial
Enzyme 2 Synonyms
  1. BCAT(m)
Enzyme 2 Gene Name BCAT2
Enzyme 2 Protein Sequence >Branched-chain-amino-acid aminotransferase, mitochondrial
MATAALRQIWIPRFLPVPWFLCGSRRYASSSFKAADLQLEMTQEPHKKPDPSQPLLFGKT
FTDHMLMVEWNQEKGWGQPRIQPFQNLTLHPACSALHYSLQLFEGMKAFKGGDQRVRLFR
PWLNMERMLRSALRLCLPSFDKIELLECIRRLVEVDQDWVPGSMGTSLYVRPVLIGNEPS
LGVGHPTRALLFVILSPVGAYFPGDALKPVSLLADPSFIRAWVGGVGNYKLGGNYGPTVL
VQQEAQKKGCEQVLWLYGPDHELTEVGTMNIFVFWTYEDGVLELVTPPLDGIILPGIVRQ
SLLDLARTWGEFRVVERKITMKEFLRALKDGRVREVFGSGTACQVCPVHQILYQGKHFHI
PTMENGPQLILRFHKELKAIQYGSKAHEWMLPV
Enzyme 2 Number of Residues 393
Enzyme 2 Molecular Weight 44647.8
Enzyme 2 Theoretical pI 8.82
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59857823 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5EA40 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name BCAT2_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1182 bp
ATGGCTACAGCGGCATTGAGGCAGATTTGGATCCCCAGATTTCTCCCTGTTCCTTGGTTT
CTGTGTGGTTCCAGAAGATATGCCTCATCCAGCTTCAAGGCTGCTGACCTGCAGCTGGAA
ATGACACAGGAGCCTCATAAGAAGCCTGACCCCAGCCAGCCTCTGCTGTTCGGGAAGACA
TTCACCGACCACATGCTGATGGTGGAATGGAATCAGGAGAAGGGCTGGGGCCAGCCCCGA
ATCCAGCCCTTCCAGAACCTCACGCTGCACCCGGCCTGCTCCGCTCTGCACTACTCCCTG
CAGCTCTTTGAAGGCATGAAGGCATTCAAAGGTGGGGACCAGCGCGTGCGCCTCTTCCGA
CCTTGGCTCAACATGGAACGGATGCTGCGCTCGGCCCTCCGCCTCTGCCTACCGAGTTTC
GACAAAATTGAGTTGCTGGAGTGCATCCGCCGGCTGGTGGAAGTGGACCAGGACTGGGTC
CCTGGCAGCATGGGCACTAGCCTCTACGTTCGGCCCGTGTTGATCGGGAACGAGCCCTCG
CTAGGTGTCGGCCACCCTACTCGAGCCCTCCTGTTCGTCATTCTCAGCCCTGTGGGCGCC
TACTTCCCTGGAGATGCCTTGAAACCTGTCTCCCTCCTGGCAGATCCATCATTCATCCGG
GCCTGGGTGGGTGGGGTCGGCAACTACAAGCTGGGAGGGAATTACGGGCCCACCGTGTTA
GTGCAGCAGGAGGCACAAAAGAAGGGCTGCGAGCAGGTCCTCTGGCTGTATGGGCCTGAT
CACGAGCTCACGGAGGTGGGCACCATGAACATCTTCGTCTTCTGGACCTATGAGGACGGG
GTGCTGGAACTGGTGACCCCCCCACTGGACGGCATCATCCTACCTGGAATAGTCCGACAG
AGTCTGCTGGACCTGGCCCGGACCTGGGGTGAATTCCGAGTGGTAGAGCGTAAGATTACC
ATGAAGGAGTTCCTGCGGGCGCTGAAGGATGGCCGGGTCCGAGAAGTCTTCGGTTCAGGC
ACTGCTTGCCAGGTCTGCCCCGTGCACCAAATCCTGTACCAAGGCAAGCATTTCCACATT
CCCACCATGGAAAACGGGCCCCAGCTCATCCTCCGCTTCCACAAGGAACTGAAGGCGATC
CAGTACGGATCAAAAGCCCATGAATGGATGCTCCCGGTGTAA
Enzyme 2 GenBank Gene ID BT020729 Link Image
Enzyme 2 GeneCard ID BCAT2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 19q13
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 228
Enzyme 3 Name Branched-chain-amino-acid aminotransferase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name BCAT2
Enzyme 3 Protein Sequence >Branched-chain-amino-acid aminotransferase
ALRQIWIPRFLPVPWFLCGSRRYASSSFKAADLQLEMTQEPHKKPDPSQPLLFGKTFTDH
MLMVEWNQEKGWGQPRIQPFQNLTLHPACSALHYSLQLFEGMKAFKGGDQRVRLFRPWLN
MERMLRSALRLCLPSFDKIELLECIRRLVEVDQDWVPGSMGTSLYVRPVLIGNEPSLGVG
HPTRALLFVILSPVGAYFPGDALKPVSLLADPSFIRAWVGGVGNYKLGGNYGPTVLVQQE
AQKKGCEQVLWLYGPDHELTEVGTMNIFVFWTYEDGVLELVTPPLDGIILPGIVRQSLLD
LARTWGEFRVVERKITMKEFLRALKDGRVREVFGSGTACQVCPVHQILYQGKHFHIPTME
NGPQLILRFHKELKAIQYGSKAHEWMLPV
Enzyme 3 Number of Residues 389
Enzyme 3 Molecular Weight 44273.4
Enzyme 3 Theoretical pI 8.82
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Amino acid transport and metabolism
Enzyme 3 Specific Function 2-oxoglutaric acid + L-isoleucine = (S)-3- methyl-2-oxopentanoic acid + L-glutamic acid
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 110331911 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q0V8J6 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name Q0V8J6_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence Not Available
Enzyme 3 GenBank Gene ID BT026222 Link Image
Enzyme 3 GeneCard ID BCAT2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 19q13
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 229
Enzyme 4 Name Branched-chain-amino-acid aminotransferase
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name BCAT2
Enzyme 4 Protein Sequence >Branched-chain-amino-acid aminotransferase
MATAALRQIWIPRFLPVPWFLCGSRRYASSSFKAADLQLEMTQEPHKKPDPSQPLLFGKT
FTDHMLMVEWNQEKGWGQPRIQPFQNLTLHPACSALHYSLQLFEGMKAFKGGDQRVRLFR
PWLNMERMLRSALRLCLPSFDKIELLECIRRLVEVDQDWVPGSMGTSLYVRPVLIGNEPS
LGVGHPTRALLFVILSPVGAYFPGDALKPVSLLADPSFIRAWVGGVGNYKLGGNYGPTVL
VQQEAQKKGCEQVLWLYGPDHELTEVGTMNIFVFWTYEDGVLELVTPPLDGIILPGIVRE
VFGSGTACQVCPVHQILYQGKHFHIPTMENGPQLILRFHKELKAIQYGSKAHEWMLPV
Enzyme 4 Number of Residues 358
Enzyme 4 Molecular Weight 40446.9
Enzyme 4 Theoretical pI 8.08
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Amino acid transport and metabolism
Enzyme 4 Specific Function 2-oxoglutaric acid + L-isoleucine = (S)-3- methyl-2-oxopentanoic acid + L-glutamic acid
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 59858011 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q5E9U7 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name Q5E9U7_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1077 bp
ATGGCTACAGCGGCATTGAGGCAGATTTGGATCCCCAGATTTCTCCCTGTTCCTTGGTTT
CTGTGTGGTTCCAGAAGATATGCCTCATCCAGCTTCAAGGCTGCTGACCTGCAGCTGGAA
ATGACACAGGAGCCTCATAAGAAGCCTGACCCCAGCCAGCCTCTGCTGTTCGGGAAGACA
TTCACCGACCACATGCTGATGGTGGAATGGAATCAGGAGAAGGGCTGGGGCCAGCCCCGA
ATCCAGCCCTTCCAGAACCTCACGCTGCACCCGGCCTGCTCCGCTCTGCACTACTCCCTG
CAGCTCTTTGAAGGCATGAAGGCATTCAAAGGTGGGGACCAGCGCGTGCGCCTCTTCCGA
CCTTGGCTCAACATGGAACGGATGCTGCGCTCGGCCCTCCGCCTCTGCCTACCGAGTTTC
GACAAAATTGAGTTGCTGGAGTGCATCCGCCGGCTGGTGGAAGTGGACCAGGACTGGGTC
CCTGGCAGCATGGGCACTAGCCTCTACGTTCGGCCCGTGTTGATCGGGAACGAGCCCTCG
CTAGGTGTCGGCCACCCTACTCGAGCCCTCCTGTTCGTCATTCTCAGCCCTGTGGGCGCC
TACTTCCCTGGAGATGCCTTGAAACCTGTCTCCCTCCTGGCAGATCCATCATTCATCCGG
GCCTGGGTGGGTGGGGTCGGCAACTACAAGCTGGGAGGGAATTACGGGCCCACCGTGTTA
GTGCAGCAGGAGGCACAAAAGAAGGGCTGCGAGCAGGTCCTCTGGCTGTATGGGCCTGAT
CACGAGCTCACGGAGGTGGGCACCATGAACATCTTCGTCTTCTGGACCTATGAGGACGGG
GTGCTGGAACTGGTGACCCCCCCACTGGACGGCATCATCCTACCTGGAATAGTCCGAGAA
GTCTTCGGTTCAGGCACTGCTTGCCAGGTCTGCCCCGTGCACCAAATCCTGTACCAAGGC
AAGCATTTCCACATTCCCACCATGGAAAACGGGCCCCAGCTCATCCTCCGCTTCCACAAG
GAACTGAAGGCGATCCAGTACGGATCAAAAGCCCATGAATGGATGCTCCCGGTGTAA
Enzyme 4 GenBank Gene ID BT020823 Link Image
Enzyme 4 GeneCard ID BCAT2 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 19q13
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available