We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Myristic acid (RMDB00806)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:58:18
Accession Number RMDB00806
Common Name Myristic acid
Description A saturated 14-carbon fatty acid occurring in most animal and vegetable fats, particularly butterfat and coconut, palm, and nutmeg oils. It is used to synthesize flavor and as an ingredient in soaps and cosmetics. (From Dorland, 28th ed) Myristic acid is also commonly added to a penultimate nitrogen terminus glycine in receptor-associated kinases to confer the membrane localisation of the enzyme. this is achieved by the myristic acid having a high enough hydrophobicity to become incorporated into the fatty acyl core of the phospholipid bilayer of the plasma membrane of the eukaryotic cell.(wikipedia)
Synonyms
  1. 1-Tridecanecarboxylate
  2. 1-Tridecanecarboxylic acid
  3. Crodacid
  4. Myristate
  5. Myristic acid
  6. Myristic acid pure
  7. Tetradecanoate
  8. Tetradecanoic (Myristic) acid
  9. n-Tetradecan-1-oate
  10. n-Tetradecan-1-oic acid
  11. n-Tetradecanoate
  12. n-Tetradecanoic acid
  13. Tetradecanoic acid
Chemical IUPAC Name tetradecanoic acid
Chemical Formula C14H28O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Fatty Acids
Sub Class
  • Long chain fatty acids
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 228.371
Monoisotopic Molecular Weight 228.208923
Isomeric SMILES CCCCCCCCCCCCCC(O)=O
Canonical SMILES CCCCCCCCCCCCCC(O)=O
KEGG Compound ID C06424 Link Image
BioCyc ID Not Available
BiGG ID 215851 Link Image
Wikipedia Link Myristic acid Link Image
METLIN ID 196 Link Image
PubChem Compound 11005 Link Image
PubChem Substance 841695 Link Image
ChEBI ID 28875 Link Image
CAS Registry Number 544-63-8
InChI Identifier InChI=1/C14H28O2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14(15)16/h2-13H2,1H3,(H,15,16)
Synthesis Reference Greaves, W. S.; Linstead, R. P.; Shephard, B. R.; Thomas, S. L. S.; Weedon, B. C. L. Anodic syntheses. I. New syntheses of stearic, myristic, and other acids. Journal of the Chemical Society (1950), 3326-30.
Melting Point (Experimental) 53.9 oC
Experimental Water Solubility 0.00107 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 1.72e-03 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity 6.11 [SANGSTER (1993)] Source: PhysProp
Predicted LogP/Hydrophobicity 6.10 [Predicted by ALOGPS]; 5.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1BJ5 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
  • Cytoplasm
  • Extracellular
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 3.3 +/- 0.6 uM
Age N/A
Sex N/A
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Dehydrogenase/reductase SDR family member 4
Enzyme 1 [top]
Enzyme 1 ID 116
Enzyme 1 Name Dehydrogenase/reductase SDR family member 4
Enzyme 1 Synonyms
  1. NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase
  2. PHCR
  3. CR
  4. Peroxisomal short-chain alcohol dehydrogenase
  5. NADPH-dependent retinol dehydrogenase/reductase
  6. NDRD
Enzyme 1 Gene Name DHRS4
Enzyme 1 Protein Sequence >Dehydrogenase/reductase SDR family member 4
MASCGMARRNPLDNKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDRAVATLKG
EGLSVTGTVCHVGKAEDRERLVATAVKLHGGVDILISNAAVSPFFGSLMDVPEEVWDKIL
DVNVKATALLTKAVVPEMAKRGGGSIVIVSSIAAYSPFPSLGPYNVSKTALLGLTKNLAL
ELAESNVRVNCLAPGLIRTSFSRVLWEDPARQESIKATFQIKRIGKPEECAGIVSFLCSE
DASYITGETVVVAGGSLSHL
Enzyme 1 Number of Residues 260
Enzyme 1 Molecular Weight 27385.3
Enzyme 1 Theoretical pI 8.49
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function Reduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co- factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 19702303 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q8SPU8 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name DHRS4_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >783 bp
ATGGCTAGCTGCGGGATGGCGCGCCGGAACCCGCTGGATAATAAAGTGGCCCTAGTAACG
GCCTCCACCGACGGGATCGGTTTTGCCATCGCCCGGCGTCTGGCCCAGGACGGGGCCCAC
GTGGTGGTCAGCAGCCGGAAGCAGCAGAATGTAGACCGGGCAGTGGCAACGCTGAAAGGG
GAGGGGCTGAGCGTCACGGGCACCGTGTGCCACGTAGGGAAGGCTGAGGACCGGGAGCGG
CTGGTGGCCACGGCTGTGAAGCTTCATGGCGGCGTGGACATCCTGATCTCCAATGCTGCC
GTCAGCCCTTTCTTTGGAAGCTTGATGGATGTCCCCGAGGAGGTGTGGGACAAGATTCTG
GACGTTAACGTGAAGGCCACGGCCCTGCTGACAAAGGCAGTGGTGCCAGAGATGGCGAAA
CGAGGAGGCGGCTCGATAGTGATCGTGTCCTCCATAGCAGCCTACAGCCCCTTTCCTAGC
CTGGGTCCTTACAACGTTTCTAAGACAGCCTTGCTGGGCCTCACTAAGAACCTGGCCCTC
GAACTGGCAGAGTCGAATGTTCGGGTGAACTGCCTGGCGCCTGGACTCATCAGGACTAGC
TTCAGCCGTGTGTTGTGGGAGGATCCGGCAAGACAGGAGAGCATAAAAGCTACCTTTCAG
ATCAAAAGGATAGGCAAGCCAGAGGAGTGTGCCGGCATCGTGTCTTTCCTGTGCTCTGAA
GACGCCAGCTACATCACTGGGGAGACAGTGGTGGTAGCTGGAGGGAGCCTATCCCACCTC
TAA
Enzyme 1 GenBank Gene ID AF487454 Link Image
Enzyme 1 GeneCard ID DHRS4 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 14q11.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available