We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Methionine (RMDB00696)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 13:42:49
Accession Number RMDB00696
Common Name L-Methionine
Description Methionine is a dietary indispensable amino acid required for normal growth and development of humans, other mammals, and avian species. In addition to being a substrate for protein synthesis, it is an intermediate in transmethylation reactions, serving as the major methyl group donor in vivo, including the methyl groups for DNA and RNA intermediates. Methionine is a methyl acceptor for 5-methyltetrahydrofolate-homocysteine methyl transferase (methionine synthase), the only reaction that allows for the recycling of this form of folate, and is also a methyl acceptor for the catabolism of betaine. Methionine is also required for synthesis of cysteine. Methionine is accepted as the metabolic precursor for cysteine. Only the sulfur atom from methionine is transferred to cysteine; the carbon skeleton of cysteine is donated by serine. (PMID 16702340) The adequacy range of dietary requirements of specific amino acids in disease states is difficult to determine. Requirements may not be similar in disease with regard to protein synthesis. Requirements for this purpose can be assessed only when such a function can be measured and related to clinical outcome. There is apparent consensus concerning normal sulfur amino acid (SAA) requirements. WHO recommendations amount to 13 mg/kg per 24 h in healthy adults. This amount is roughly doubled in artificial nutrition regimens. In disease or after trauma, requirements may be altered for methionine, cysteine, and taurine. Although in specific cases of congenital enzyme deficiency, prematurity, or diminished liver function, hypermethionemia or hyperhomocysteinemia may occur, SAA supplementation can be considered safe in amounts exceeding 2-3 times the minimal recommended daily intake. Apart from some very specific indications (e.g., acetaminophen poisoning) the usefulness of SAA supplementation is not yet established.(PMID 16702341) Methionine is known to exacerbate psychopathological symptoms in schizophrenic patients, there is no evidence of similar effects in healthy subjects. The role of methionine as a precursor of homocysteine is the most notable cause for concern. A "loading dose" of methionine (0.1 g/kg) has been given, and the resultant acute increase in plasma homocysteine has been used as an index of the susceptibility to cardiovascular disease. Although this procedure results in vascular dysfunction, this is acute and unlikely to result in permanent damage. However, a 10-fold larger dose, given mistakenly, resulted in death. Longer-term studies in adults have indicated no adverse consequences of moderate fluctuations in dietary methionine intake, but intakes higher than 5 times normal resulted in elevated homocysteine levels. These effects of methionine on homocysteine and vascular function are moderated by supplements of vitamins B-6, B-12, C, and folic acid. In infants, methionine intakes of 2 to 5 times normal resulted in impaired growth and extremely high plasma methionine levels, but no adverse long-term consequences were observed. (PMID 16702346)
Synonyms
  1. (2S)-2-amino-4-(methylsulfanyl)butanoic acid
  2. (S)-2-Amino-4-(methylthio)butanoate
  3. (S)-2-Amino-4-(methylthio)butanoic acid
  4. (S)-2-amino-4-(methylthio)-Butanoate
  5. (S)-2-amino-4-(methylthio)-Butanoic acid
  6. (S)-2-amino-4-(methylthio)butyric acid
  7. (l)-methionine
  8. (s)-(+)-methionine
  9. (s)-methionine
  10. 2-Amino-4-(methylthio)butyrate
  11. 2-Amino-4-(methylthio)butyric acid
  12. 2-Amino-4-methylthiobutanoic acid
  13. A-amino-g-methylmercaptobutyrate
  14. A-amino-g-methylmercaptobutyric acid
  15. Acimethin
  16. Alpha-amino-gamma-methylmercaptobutyric acid
  17. Cymethion
  18. G-methylthio-a-aminobutyrate
  19. G-methylthio-a-aminobutyric acid
  20. H-met-h
  21. H-met-oh
  22. L(-)-amino-alpha-amino-alpha-aminobutyric acid
  23. L(-)-amino-gamma-methylthiobutyric acid
  24. L-(-)-methionine
  25. L-2-Amino-4methylthiobutyric acid
  26. L-Methionine
  27. L-a-amino-g-methylthiobutyrate
  28. L-a-amino-g-methylthiobutyric acid
  29. L-alpha-amino-gamma-methylmercaptobutyric acid
  30. L-alpha-amino-gamma-methylthiobutyric acid
  31. L-gamma-methylthio-alpha-aminobutyric acid
  32. L-methionin
  33. L-methioninum
  34. Liquimeth
  35. MET
  36. Mepron
  37. Methilanin
  38. Methionine
  39. Methioninum
  40. Metionina
  41. Neo-methidin
  42. Poly-l-methionine
  43. Polymethionine
  44. S-methionine
  45. S-methyl-l-homocysteine
  46. Toxin WAR
  47. alpha-amino-alpha-aminobutyric acid
  48. gamma-methylthio-alpha-aminobutyric acid
  49. l-2-Amino-4-(methylthio)butyric acid
  50. alpha-amino-gamma-methylmercaptobutyrate
  51. gamma-methylthio-alpha-aminobutyrate
  52. L-alpha-amino-gamma-methylthiobutyrate
  53. (2S)-2-amino-4-(methylsulfanyl)butanoate
  54. 2-Amino-4-methylthiobutanoate
Chemical IUPAC Name (2S)-2-amino-4-methylsulfanyl-butanoic acid
Chemical Formula C5H11NO2S
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • thioether; primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Essential amino acids; Component of Aminoacyl-tRNA biosynthesis; Component of Glycine, serine and threonine metabolism; Component of Histidine metabolism; Component of Methionine metabolism; Component of Selenoamino acid metabolism; Component of Tyrosine metabolism
Application
Source
  • Exogenous
Average Molecular Weight 149.211
Monoisotopic Molecular Weight 149.051056
Isomeric SMILES CSCC[C@H](N)C(O)=O
Canonical SMILES CSCCC(N)C(O)=O
KEGG Compound ID C00073 Link Image
BioCyc ID MET Link Image
BiGG ID 33753 Link Image
Wikipedia Link MET Link Image
METLIN ID 5664 Link Image
PubChem Compound 6137 Link Image
PubChem Substance 10317509 Link Image
ChEBI ID 16811 Link Image
CAS Registry Number 63-68-3
InChI Identifier InChI=1/C5H11NO2S/c1-9-3-2-4(6)5(7)8/h4H,2-3,6H2,1H3,(H,7,8)/t4-/m0/s1
Synthesis Reference Boy, Matthias; Klein, Daniela; Schroeder, Hartwig. Method for the production and recovery of methionine. PCT Int. Appl. (2005), 34 pp.
Melting Point (Experimental) 284 oC
Experimental Water Solubility 56.6 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)]; 56.6 mg/mL at 25 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 23.900002 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -1.87 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.85 [Predicted by ALOGPS]; -1.9 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1C21 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
Biofluid Location
  • Rumen
  • Blood
  • Cow_Milk
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 44.0 (27-61) uM
Age N/A
Sex Both
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments This concentration measured after 1 hour of feeding.; The three amino acids (AA), threonine, methionine and Lysine were administered intraruminally in mixtures at dosages of 100, 200, 300, and 400 mmol of each,together with polyethylene glycol (PEG) as a liquid marker.
References
Biofluid Rumen
Value 18.75 +/- 10.3 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 22 +/- 8 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 32 +/- 10 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 47 +/- 19 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. S-adenosylmethionine synthetase
  2. Lipoyl synthase, mitochondrial
  3. S-adenosylmethionine synthetase isoform type-1
  4. Methionine synthase
  5. Methionine-R-sulfoxide reductase B1
  6. Methionine aminopeptidase 1
  7. Methionine aminopeptidase 2
  8. Betaine--homocysteine S-methyltransferase 1
  9. Peptide methionine sulfoxide reductase
  10. Methionyl-tRNA synthetase, mitochondrial
  11. Methionyl-tRNA synthetase, cytoplasmic
Enzyme 1 [top]
Enzyme 1 ID 174
Enzyme 1 Name S-adenosylmethionine synthetase
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name MAT2A
Enzyme 1 Protein Sequence >S-adenosylmethionine synthetase
MNGQLNGFHDAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVA
KTGMILLAGEITSRAAVDYQKVVRETIKHIGYDDSSKGFDYKTCNVLVALEQQSPDIAQG
VHLDRNEEDIGAGDQGLMFGYATDETEECMPLTIVLAHKLNAKLAELRRNGTLPWLRPDS
KTQVTVQYMQDRGAVLPIRVHTIVISVQHDEEVCLDEMRDALKEKVIKAVVPAKYLDEDT
IYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAARW
VAKSLVKGGLCRRVLVQVSYAIGVSHPLSISIFHYGTSQKSERELLEIVKKNFDLRPGVI
VRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLKY
Enzyme 1 Number of Residues 395
Enzyme 1 Molecular Weight 43690.4
Enzyme 1 Theoretical pI 6.45
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Coenzyme transport and metabolism
Enzyme 1 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 1 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 152941174 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A7E3T7 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name A7E3T7_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1188 bp
ATGAACGGGCAGCTCAACGGCTTCCACGACGCGTTCATCGAGGAGGGCACGTTCCTCTTT
ACCTCCGAGTCCGTGGGGGAAGGCCACCCAGATAAGATCTGTGACCAGATCAGTGATGCT
GTCCTTGATGCCCACCTTCAGCAGGACCCTGATGCCAAAGTGGCTTGTGAAACTGTTGCT
AAGACTGGAATGATCCTTCTTGCTGGGGAAATTACATCCAGAGCTGCTGTTGACTACCAG
AAAGTGGTTCGTGAAACCATTAAACACATTGGATATGACGATTCTTCCAAAGGGTTTGAC
TACAAGACATGTAATGTGCTAGTGGCCTTGGAGCAACAGTCACCAGATATTGCCCAAGGT
GTTCATCTTGACCGAAACGAGGAAGACATTGGTGCAGGAGACCAGGGTTTGATGTTTGGT
TATGCCACTGATGAAACTGAGGAATGTATGCCTTTAACCATTGTCTTAGCACACAAGCTC
AATGCCAAACTGGCTGAACTGCGCCGGAATGGCACTTTGCCTTGGTTACGCCCTGATTCT
AAAACTCAAGTGACTGTGCAGTATATGCAGGATCGAGGTGCCGTACTTCCCATCAGAGTC
CACACAATTGTTATATCTGTTCAGCATGATGAAGAAGTTTGTCTTGATGAGATGAGAGAT
GCTCTGAAGGAGAAAGTCATCAAAGCTGTTGTACCTGCAAAGTACCTTGATGAGGACACA
ATCTATCATCTACAGCCAAGTGGCAGATTTGTTATTGGTGGGCCTCAGGGTGATGCTGGT
TTGACTGGCCGGAAAATCATTGTGGACACTTACGGTGGTTGGGGAGCTCATGGAGGAGGT
GCCTTTTCAGGAAAGGATTATACCAAGGTGGACCGTTCAGCTGCTTATGCTGCTCGTTGG
GTGGCAAAATCCCTTGTTAAAGGAGGTCTGTGCAGAAGGGTTCTTGTTCAGGTCTCTTAT
GCTATTGGAGTATCTCATCCATTGTCTATCTCCATTTTCCATTATGGCACCTCTCAGAAG
AGTGAGAGAGAGCTATTAGAGATTGTGAAGAAGAATTTTGACCTCCGCCCTGGGGTCATT
GTCAGGGATCTGGATCTGAAGAAGCCAATTTATCAGAGGACTGCAGCCTATGGCCACTTT
GGTAGGGACAGCTTCCCATGGGAAGTGCCCAAAAAGCTTAAATATTGA
Enzyme 1 GenBank Gene ID BT030708 Link Image
Enzyme 1 GeneCard ID MAT2A Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:2
Enzyme 1 Locus 2p11.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 396
Enzyme 2 Name Lipoyl synthase, mitochondrial
Enzyme 2 Synonyms
  1. Lipoic acid synthase
  2. Lipoate synthase
  3. Lip-syn
  4. LS
Enzyme 2 Gene Name LIAS
Enzyme 2 Protein Sequence >Lipoyl synthase, mitochondrial
MSLRCGGAVRTVGPRVFGRYVFSPVREVSFLPDEKKEFLQSGPDLQEFISGNLADKSTWD
EYKGNLKRQKGERLRLPPWLKTEIPMGKNYNKLKNTLRNLNLHTVCEEARCPNIGECWGG
GEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPYNTAKAIAEWGLDYVVLTSV
DRDDMPDGGAEHFAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVET
VPELQRKVRDPRANFDQSLRVLKHAKEVRPDVISKTSIMLGLGENDEQVYATMKALREAD
VDCLTLGQYMQPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFL
KNLVAKRKTKAL
Enzyme 2 Number of Residues 372
Enzyme 2 Molecular Weight 42034.9
Enzyme 2 Theoretical pI 8.86
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Coenzyme transport and metabolism
Enzyme 2 Specific Function Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives
Enzyme 2 Pathways
  • Protein modification
  • protein lipoylation via endogenous pathway
  • protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]:step 2/2
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 60650254 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5BIP7 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name LIAS_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1119 bp
ATGTCTCTACGCTGCGGGGGCGCGGTCCGCACCGTGGGCCCCCGGGTATTTGGAAGATAT
GTATTCAGCCCTGTCAGAGAAGTAAGTTTCCTGCCAGATGAAAAAAAGGAATTTTTACAG
AGTGGACCAGACCTTCAAGAATTTATATCTGGTAATCTGGCTGACAAGAGTACCTGGGAT
GAATATAAAGGAAATTTAAAACGCCAGAAAGGAGAAAGGTTAAGACTACCTCCATGGCTA
AAAACAGAGATTCCTATGGGGAAAAATTATAATAAACTGAAAAACACTTTGCGGAATTTA
AATCTTCACACAGTGTGTGAGGAAGCTCGATGTCCCAATATTGGAGAGTGTTGGGGAGGT
GGAGAATATGCTACCGCCACAGCCACAATCATGTTGATGGGTGACACATGTACAAGAGGT
TGTAGATTTTGTTCTGTTAAGACTGCAAGAAATCCACCTCCACTGGATGCCAATGAGCCC
TACAATACTGCAAAGGCAATTGCAGAGTGGGGTCTGGATTATGTTGTCCTGACATCTGTG
GATCGAGATGATATGCCTGATGGAGGAGCTGAGCACTTTGCAAAGACTGTATCTTACTTA
AAGGAAAGGAATCCAAAAATTCTTGTGGAATGTCTCACCCCTGATTTCCGAGGAGATCTT
AAAGCAATAGAAAAAGTTGCCCTGTCAGGATTAGATGTATATGCACATAATGTAGAAACA
GTTCCAGAATTACAGAGGAAAGTTCGTGATCCCCGGGCCAATTTTGACCAGTCTCTACGT
GTACTAAAACATGCCAAGGAGGTTCGACCTGATGTTATTTCTAAAACATCTATTATGTTG
GGTTTAGGTGAGAATGATGAGCAAGTATATGCCACGATGAAAGCACTTCGTGAGGCAGAT
GTGGACTGTTTGACTTTAGGACAATATATGCAGCCAACAAAGCGCCACCTTAAGGTTGAA
GAATACATTACTCCTGAAAAGTTCAAATACTGGGAAAAAGTAGGAAATGAACTTGGATTT
CATTATACTGCAAGTGGCCCCCTGGTGCGTTCTTCATACAAAGCAGGTGAATTTTTCCTG
AAAAATCTAGTGGCTAAAAGAAAAACAAAAGCCCTGTAA
Enzyme 2 GenBank Gene ID BT021177 Link Image
Enzyme 2 GeneCard ID LIAS Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:4
Enzyme 2 Locus 4p14
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 403
Enzyme 3 Name S-adenosylmethionine synthetase isoform type-1
Enzyme 3 Synonyms
  1. AdoMet synthetase 1
  2. Methionine adenosyltransferase 1
  3. MAT 1
Enzyme 3 Gene Name MAT1A
Enzyme 3 Protein Sequence >S-adenosylmethionine synthetase isoform type-1
MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETV
CKTGMVLLCGEITSMAMVDYQRVVRETIQHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQ
CVHLDRNEEDVGAGDQGLMFGYATDETEECMPLTIMLAHRLNARMAELRRSGQLPWLQPD
SKTQVTVQYTQDNGAVIPMRVHTVVISVQHNEDITLEDMRRALKEQVIRAVVPARYLDED
TIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGGGAFSGKDYTKVDRSAAYAAR
WVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVNKNFDLRPGV
IVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
Enzyme 3 Number of Residues 396
Enzyme 3 Molecular Weight 43760.5
Enzyme 3 Theoretical pI 5.61
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Coenzyme transport and metabolism
Enzyme 3 Specific Function Catalyzes the formation of S-adenosylmethionine from methionine and ATP
Enzyme 3 Pathways
  • Amino-acid biosynthesis
  • S-adenosyl-L-methionine biosynthesis
  • S-adenosyl-L-methionine from L-methionine:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 86821449 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2KJC6 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name METK1_BOVIN Link Image
Enzyme 3 PDB ID 1O9T Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1191 bp
ATGAATGGACCAGTGGATGGCTTGTGTGATCATTCTCTAAGTGAGGAAGGAGCATTCATG
TTCACATCGGAATCTGTAGGAGAGGGGCACCCGGATAAGATCTGTGACCAGATCAGTGAT
GCAGTGCTGGATGCCCATCTCAAGCAGGACCCCAATGCCAAGGTGGCCTGTGAGACGGTG
TGTAAGACGGGCATGGTGCTTCTGTGCGGGGAGATCACCTCCATGGCCATGGTGGATTAC
CAGCGTGTGGTGCGGGAGACCATCCAGCACATCGGCTACGACGACTCCGCCAAGGGCTTT
GACTTTAAGACCTGCAACGTGCTGGTGGCTTTGGAGCAGCAGTCCCCGGATATCGCCCAG
TGTGTCCACCTGGACAGAAATGAAGAGGATGTCGGTGCCGGAGATCAGGGGCTGATGTTT
GGCTATGCCACGGATGAGACGGAAGAGTGCATGCCCCTCACCATCATGCTGGCGCACAGA
CTCAACGCCCGCATGGCAGAGCTGCGACGCTCAGGGCAGCTCCCCTGGCTGCAACCTGAC
TCCAAGACACAGGTGACAGTGCAGTACACGCAGGACAACGGTGCGGTCATCCCTATGCGC
GTCCATACCGTCGTCATCTCCGTGCAGCACAACGAAGACATAACGCTGGAGGACATGCGC
AGAGCCCTGAAGGAGCAGGTGATCAGGGCTGTTGTGCCAGCACGGTACCTGGACGAGGAC
ACCATCTACCACCTGCAGCCCAGTGGGCGCTTTGTCATCGGAGGCCCCCAGGGGGATGCC
GGTGTCACTGGCCGAAAGATCATCGTGGACACCTATGGCGGCTGGGGGGCACACGGCGGA
GGCGCCTTCTCTGGGAAGGACTACACCAAGGTGGACCGCTCGGCAGCGTACGCTGCCCGC
TGGGTGGCCAAGTCCCTGGTGAAAGCAGGGCTCTGCCGGAGGGTGCTTGTGCAGGTGTCC
TATGCCATTGGTGTGGCTGAGCCACTGTCTATTTCCATCTTTACCTATGGAACCTCCCAG
AAGACAGAGAGAGAGCTGCTGGATGTGGTCAATAAGAACTTTGACCTTCGGCCTGGTGTT
ATCGTCAGGGACTTGGACTTGAAGAAGCCCATCTACCAGAAGACAGCATGCTACGGCCAC
TTCGGGAGGAGCGAGTTCCCTTGGGAAGTTCCCAAAAAGCTTGTGTTTTAG
Enzyme 3 GenBank Gene ID BC105410 Link Image
Enzyme 3 GeneCard ID MAT1A Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 10q22
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 414
Enzyme 4 Name Methionine synthase
Enzyme 4 Synonyms
  1. 5-methyltetrahydrofolate--homocysteine methyltransferase
  2. Vitamin-B12 dependent methionine synthase
  3. MS
Enzyme 4 Gene Name MTR
Enzyme 4 Protein Sequence >Methionine synthase
MAPTLQDLTPSAGMKKTLQDEIEAILQERIMVLDGGMGTMIQRHKLSEEDFRGQEFKDHA
RPLKGNNDILSITQPNVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC
SAGVARKAAEDISLQTGIKRYVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYKEQA
KGLLDGGVDILLIETIFDTANAKAALFAVQKLFEEEYVPRPVFISGTIVDKSGRTLSGQT
GEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDET
PHVMAMHLKDFAVDGLVNIVGGCCGTTPDHIREIAEAVKNCKPRVPPATVFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRRFAKLIMAGNYEEALSVAKMQVEMGAQVLDINMDDG
MLDGPSAMTRFCNFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKFGAAVVVMAFDEEGQATETDPKIRVCTRAYHLLLKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAVNFINATKVIKETLPGAKVSGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKFGMDMGIVNAGSLPVYDDIHKELLQLCEDLIWNRDPEATEKLLHYAQTQGKGGKKV
IQTDEWRNGPLEERLEYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETKVLTGKIEDEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEILEEYEDIRQDHYESLKERRYLTLRQARENGFHIDWLSEPPPVKPTFLGTRV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFDDKTVGEEAKKVYDDAQNMLQAL
ISQKKLQARGVVGFWPAQSIQDDIHLYAEGAVPQASEPIATFYGLRQQAEKDSASSDPYL
CLSDFIAPLHSGIPDYLGLFAVACFGVEELSKAYEEECDDYSSIMVKALGDRLAEAFAEE
LHERARRELWGYCSGEQLAVADLRRLRYEGIRPAPGYPSQPDHTEKLTVWRLADVEQRTG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYASRKNMSVAEVEKWLGPIL
GYDTD
Enzyme 4 Number of Residues 1265
Enzyme 4 Molecular Weight 140476.7
Enzyme 4 Theoretical pI 4.99
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Amino acid transport and metabolism
Enzyme 4 Specific Function Catalyzes the transfer of a methyl group from methyl- cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Subsequently, remethylates the cofactor using methyltetrahydrofolate
Enzyme 4 Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via de novo pathway
  • L-methionine from L-homocysteine (MetH route):step 1/1
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 68160375 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q4JIJ3 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name METH_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >3798 bp
ATGGCCCCCACGCTCCAGGACCTGACGCCATCTGCAGGGATGAAGAAGACCCTGCAAGAT
GAGATTGAAGCTATCCTGCAGGAGAGGATTATGGTGCTTGATGGAGGGATGGGGACCATG
ATCCAGCGGCACAAGCTGAGTGAAGAAGACTTCCGAGGACAAGAATTTAAAGATCATGCC
AGGCCCCTGAAAGGCAACAATGACATTTTAAGTATAACTCAGCCCAATGTCATTTACCAA
ATCCATAAGGAGTACCTCCTAGCTGGGGCAGATATCATTGAAACAAATACTTTCAGCAGC
ACTTCTATTGCCCAAGCTGACTATGGCCTGGAACACTTGGCCTACCGGATGAACATGTGC
TCTGCGGGAGTGGCCAGAAAAGCAGCCGAGGACATCTCTCTCCAGACAGGAATTAAGAGG
TATGTGGCAGGAGCTCTGGGTCCAACTAACAAGACACTCTCTGTGTCGCCATCTGTGGAA
AGACCAGATTACAGGAACATCACATTTGATGAACTTGTTGAAGCATACAAAGAGCAGGCC
AAAGGGCTTCTGGATGGTGGAGTGGATATCTTACTCATTGAAACTATTTTTGATACCGCC
AATGCCAAGGCAGCCTTGTTTGCAGTCCAAAAACTTTTTGAAGAGGAGTATGTTCCCCGG
CCTGTCTTTATTTCAGGGACAATTGTTGATAAAAGTGGGCGGACTCTCTCTGGCCAGACT
GGGGAGGCATTTGTCATCAGCGTGTCTCATGCAGACCCACTCTGCATTGGATTAAATTGT
GCTCTGGGTGCAGCTGAAATGAGACCTTTTATTGAAACAATTGGAAAATGTACAACAGCT
TATGTTCTCTGTTATCCCAATGCAGGTCTTCCCAATACCTTCGGTGACTATGATGAAACT
CCCCACGTGATGGCCATGCATTTAAAGGATTTTGCTGTTGATGGCTTGGTCAACATAGTT
GGCGGATGCTGTGGTACGACACCAGATCATATCAGAGAAATTGCTGAAGCTGTGAAAAAC
TGTAAGCCTAGAGTTCCACCTGCCACTGTTTTCGAAGGGCATATGCTACTGTCTGGTCTA
GAGCCCTTCAGGATTGGACCATACACCAACTTTGTTAACATTGGAGAGCGCTGTAACGTT
GCAGGATCCAGGAGATTTGCTAAGCTCATCATGGCAGGAAATTATGAAGAAGCACTGAGC
GTTGCCAAAATGCAGGTGGAAATGGGAGCCCAGGTGTTGGATATTAACATGGATGATGGC
ATGCTGGATGGTCCAAGTGCAATGACCAGATTCTGCAACTTCATTGCTTCCGAGCCTGAC
ATTGCCAAGGTGCCCTTGTGCATTGACTCTTCCAATTTTGCTGTGATTGAAGCCGGCTTA
AAGTGCTGCCAGGGGAAGTGCATTGTTAATAGCATCAGCTTGAAGGAGGGAGAGGATGAC
TTCTTGGAGAAGGCCAGAAAGATTAAGAAGTTTGGAGCTGCCGTGGTGGTTATGGCTTTT
GATGAAGAAGGACAGGCAACAGAAACAGATCCCAAAATCAGAGTGTGCACCCGGGCCTAC
CATCTCCTTTTGAAAAAACTGGGCTTCAATCCAAATGACATCATCTTTGACCCTAATATC
CTCACCATTGGTACTGGGATGGAAGAACATAACTTGTATGCTGTTAATTTTATCAATGCA
ACAAAAGTCATTAAAGAAACGCTGCCTGGAGCCAAAGTAAGCGGTGGTCTTTCCAACTTG
TCCTTCTCCTTCCGAGGAATGGAAGCCATTCGAGAGGCAATGCATGGGGTTTTCCTGTAC
CATGCGATCAAGTTTGGTATGGACATGGGAATAGTGAATGCTGGAAGCCTTCCTGTATAT
GATGACATCCACAAGGAGCTTCTCCAGCTCTGTGAGGACCTCATCTGGAACAGAGACCCT
GAGGCCACCGAGAAGCTCTTACACTACGCCCAGACTCAGGGCAAAGGAGGGAAGAAAGTC
ATCCAGACTGATGAGTGGAGGAATGGCCCTCTCGAAGAACGCCTTGAGTACGCTCTTGTG
AAGGGCATTGAAAAATATATTATTGAAGATACTGAGGAAGCCAGGTTAAACCAGGAAAAA
TATCCCCGACCTCTGAATATAATTGAAGGGCCGCTGATGAATGGCATGAAAATTGTTGGT
GATCTTTTTGGAGCTGGAAAAATGTTTCTACCTCAGGTTATAAAGTCAGCTCGGGTCATG
AAGAAGGCCGTGGGTCACCTTATTCCCTTCATGGAAAAAGAGAGAGAAGAAACCAAAGTG
CTTACTGGCAAAATAGAAGATGAGGACCCTTACCAAGGCACCATCGTGCTGGCTACTGTT
AAAGGTGACGTACACGACATAGGCAAGAACATAGTTGGAGTGGTTCTTGGCTGCAATAAT
TTCAGAGTTATTGATTTAGGAGTCATGACTCCATGTGACAAGATACTGAAGGCTGCTCTA
GACCACAAAGCAGATATAATTGGCCTGTCAGGACTCATCACTCCTTCCCTGGATGAAATG
ATTTTTGTCGCTAAGGAAATGGAGAGACTAGCTATAAAGATCCCATTGTTGATCGGAGGA
GCTACCACTTCCAGAACCCACACAGCAGTTAAAATAGCCCCAAGATACAGTGCGCCCGTG
ATCCACGTCCTGGATGCATCCAAGAGCGTGGTGGTGTGTTCTCAACTGTTAGATGAGAAT
CTAAAAGATGAGTACTTTGAGGAGATCCTGGAAGAATATGAAGATATTAGACAGGACCAT
TATGAATCTCTCAAGGAGAGAAGATACTTAACCTTAAGGCAAGCTAGAGAAAATGGTTTC
CATATTGACTGGCTGTCAGAGCCTCCTCCAGTGAAGCCCACGTTCCTCGGGACTCGGGTC
TTTGAAGACTACGACCTGCAGAAGCTGGTGGACTACATTGATTGGAAGCCTTTCTTCGAC
GTCTGGCAGCTCCGGGGCAAATACCCGAACCGAGGCTTTCCCAAGATATTTGACGACAAA
ACTGTAGGTGAAGAGGCCAAAAAGGTCTATGATGATGCCCAAAATATGCTGCAGGCACTG
ATCAGTCAGAAGAAGCTCCAGGCCAGGGGTGTGGTTGGGTTCTGGCCAGCACAGAGCATT
CAGGATGATATCCACCTGTACGCGGAAGGCGCAGTGCCACAGGCCTCGGAGCCCATAGCC
ACCTTCTACGGGCTCAGGCAGCAGGCCGAGAAGGACTCTGCCAGCTCGGACCCCTACCTC
TGCCTCTCGGACTTCATCGCCCCTCTGCACTCAGGTATCCCCGACTACCTGGGCCTGTTC
GCCGTTGCCTGCTTTGGGGTGGAGGAGCTGAGCAAGGCCTACGAGGAGGAGTGTGATGAC
TACAGCAGCATCATGGTCAAGGCGCTGGGGGACCGGCTGGCCGAGGCCTTCGCTGAGGAG
CTGCACGAGCGGGCCCGCAGGGAGCTGTGGGGTTACTGTAGTGGTGAGCAGCTGGCTGTG
GCTGACCTGCGGAGACTGCGCTACGAGGGCATCCGGCCGGCGCCCGGCTATCCCAGCCAG
CCTGACCACACTGAGAAGCTGACCGTGTGGAGGCTGGCGGACGTGGAGCAGCGCACAGGC
ATTAGGTTAACAGAATCGCTGGCCATGGCACCTGCTTCAGCAGTATCTGGCCTTTACTTC
TCCAACTTGAAGTCCAAGTATTTTGCCGTGGGGAAAATTTCCAAGGATCAGATTGAGGAT
TATGCTTCGAGGAAGAACATGTCTGTGGCCGAGGTTGAGAAATGGCTTGGACCCATTTTG
GGATATGATACAGACTAA
Enzyme 4 GenBank Gene ID DQ084519 Link Image
Enzyme 4 GeneCard ID MTR Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 1q43
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 547
Enzyme 5 Name Methionine-R-sulfoxide reductase B1
Enzyme 5 Synonyms
  1. Selenoprotein X
  2. SelX
Enzyme 5 Gene Name SEPX1
Enzyme 5 Protein Sequence >Methionine-R-sulfoxide reductase B1
MSFCSFFGGEIFQNHFEPGIYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPE
HNRPGAIKVSCGRCGNGLGHEFLNDGPKRGQSRFUIFSSSLKFIPKAEETSASQGQ
Enzyme 5 Number of Residues 116
Enzyme 5 Molecular Weight 12833.2
Enzyme 5 Theoretical pI 8.50
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 5 Specific Function L-methionine + oxidized thioredoxin = L- methionine R-oxide + reduced thioredoxin
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 75773607 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q3MHL9 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name MSRB1_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >285 bp
ATGTCGTTCTGCAGCTTCTTCGGAGGCGAGATTTTCCAGAACCACTTTGAGCCGGGTATC
TACGTGTGTGCCAAGTGTGGCTATGAGCTCTTCTCCAGCCGCTCCAAGTACGCACACTCA
TCCCCATGGCCGGCGTTCACTGAGACCATCCATGCTGACAGTGTGGCCAAGCGGCCAGAG
CACAATCGGCCTGGAGCCATAAAGGTATCCTGTGGCAGGTGTGGCAACGGGCTGGGCCAT
GAGTTCCTGAACGATGGCCCCAAGCGCGGACAGTCCCGCTTCTGA
Enzyme 5 GenBank Gene ID BC105188 Link Image
Enzyme 5 GeneCard ID SEPX1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 16p13.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 795
Enzyme 6 Name Methionine aminopeptidase 1
Enzyme 6 Synonyms
  1. MetAP 1
  2. MAP 1
  3. Peptidase M 1
Enzyme 6 Gene Name METAP1
Enzyme 6 Protein Sequence >Methionine aminopeptidase 1
MAAVETRVCETDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKA
KREVSSWTVEGDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ
ALKGTSQIKLLSSEDIEGMRLVCRLAREVLDIAAGLIKPGVTTEEIDHAVHLACIARNCY
PSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGD
VDEGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLF
HTAPNVPHYSKNKAVGVMKAGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHT
LLVTDTGCEILTRRLDSAQPHFMSQF
Enzyme 6 Number of Residues 386
Enzyme 6 Molecular Weight 43182.8
Enzyme 6 Theoretical pI 7.05
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Translation, ribosomal structure and biogenesis
Enzyme 6 Specific Function Removes the amino-terminal methionine from nascent proteins
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 151554799 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID A6QLA4 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name AMPM1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1161 bp
ATGGCGGCGGTGGAGACGCGTGTGTGCGAGACGGACGGTTGCAGCAGCGAGGCCAAGCTC
CAGTGCCCCACCTGCATCAAGCTGGGCATCCAGGGCTCGTACTTCTGCTCGCAGGAATGT
TTTAAAGGAAGTTGGGCAACTCACAAGTTACTGCATAAGAAAGCAAAAGATGAAAAGGCC
AAGCGAGAAGTGTCTTCCTGGACTGTAGAAGGTGATATCAACACTGATCCATGGGCAGGT
TATCGATATACTGGAAAACTCAGACCCCATTATCCACTGATGCCAACAAGGCCAGTGCCA
AGTTATATTCAAAGACCAGATTATGCTGATCACCCTTTAGGAATGTCTGAATCTGAGCAA
GCTCTTAAAGGTACTTCTCAAATTAAGTTACTCTCATCTGAAGATATAGAAGGGATGCGG
CTCGTATGTAGGCTTGCTAGAGAAGTATTGGACATTGCCGCTGGGCTGATTAAACCAGGT
GTAACTACTGAAGAAATAGATCATGCTGTACACTTAGCATGCATTGCAAGAAATTGCTAT
CCTTCACCCCTGAATTATTATAATTTCCCGAAGTCTTGTTGTACTTCAGTGAATGAAGTG
ATTTGCCATGGAATTCCAGACAGACGGCCTTTGCAAGAAGGTGATATTGTTAATGTGGAC
ATCACTCTTTATCGGAATGGTTATCATGGGGACCTGAATGAAACATTTTTTGTTGGAGAC
GTGGATGAGGGAGCTCGGAAACTGGTTCAGACCACGTATGAGTGCCTGATGCAAGCCATT
GACGCAGTAAAGCCTGGTGTTCGATACAGAGAATTGGGAAACATTATCCAGAAGCATGCA
CAAGCAAATGGATTTTCAGTTGTTCGAAGTTACTGTGGGCATGGAATTCACAAGCTTTTT
CATACAGCCCCCAATGTACCCCACTACTCCAAAAATAAAGCAGTTGGAGTGATGAAGGCT
GGTCATGTATTTACAATTGAGCCAATGATTTGTGAAGGCGGATGGCAGGATGAAACCTGG
CCGGATGGCTGGACGGCGGTGACAAGAGACGGGAAGCGGTCTGCCCAGTTCGAGCACACT
CTGCTGGTCACGGACACTGGCTGTGAGATCCTAACCCGGCGGCTTGATAGTGCGCAGCCT
CACTTCATGTCCCAGTTTTAA
Enzyme 6 GenBank Gene ID BC147894 Link Image
Enzyme 6 GeneCard ID METAP1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:4
Enzyme 6 Locus 4q23
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 797
Enzyme 7 Name Methionine aminopeptidase 2
Enzyme 7 Synonyms
  1. MetAP 2
  2. MAP 2
  3. Peptidase M 2
Enzyme 7 Gene Name METAP2
Enzyme 7 Protein Sequence >Methionine aminopeptidase 2
MAGVEEAASCGSHLNGDLDPDEREEGAASTAEEAAKKKKRKKKKSKGAATGQQEPDKEAG
ASVDEVTRQLERQALEEKEKDDDDEDGDGDGDGATGKKKKKKKKKRGPKVQTDPPSVPIC
DLYPNGVFPKGQECEYPPTQDGRTAAWRTTSEEKKALDQASEEIWNDFREAAEAHRQVRK
YVMSWIKPGMTMIEICEKMEDCSRKLIKENGLNAGLAFPTGCSLNNCAAHYTPNAGDTTV
LQYDDICKIDFGTHISGRIIDCAFTVTFNPKYDTLLKAVKDATNTGIKCAGIDVRLCDVG
EAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPIVKGGEATRMEEGEVY
AIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIRLPRTKHLLNVINENFGTLAFCRRWLD
RLGESKYLMALKNLCDLGIVDPYPPLCDIKGSYTAQFEHTILLRPTCKEVVSRGDDY
Enzyme 7 Number of Residues 477
Enzyme 7 Molecular Weight 52811.2
Enzyme 7 Theoretical pI 5.71
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Translation, ribosomal structure and biogenesis
Enzyme 7 Specific Function Removes the amino-terminal methionine from nascent proteins
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 73586904 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q3ZC89 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name AMPM2_BOVIN Link Image
Enzyme 7 PDB ID 1B6A Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1434 bp
ATGGCGGGTGTGGAGGAGGCAGCGTCCTGCGGGAGCCACCTGAATGGCGACCTGGATCCA
GACGAAAGAGAGGAGGGAGCTGCCTCTACGGCTGAGGAAGCGGCCAAGAAAAAAAAACGG
AAGAAGAAGAAGAGTAAAGGGGCTGCCACAGGGCAACAGGAACCTGATAAAGAAGCAGGA
GCCTCAGTTGATGAGGTGACAAGACAATTGGAAAGACAAGCATTGGAAGAGAAAGAAAAA
GATGATGATGATGAAGATGGAGATGGTGACGGAGATGGAGCAACTGGAAAGAAGAAGAAA
AAGAAGAAGAAGAAGAGAGGACCAAAAGTTCAAACAGACCCTCCCTCAGTTCCAATATGT
GACCTGTATCCTAATGGTGTATTTCCCAAAGGACAAGAATGCGAATACCCACCCACACAA
GATGGGCGAACAGCTGCTTGGAGAACTACAAGTGAAGAAAAGAAAGCATTAGATCAAGCT
AGTGAAGAGATTTGGAATGATTTTCGAGAAGCTGCAGAAGCACATCGACAAGTTAGAAAA
TATGTTATGAGCTGGATCAAGCCTGGGATGACAATGATAGAAATCTGTGAGAAGATGGAA
GACTGTTCACGAAAGTTAATAAAAGAGAATGGATTAAACGCAGGCCTGGCATTTCCTACT
GGGTGTTCTCTGAATAACTGTGCTGCCCATTATACTCCCAATGCTGGTGACACAACAGTA
TTACAGTATGATGACATCTGTAAGATAGACTTTGGAACACATATAAGTGGTAGGATTATC
GATTGTGCTTTTACTGTCACTTTTAATCCCAAATATGATACATTATTAAAAGCTGTCAAA
GATGCCACTAACACTGGAATAAAGTGTGCCGGAATTGATGTTCGTCTCTGTGATGTTGGT
GAGGCTATCCAAGAAGTTATGGAATCCTATGAAGTTGAAATAGATGGGAAGACATATCAA
GTGAAACCAATCCGTAATCTAAATGGACATTCAATTGGGCCATATAGAATACATGCTGGG
AAAACAGTGCCCATTGTGAAAGGAGGAGAGGCAACAAGAATGGAGGAAGGAGAAGTATAT
GCCATTGAAACCTTTGGTAGCACAGGAAAAGGTGTGGTTCATGATGATATGGAATGTTCA
CATTACATGAAAAATTTTGATGTTGGACATGTGCCAATAAGGCTTCCAAGAACAAAACAC
TTGTTAAATGTCATCAATGAAAACTTTGGCACTCTTGCCTTCTGCCGCAGATGGCTGGAT
CGTTTGGGAGAAAGTAAATACTTGATGGCTCTGAAGAATCTGTGTGACTTGGGCATTGTA
GACCCATATCCACCATTATGTGACATTAAAGGATCATATACAGCACAGTTTGAACACACC
ATACTTTTGCGTCCAACATGTAAAGAAGTTGTCAGCCGAGGAGATGACTATTAA
Enzyme 7 GenBank Gene ID BC102824 Link Image
Enzyme 7 GeneCard ID METAP2 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 12q22
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1057
Enzyme 8 Name Betaine--homocysteine S-methyltransferase 1
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name BHMT
Enzyme 8 Protein Sequence >Betaine--homocysteine S-methyltransferase 1
MAPAGGKNVKKGILERLNSGEVIIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFQQQLEVFVKKNVDFLIAEYFEHVEEAVWAVEALKASGKP
VAATMCIGPEGDLHSVTPGECAVRLVKAGASIVGVNCHFDPTISLQTVKLMKEGLEAAGL
KAHLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPLASEKHGSWGSGLDMHTKPWIRARARKEYWENLQIASG
RPYNPSMSKPDAWGVTKGTAELMQQKEATTEQQLRELFEKQKFKSAQ
Enzyme 8 Number of Residues 407
Enzyme 8 Molecular Weight 44877.9
Enzyme 8 Theoretical pI 6.84
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Amino acid transport and metabolism
Enzyme 8 Specific Function Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline
Enzyme 8 Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via de novo pathway
  • L-methionine from L-homocysteine (BhmT route):step 1/1
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 57222553 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q5I597 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name BHMT1_BOVIN Link Image
Enzyme 8 PDB ID 1UMY Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1224 bp
ATGGCACCGGCTGGGGGCAAAAATGTCAAGAAGGGCATCCTAGAACGGCTAAACTCTGGA
GAGGTCATCATCGGAGACGGAGGGTTTGTCTTTGCGCTGGAGAAGAGGGGCTACGTGAAG
GCAGGGCCCTGGACCCCAGAAGCTGCTGTGGAACACCCAGAAGCAGTTCGCCAACTTCAT
CGAGAGTTCCTCAGAGCTGGCTCGAATGTCATGCAGACCTTCACCTTCTATGCCAGTGAA
GACAAGCTGGAGAACAGGGGGAACTATGTTGCAGAGAAAATATCCGGGCAGAAAGTCAAT
GAAGCCGCTTGTGACATTGCCCGGCAAGTGGCTGATGAAGGAGATGCTTTGGTAGCAGGG
GGTGTGAGCCAGACACCTTCGTACCTTAGCTGCAAGAGCGAAACTGAAGTCAAAAAAGTC
TTTCAGCAACAGTTAGAGGTCTTCGTAAAGAAGAACGTGGACTTCTTGATCGCAGAGTAT
TTTGAACATGTTGAAGAGGCTGTATGGGCAGTTGAAGCCTTGAAAGCATCAGGGAAACCA
GTGGCGGCAACTATGTGCATCGGCCCAGAGGGAGACTTGCACAGCGTGACCCCTGGCGAG
TGTGCAGTGCGCCTGGTTAAAGCAGGAGCTTCCATCGTGGGGGTAAACTGCCATTTTGAC
CCCACAATTAGCTTACAGACAGTGAAGCTCATGAAAGAAGGCTTGGAGGCTGCCGGACTG
AAAGCCCACCTCATGAGCCAGCCCTTGGCCTACCACACTCCTGACTGCGGCAAGCAGGGG
TTTATTGACCTGCCAGAATTCCCCTTTGGACTGGAACCCAGAGTTGCAACCAGATGGGAT
ATTCAAAAGTATGCCAGAGAGGCCTACAACCTGGGGGTCAGGTACATAGGTGGGTGCTGT
GGATTTGAACCCTACCACATCAGGGCAATTGCAGAGGAGCTGGCTCCGGAGAGGGGATTT
TTGCCACTGGCTTCAGAAAAACATGGCAGCTGGGGAAGTGGTTTGGATATGCACACCAAA
CCCTGGATTAGAGCCAGGGCCAGGAAGGAATACTGGGAGAATCTTCAGATAGCCTCGGGC
AGGCCGTACAACCCTTCCATGTCAAAGCCGGACGCCTGGGGAGTGACCAAAGGAACAGCC
GAGCTTATGCAGCAGAAGGAAGCCACAACGGAGCAGCAGCTGAGAGAGCTCTTCGAAAAA
CAGAAGTTCAAGTCTGCACAGTAG
Enzyme 8 GenBank Gene ID AY854632 Link Image
Enzyme 8 GeneCard ID BHMT Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:5
Enzyme 8 Locus 5q13.1-q15
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1249
Enzyme 9 Name Peptide methionine sulfoxide reductase
Enzyme 9 Synonyms
  1. Protein-methionine-S-oxide reductase
  2. Peptide-methionine (S)-S-oxide reductase
  3. Peptide Met(O) reductase
Enzyme 9 Gene Name MSRA
Enzyme 9 Protein Sequence >Peptide methionine sulfoxide reductase
MLSATRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
Enzyme 9 Number of Residues 233
Enzyme 9 Molecular Weight 25818.1
Enzyme 9 Theoretical pI 7.66
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 9 Specific Function Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 1205993 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID P54149 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name MSRA_BOVIN Link Image
Enzyme 9 PDB ID 1FVA Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >702 bp
ATGCTCTCGGTCACCAGGAGGGCCCTCCAGCTCTTTCACAGCCTCTTCCCCATCCCGAGA
ATGGGTGACTCCGCCGCCAAGATCGTCAGTCCCCAGGAAGCCTTGCCGGGCCGGAAGGAG
CCCCTCGTCGTAGCGGCCAAACATCATGTCAATGGCAACAGAACAGTTGAACCTTTCCCA
GAGGGGACACAGATGGCTGTATTTGGAATGGGCTGTTTCTGGGGAGCTGAAAGGAAATTC
TGGACCCTGAAAGGTGTATATTCAACTCAAGTTGGTTTTGCAGGAGGCTATACTCCCAAT
CCTACTTATAAAGAAGTCTGCTCAGGAAAAACTGGCCACGCAGAAGTAGTCCGGGTGGTG
TTCCAGCCAGAACACATCAGCTTTGAGGAACTGCTCAAGGTCTTCTGGGAGAATCATGAC
CCGACCCAAGGCATGCGCCAAGGCAATGACCACGGCTCTCAGTACCGCTCAGCCATCTAC
CCGACCTCTGCCGAGCACGTGGGGGCAGCCCTGAAGTCCAAGGAGGACTACCAGAAGGTT
CTGTCGGAGCATGGTTTTGGGCTGATCACCACGGACATCCGGGAGGGACAAACCTTTTAC
TATGCGGAAGATTACCACCAGCAGTACCTGAGCAAGGACCCCGACGGGTACTGCGGCCTC
GGGGGCACCGGAGTGTCTTGTCCCCTGGGTATTAAAAAGTAA
Enzyme 9 GenBank Gene ID U37150 Link Image
Enzyme 9 GeneCard ID MSRA Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:8
Enzyme 9 Locus 8p23.1
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1250
Enzyme 10 Name Methionyl-tRNA synthetase, mitochondrial
Enzyme 10 Synonyms
  1. Mitochondrial methionine--tRNA ligase
  2. MtMetRS
  3. Methionine--tRNA ligase 2
Enzyme 10 Gene Name MARS2
Enzyme 10 Protein Sequence >Methionyl-tRNA synthetase, mitochondrial
MLRVSAFRLLGRRGASRVSLLEDFSFRYYSSGPLGVRDDTRDSRAYFTTPIFYVNAAPHI
GHLYSALLADALCRHHRLRVPSDAATGFSTGTDEHGLKIQQAAAAAGLAPSELCDRVSAQ
FQQLFREADISSTDFIRTTEARHRIAVQHFWGMLKSRGLLYKGLYEGWYCASDECFLPEA
KVTRQPGPSGDLCPVSLESGHPVSWTKEENYIFRLSQFREPLQQWLRGDPQAITPEPFHH
TVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLTVVGYPDAEFKSW
WPNTSHIIGKDILKFHAIYWPALLLGAGMSPPHRIYVHSHWTVCGQKMSKSLGNVVDPRT
CLDRYTVDGFRYFLLRQGVPSWDCDYYDEKVVKLLDSELADALGGLLNRCTANKINPSGI
YPAFCATCFPSEPGLVGPSGRAQAEDYALVSAVATLPKQVADHYDNFQIYKALEAVSSCV
RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTLLQPVTPSLADRLLSRLG
VSSTERSLGELHFLSRFYGHPSPFEGRRLGPETGVLFPRLDQSRSWLVKAHKT
Enzyme 10 Number of Residues 593
Enzyme 10 Molecular Weight 66647.1
Enzyme 10 Theoretical pI 7.47
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Translation, ribosomal structure and biogenesis
Enzyme 10 Specific Function ATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 148878169 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID A6H7E1 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name SYMM_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1782 bp
ATGCTGCGAGTTTCTGCCTTCCGGCTGCTAGGTCGCAGAGGGGCGAGTAGGGTCTCGCTC
TTGGAGGACTTTAGCTTCCGCTACTACAGCTCGGGTCCTCTTGGTGTCCGCGACGATACC
CGCGACTCGCGCGCCTACTTTACCACACCTATTTTCTACGTGAACGCCGCGCCGCACATC
GGGCACCTGTACTCCGCGCTGCTGGCGGACGCCCTGTGCCGACACCATCGCCTCCGAGTT
CCCAGTGACGCCGCCACGGGATTCTCCACGGGTACCGATGAGCACGGCCTGAAGATTCAG
CAGGCAGCCGCCGCCGCGGGCCTGGCTCCGTCCGAGCTGTGCGACAGAGTCTCTGCCCAG
TTCCAGCAGCTTTTCCGGGAGGCTGACATCTCTTCCACCGACTTCATCCGCACCACCGAG
GCCCGGCACCGGATAGCTGTGCAGCATTTCTGGGGGATGCTGAAGTCTCGGGGTCTTCTC
TATAAGGGCCTCTATGAAGGTTGGTATTGCGCCTCCGACGAGTGCTTCCTGCCTGAAGCC
AAGGTCACCAGGCAGCCCGGCCCGTCAGGGGATTTGTGTCCTGTATCTCTCGAGAGCGGA
CACCCGGTCTCCTGGACCAAGGAAGAAAACTACATTTTTAGGCTTTCCCAGTTCCGGGAG
CCGCTCCAGCAGTGGCTGCGGGGCGACCCTCAGGCCATAACACCGGAGCCATTCCATCAC
ACAGTCCTTCAGTGGTTGGAGGAGGAGCTGCCGGACCTATCGGTCTCTCGAAGGAGTAGC
CACTTGCACTGGGGCATTCCGGTGCCCGGGGACGATTCACAGACCATCTACGTATGGCTG
GATGCCTTGGTCAACTACCTTACTGTAGTTGGCTACCCAGACGCTGAGTTCAAATCTTGG
TGGCCGAACACCTCTCATATCATAGGCAAGGACATTCTCAAATTCCATGCTATCTATTGG
CCTGCCCTCCTCTTAGGGGCCGGCATGAGCCCACCACACCGCATCTATGTCCACTCCCAC
TGGACAGTCTGTGGTCAGAAGATGTCTAAGAGCTTGGGTAACGTGGTGGATCCCAGGACT
TGTCTTGACCGCTATACGGTGGATGGCTTCCGCTACTTTCTTCTTCGGCAGGGCGTCCCC
AGCTGGGATTGTGATTACTATGATGAAAAGGTGGTTAAGTTGTTGGATTCCGAGCTGGCA
GATGCTTTGGGAGGTCTCCTGAACCGATGTACTGCCAACAAGATCAATCCTTCTGGGATC
TATCCGGCTTTCTGCGCTACTTGCTTTCCCAGTGAGCCAGGCTTGGTAGGGCCGTCAGGT
CGTGCTCAGGCAGAGGACTACGCTCTAGTGAGCGCAGTGGCCACTTTGCCCAAGCAGGTA
GCAGACCACTACGATAACTTTCAGATCTATAAGGCTCTGGAGGCAGTGTCCAGCTGTGTC
CGGCAGACTAACGGCTTTGTCCAAAGGCATGCGCCATGGAAGCTGAACTGGGAGAGCCCC
GTGGATGCTCCCTGGCTGGGTACTGTGCTTCATGTGGCCTTGGAGTGTTTGCGAGTCTTT
GGAACTCTGCTCCAGCCTGTCACCCCAAGCCTAGCTGACAGGCTGCTGTCTAGGTTGGGG
GTTTCTTCCACAGAGAGGAGCCTTGGAGAGCTCCATTTTTTGTCTCGATTCTATGGACAT
CCATCCCCTTTTGAAGGGAGGAGACTGGGACCTGAAACTGGGGTCTTGTTTCCAAGACTG
GACCAGTCTAGGTCCTGGCTGGTAAAAGCCCACAAGACCTAG
Enzyme 10 GenBank Gene ID BC146211 Link Image
Enzyme 10 GeneCard ID MARS2 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:2
Enzyme 10 Locus 2q33.1
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1251
Enzyme 11 Name Methionyl-tRNA synthetase, cytoplasmic
Enzyme 11 Synonyms
  1. Methionine--tRNA ligase
  2. MetRS
Enzyme 11 Gene Name MARS
Enzyme 11 Protein Sequence >Methionyl-tRNA synthetase, cytoplasmic
MRLFVSEGAPGSLPVLAAAGRAQGRAELLISTVGPEECVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGPVRRA
LTHIDHSLSRRSCPFLAGETESLADIVLWGALYPLLQDPSYLPEELGALHSWFQTLSSQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSSLEGRLVSNEPEEEELATLSEEEIAVAVAAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHVIHADIYRWFNISFDFFGRTTTP
QQTKITQDIFQRLLARGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAIELKKPQCKVCRSCPVVKSSQHLFLDLPKLAARVEEWLEKTLPGSDWTANARF
IIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWEKWW
KNPEQVNLYQFMAKDNVPFHGIVFPSSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYNRPEGQDSAFSWTDMLFKNNSELLNNLGNFINRAGMF
VSKFFGGFVPEMVLTSDDQRLLTHITLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGGEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LPTNFLCTLPAGHQIGTVSPLFQKLENDQIESLKQRFSGGQAKASPKTAAGLTTAGPQQI
QALTEEVTKQGNIVRELKAQKADKNQIAAEVAKLLDLKKQLALAEGKPLETSKGKKKK
Enzyme 11 Number of Residues 898
Enzyme 11 Molecular Weight 100633.3
Enzyme 11 Theoretical pI 6.36
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Translation, ribosomal structure and biogenesis
Enzyme 11 Specific Function ATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 83405370 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q2T9L8 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name SYMC_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >2697 bp
ATGAGGTTGTTCGTGAGTGAGGGCGCTCCGGGGAGTCTGCCTGTGCTGGCCGCGGCCGGG
AGGGCCCAGGGCAGAGCGGAGCTGCTCATCAGCACTGTAGGCCCAGAAGAGTGTGTGGTC
CCATTCCTGACCCGGCCTAAGGTCCCTGTCTTGCAGCTGGATAGTGGCAACTACCTCTTC
TCCACCAGTGCAATCTGTCGATACTTCTTTCTGTTATCTGGCTGGGAGCAAGATGACCTC
ACCAACCAGTGGCTGGAATGGGAAGCAACCGAGCTGCAGCCAGCTTTGTCCGCTGCCCTG
TACTATTTAGTGGTCCAAGGGAAGAAGGGAGAAGATGTTCTTGGCCCAGTTCGGAGAGCC
CTGACGCATATTGACCACAGCTTGAGTCGTCGGAGCTGTCCGTTCCTGGCTGGGGAGACA
GAATCTCTAGCTGATATTGTTTTGTGGGGAGCGCTCTACCCGTTACTCCAAGACCCATCC
TATCTCCCTGAGGAGCTGGGTGCCCTGCACAGCTGGTTCCAGACACTGAGTTCTCAGGAG
CCATGTCAGCGAGCTGCAGAGACTGTGCTGAAGCAGCAGGGTGTCCTGGCCCTCCGGCCC
TACCTCCAGAAGCAGCCCCAGCCCAGCTCCCTTGAGGGCAGGCTTGTCAGCAATGAGCCT
GAGGAGGAGGAACTGGCTACTCTGTCTGAGGAGGAGATTGCCGTGGCTGTAGCTGCTTGG
GAGAAGGGCCTGGAAAGCTTGCCCCCTCTTCGGCCGCAGCAGAATCCAGTGTTGCCCGTG
GCTGGGGAGAGAAATGTGCTCATCACCAGCGCCCTCCCTTACGTCAACAACGTCCCCCAC
CTTGGAAACATCATCGGCTGTGTGCTCAGTGCCGACGTCTTTGCAAGGTACTCCCGGCTC
CGTCAGTGGAACACCCTCTACCTGTGTGGGACAGATGAGTATGGTACAGCGACAGAGACC
AAGGCTATGGAGGAGGGACTAACCCCACAGGAAATCTGTGACAAGTACCACGTAATCCAC
GCTGACATCTACCGCTGGTTTAATATTTCGTTTGACTTTTTTGGTCGGACTACCACTCCA
CAGCAGACCAAAATTACCCAGGACATCTTCCAGCGGCTGTTGGCCCGAGGTTTTGTGCTG
CAAGATACTGTGGAGCAACTTCGGTGTGAGCACTGTGCCCGCTTCCTGGCTGACCGCTTT
GTGGAGGGTGTGTGTCCCTTCTGTGGATACGAGGAAGCCCGGGGTGACCAGTGTGACAAG
TGTGGCAAGCTCATTAATGCCATTGAGCTCAAGAAGCCTCAGTGTAAAGTCTGCCGGTCG
TGCCCTGTGGTGAAATCCTCTCAGCACCTGTTTCTGGACCTGCCTAAGCTGGCAGCGCGG
GTGGAGGAGTGGTTGGAGAAGACATTGCCTGGCAGTGACTGGACTGCCAACGCCCGGTTC
ATCATTCGTTCTTGGCTTCGAGATGGCCTCAAGCCCCGCTGTATAACCCGAGACCTCAAG
TGGGGAACCCCTGTGCCCTTAGAAGGTTTTGAGGACAAGGTGTTCTATGTCTGGTTTGAT
GCCACCATTGGCTATCTGTCCATCACAGCCAACTACACAGACCAATGGGAGAAGTGGTGG
AAGAACCCAGAACAAGTGAACCTGTATCAGTTCATGGCCAAGGACAATGTTCCCTTCCAT
GGCATAGTCTTTCCTTCTTCAGCCCTAGGAGCTGAGGACAACTACACCTTGGTCAGCCAC
CTCATTGCTACAGAGTATCTGAATTACGAGGATGGGAAATTCTCTAAGAGCCGGGGTGTG
GGAGTGTTTGGGGACATGGCCCAGGACACAGGGATCCCTGCTGACATCTGGCGCTTCTAT
CTGCTGTACAATCGGCCTGAGGGGCAGGACAGTGCCTTCTCCTGGACAGACATGTTGTTC
AAGAATAATTCCGAGCTGCTTAACAACCTGGGCAACTTCATCAACAGAGCTGGGATGTTT
GTGTCCAAGTTTTTTGGGGGTTTTGTGCCTGAGATGGTGCTCACCTCTGATGATCAGCGC
CTGCTGACCCATATCACCCTGGAGCTCCAGCACTACCACCAGCTGCTAGAGAAGGTTCGG
ATCCGGGATGCCTTACGTAGCATCCTCACCATCTCTCGCCATGGCAACCAGTACATTCAG
GTGAACGAGCCCTGGAAGCGGATTAAAGGTGGCGAAGCTGACAGGCAGCGGGCAGGGACA
GTGACAGGCTTGGCCGTGAATATAGCTGCCTTGCTGTCCGTCATGCTCCAGCCTTACATG
CCTACAGTTAGTGCCACCATCCAAGCCCAGCTGCAGCTCCCACCTCCAGCCTGCAGTATC
CTGCCCACAAACTTCCTATGCACCTTACCAGCAGGACACCAGATTGGCACGGTCAGTCCC
TTGTTCCAAAAATTGGAAAATGACCAGATTGAAAGTCTGAAGCAGCGCTTCAGTGGGGGC
CAGGCAAAAGCATCCCCCAAGACAGCAGCTGGACTGACAACAGCTGGACCGCAGCAGATC
CAAGCACTGACAGAGGAAGTGACCAAGCAGGGCAATATTGTCCGAGAATTGAAGGCACAG
AAGGCAGACAAGAACCAGATTGCTGCAGAGGTGGCTAAACTCTTGGATCTGAAGAAACAG
TTGGCTCTAGCTGAGGGGAAACCCCTGGAAACCTCTAAAGGCAAGAAGAAAAAGTGA
Enzyme 11 GenBank Gene ID BC111362 Link Image
Enzyme 11 GeneCard ID MARS Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 12q13.2
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References Not Available
Enzyme 11 Metabolite References Not Available