We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for L-Tryptophan (RMDB00929)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 12:39:22
Accession Number RMDB00929
Common Name L-Tryptophan
Description Tryptophan is an essential amino acid which is the precursor of serotonin. Serotonin is a brain neurotransmitter, platelet clotting factor and neurohormone found in organs throughout the body. Metabolism of tryptophan to serotonin requires nutrients such as vitamin B6, niacin and glutathione. Niacin is an important metabolite of tryptophan. High corn or other tryptophan-deficient diets can cause pellagra, which is a niacin-tryptophan deficiency disease with symptoms of dermatitis, diarrhea and dementia. Inborn errors of tryptophan metabolism exist where a tumor (carcinoid) makes excess serotonin. Hartnup's disease is a disease where tryptophan and other amino acids are not absorbed properly. Tryptophan supplements may be useful in each condition, in carcinoid replacing the over-metabolized nutrient and in Hartnup's supplementing a malabsorbed nutrient. Some disorders of excess tryptophan in the blood may contribute to mental retardation. Assessment of tryptophan deficiency is done through studying excretion of tryptophan metabolites in the urine or blood. Blood may be the most sensitive test because the amino acid tryptophan is transported in a unique way. Increased urination of tryptophan fragments correlates with increased tryptophan degradation, which occurs with oral contraception, depression, mental retardation, hypertension and anxiety states. The requirement for tryptophan and protein decreases with age. Adults' minimum daily requirement is 3 mg/kg/day or about 200 mg a day. This may be an underestimation, for there are 400 mg of tryptophan in just a cup of wheat germ. A cup of low fat cottage cheese contains 300 mg of tryptophan and chicken and turkey contain up to 600 mg per pound. (http://www.dcnutrition.com)
Synonyms
  1. (-)-tryptophan
  2. (2S)-2-amino-3-(1H-indol-3-yl)propanoic acid
  3. (S)-1H-Indole-3-alanine
  4. (S)-2-Amino-3-(3-indolyl)propionic acid
  5. (S)-a-Amino-1H-indole-3-propanoate
  6. (S)-a-Amino-1H-indole-3-propanoic acid
  7. (S)-a-Aminoindole-3-propionate
  8. (S)-a-Aminoindole-3-propionic acid
  9. (S)-alpha-Amino-1H-indole-3-propanoic acid
  10. (S)-alpha-Amino-beta-(3-indolyl)-propionic acid
  11. (S)-alpha-Aminoindole-3-propionic acid
  12. (l)-tryptophan
  13. (s)-a-amino-b-indolepropionate
  14. (s)-a-amino-b-indolepropionic acid
  15. (s)-alpha-amino-beta-indolepropionic acid
  16. (s)-tryptophan
  17. 1-beta-3-Indolylalanine
  18. 1H-Indole-3-Alanine
  19. 1beta-3-Indolylalanine
  20. 2-Amino-3-indolylpropanoate
  21. 2-Amino-3-indolylpropanoic acid
  22. 3-Indol-3-ylalanine
  23. Ardeytropin
  24. H-TRP-oh
  25. Indole-3-alanine
  26. Kalma
  27. L-(-)-tryptophan
  28. L-Tryptophan
  29. 3-(1H-indol-3-yl)-L-Alanine
  30. L-alpha-amino-3-indolepropionic acid
  31. L-alpha-aminoindole-3-propionic acid
  32. L-beta-3-indolylalanine
  33. L-tryptofan
  34. L-tryptophane
  35. Lopac-T-0254
  36. Lyphan
  37. Optimax
  38. Pacitron
  39. Sedanoct
  40. Triptofano
  41. Trofan
  42. Tryptacin
  43. Tryptan
  44. Tryptophan
  45. Tryptophane
  46. Tryptophanum
  47. alpha'-Amino-3-indolepropionic acid
  48. alpha-Aminoindole-3-propionic acid
  49. l-b-3-Indolylalanine
  50. (S)-alpha-Amino-1H-indole-3-propanoate
  51. (S)-alpha-Aminoindole-3-propionate
  52. (s)-alpha-amino-beta-indolepropionate
  53. (2S)-2-amino-3-(1H-indol-3-yl)propanoate
Chemical IUPAC Name (2S)-2-amino-3-(1H-indol-3-yl)propanoic acid
Chemical Formula C11H12N2O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids; Indoles and Indole Derivatives
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid; aromatic compound; heterocyclic compound; alpha-aminoacid
Biofunction
  • Essential amino acid; Component of Aminoacyl-tRNA biosynthesis; Component of Histidine metabolism; Component of Indole and ipecac alkaloid biosynthesis; Component of Phenylalanine metabolism; Component of Tryptophan metabolism; Component of Tyrosine metabolism
Application
Source
  • Exogenous
Average Molecular Weight 204.225
Monoisotopic Molecular Weight 204.089874
Isomeric SMILES N[C@@H](CC1=CNC2=CC=CC=C12)C(O)=O
Canonical SMILES NC(CC1=CNC2=CC=CC=C12)C(O)=O
KEGG Compound ID C00078 Link Image
BioCyc ID TRP Link Image
BiGG ID 33772 Link Image
Wikipedia Link Kalma Link Image
METLIN ID 5879 Link Image
PubChem Compound 6305 Link Image
PubChem Substance 10322924 Link Image
ChEBI ID 27897 Link Image
CAS Registry Number 73-22-3
InChI Identifier InChI=1/C11H12N2O2/c12-9(11(14)15)5-7-6-13-10-4-2-1-3-8(7)10/h1-4,6,9,13H,5,12H2,(H,14,15)/t9-/m0/s1
Synthesis Reference Amir-Heidari, Bagher; Thirlway, Jenny; Micklefield, Jason. Stereochemical course of tryptophan dehydrogenation during biosynthesis of the calcium-dependent lipopeptide antibiotics. Organic Letters (2007), 9(8), 1513-1516.
Melting Point (Experimental) 230 oC
Experimental Water Solubility 13.4 mg/mL at 25 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)]; 23.5 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 1.36 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -1.06 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.10 [Predicted by ALOGPS]; -1.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1GC3 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
Biofluid Location
  • Rumen
  • Cow_Milk
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 5-8 uM
Age N/A
Sex Both
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
Biofluid Rumen
Value 10.6 +/- 4.75 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 7 +/- 3 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 10 +/- 3 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 17 +/- 9 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Tryptophan 2,3-dioxygenase
  2. Tryptophanyl-tRNA synthetase, cytoplasmic
  3. Tryptophanyl-tRNA synthetase, mitochondrial
Enzyme 1 [top]
Enzyme 1 ID 12
Enzyme 1 Name Tryptophan 2,3-dioxygenase
Enzyme 1 Synonyms
  1. TDO
  2. Tryptophan pyrrolase
  3. Tryptophanase
  4. Tryptophan oxygenase
  5. TRPO
  6. TO
  7. Tryptamin 2,3-dioxygenase
Enzyme 1 Gene Name TDO2
Enzyme 1 Protein Sequence >Tryptophan 2,3-dioxygenase
MSGCPFLGKSFGYAFKPLSAQGSEEDKSQAGVNRASKGGLIYGNYLQLEKVLNAQELQSE
MKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVITRMHRVVV
ILKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQSLRVPYNRRHY
RDNFRGKDNELLLKSEQERTLLQLVEAWLERTPGLEPHGFNFWGKLEKNIVKGLEEEFTK
IQAKEESEEKEEQMAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYKALQGALMIYFYRE
EPRFQVPFQLLTFLMDVDSLMTKWRYNHVCLVHRMLGSKAGTGGSSGYQYLRSTVSDRYK
VFVDLFNLSTYLVPRHWIPKMNPVIHKFLYTAEYCDSSYFSSDESD
Enzyme 1 Number of Residues 406
Enzyme 1 Molecular Weight 47707.3
Enzyme 1 Theoretical pI 7.76
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin
Enzyme 1 Pathways
  • Amino-acid degradation
  • L-tryptophan degradation via kynurenine pathway
  • L-kynurenine from L-tryptophan:step 1/2
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 86438216 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q2KIQ5 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name T23O_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1221 bp
ATGAGTGGGTGCCCCTTTTTAGGAAAGAGCTTTGGATATGCTTTTAAACCACTCTCTGCA
CAAGGCAGTGAAGAAGACAAATCACAGGCCGGTGTGAACAGAGCCAGTAAAGGAGGACTT
ATCTATGGGAACTACCTGCAATTGGAAAAAGTTTTGAATGCACAGGAGCTTCAAAGTGAA
ATGAAAGGAAATAAAATCCACGATGAACATCTTTTTATCATAACTCATCAAGCTTATGAA
CTCTGGTTTAAGCAGATCCTGTGGGAATTAGATTCTGTTCGTGAGATCTTTCAGAATGGC
CATGTGAGGGATGAGAGGAACATGCTGAAGGTGATCACCCGAATGCACCGAGTGGTGGTG
ATCCTCAAACTCTTGGTCCAGCAGTTTTCCGTCCTGGAGACCATGACAGCCTTGGACTTC
AATGACTTCAGAGAGTACTTATCCCCGGCGTCCGGCTTCCAGAGTCTGCAGTTCCGCCTG
TTAGAAAACAAGATAGGGGTTCTGCAGAGCTTGAGGGTCCCTTACAACAGAAGACACTAC
CGCGACAACTTCAGAGGGAAAGACAACGAGCTTCTGCTGAAGTCCGAGCAAGAAAGGACG
CTTCTGCAGCTGGTTGAGGCATGGCTGGAAAGAACCCCAGGTTTAGAGCCGCATGGATTT
AACTTCTGGGGAAAGCTTGAAAAGAACATTGTCAAAGGTTTGGAAGAAGAATTCACAAAG
ATTCAGGCTAAGGAAGAGTCAGAGGAAAAGGAGGAACAAATGGCTGAATTTCAGAAGCAG
AAAGAGGTATTACTGTCCTTATTTGATGAGAAACGTCATGAGCATCTCCTTAGTAAAGGA
GAAAGACGGCTATCGTACAAAGCACTTCAGGGGGCCTTGATGATATATTTTTACAGGGAA
GAGCCCAGGTTCCAGGTCCCTTTCCAGCTGCTGACTTTCCTCATGGATGTGGACTCACTC
ATGACCAAGTGGAGATATAACCACGTGTGCCTGGTGCACAGGATGCTCGGCAGCAAGGCG
GGCACTGGCGGGTCCTCTGGGTACCAGTACCTGCGCTCCACCGTGAGTGACAGGTACAAA
GTATTTGTAGATTTATTTAATCTCTCAACATATCTGGTTCCCCGACACTGGATTCCGAAG
ATGAACCCAGTCATTCATAAGTTCCTTTACACGGCTGAATACTGTGACAGCTCTTACTTC
AGCAGTGATGAATCAGATTAA
Enzyme 1 GenBank Gene ID BC112550 Link Image
Enzyme 1 GeneCard ID TDO2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:4
Enzyme 1 Locus 4q31-q32
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 928
Enzyme 2 Name Tryptophanyl-tRNA synthetase, cytoplasmic
Enzyme 2 Synonyms
  1. Tryptophan--tRNA ligase
  2. TrpRS
Enzyme 2 Gene Name WARS
Enzyme 2 Protein Sequence >Tryptophanyl-tRNA synthetase, cytoplasmic
MADMSNGEQGCGSPLELFHSIAAQGELVRDLKARNAAKDEIDSAVKMLLSLKTSYKAATG
EDYKVDCPPGDPAPESGEGLDATEADEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKE
LVNRIERATGQRPHRFLRRGIFFSHRDMHQILDAYENKKPFYLYTGRGPSSEAMHVGHLI
PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGYAVENAKDIIACGFDINKTFIF
SDLDYMGMSPGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQ
IFRDRTDVQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDP
NSSIFLTDTAKQIKTKVNKHAFSGGRDTVEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQ
IRRDYTSGAMLTGELKKELIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSYDFQ
Enzyme 2 Number of Residues 476
Enzyme 2 Molecular Weight 53811.6
Enzyme 2 Theoretical pI 5.51
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Translation, ribosomal structure and biogenesis
Enzyme 2 Specific Function ATP + L-tryptophan + tRNA(Trp) = AMP + diphosphate + L-tryptophyl-tRNA(Trp)
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 825 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P17248 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name SYWC_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1428 bp
ATGGCAGACATGTCCAATGGCGAGCAGGGCTGTGGGTCCCCCCTGGAGCTGTTCCACAGC
ATCGCTGCTCAGGGGGAGCTCGTAAGGGACCTCAAAGCCAGAAACGCAGCCAAGGATGAA
ATTGATTCTGCAGTGAAGATGTTGTTGTCCTTAAAAACGAGCTACAAAGCTGCCACAGGG
GAGGATTACAAGGTGGACTGTCCTCCAGGGGACCCGGCGCCTGAGAGTGGTGAGGGCCTG
GATGCCACCGAAGCAGACGAGGACTTTGTGGATCCCTGGACAGTGCAGACAAGCAGCGCC
AAAGGCATTGACTACGACAAGCTCATTGTTCGATTTGGAAGCAGTAAAATTGACAAGGAG
CTGGTAAACCGAATAGAGAGAGCCACGGGCCAGAGACCACACCGCTTCCTGCGCAGGGGA
ATCTTCTTCTCACACAGAGACATGCATCAGATTCTGGATGCCTATGAAAACAAGAAGCCG
TTCTATCTCTACACGGGCAGGGGCCCCTCTTCTGAAGCCATGCATGTGGGTCACCTCATC
CCATTCATCTTCACCAAGTGGCTGCAGGATGTGTTCAACGTCCCCTTGGTCATCCAGATG
ACTGATGACGAGAAGTACCTGTGGAAGGACCTGACCCTGGATCAGGCCTATGGCTACGCT
GTGGAGAACGCCAAGGATATCACGTGCGGCTTTGACATCAACAAAACGTTCATCTTCTCT
GACCTTGACTACATGGGGATGAGCCCTGGCTTCTACAAGAACGTGGTGAAGATCCAGAAG
CACGTCACCTTCAACCAAGTGAAAGGCATTTTCGGCTTCACTGACAGCGACTGCATTGGG
AAGATCAGTTTTCCTGCCATCCAGGCCGCTCCCTCCTTCAGCAACTCATTCCCTCAGATC
TTCCGAGACCGGACGGACGTCCAGTGCCTCATCCCGTGCGCCATCGACCAGGACCCGTAC
TTCAGGATGACCAGGGACGTGGCCCCCAGGATCGGCTACCCCAAGCCAGCCCTCTTGCAC
TCGACCTTCTTCCCTGCCCTGCAGGGGGCCCAGACCAAGATGAGTGCCAGTGACCCCAAC
TCTTCCATCTTCCTCACGGACACGGCCAAGCAGATCAAGACCAAGGTCAACAAGCACGCC
TTCTCCGGAGGCAGGGACACCGTTGAGGAGCACCGGCAGTTTGGGGGCAACTGTGACGTG
GACGTGTCCTTCATGTACCTGACCTTCTTCCTGGAGGATGATGACAAGCTGGAGCAGATC
AGGAGGGACTACACGAGCGGGGCCATGCTCACCGGCGAGCTCAAGAAGGAGCTCATCGAA
GTCCTGCAGCCCTTGATTGCCGAGCACCAGGCCCGGCGCAAGGAGGTCACCGACGAGATC
GTGAAAGAATTCATGACCCCCCGGAAGCTGTCCTACGACTTTCAGTAA
Enzyme 2 GenBank Gene ID X53918 Link Image
Enzyme 2 GeneCard ID WARS Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 14q32.31
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 929
Enzyme 3 Name Tryptophanyl-tRNA synthetase, mitochondrial
Enzyme 3 Synonyms
  1. Tryptophan--tRNA ligase
  2. TrpRS
  3. (Mt)TrpRS
Enzyme 3 Gene Name WARS2
Enzyme 3 Protein Sequence >Tryptophanyl-tRNA synthetase, mitochondrial
MALRSMRKARECWNFIRALHQGPDAAPVPQKDAVKRIFSGIQPTGIPHLGNYLGAIESWV
RLQDEHDSVLYSIVDLHSITVPQDPTILRQSILDMTAALLACGINPEKSILFQQSQVSEH
TQLSWILTCMVRLPRLQHLHQWKAKTAKEKHNGTVGLLTYPVLQAADILLYKSTHVPVGE
DQVQHMELVQDLAQSFNKKYGEFFPVPKSILTSMKKVKSLRDPSAKMSKSDPDKLATVRI
TDSPEEIVQKFRKAMTDFTSEVTYEPASRGGVSNLVAIHAAVAGLPVEEVVRRSAGMDTA
RYKLVVADAVIEKFAPIKSEIEKLKMNKDHLEKVLQVGSARAKELAYPVCQEVKKLVGFL
Enzyme 3 Number of Residues 360
Enzyme 3 Molecular Weight 40204.4
Enzyme 3 Theoretical pI 9.56
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Translation, ribosomal structure and biogenesis
Enzyme 3 Specific Function ATP + L-tryptophan + tRNA(Trp) = AMP + diphosphate + L-tryptophyl-tRNA(Trp)
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 74268052 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q3T099 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name SYWM_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1083 bp
ATGGCGCTGCGCTCAATGCGGAAAGCGCGTGAGTGCTGGAACTTCATCCGGGCACTTCAT
CAAGGACCCGACGCTGCTCCCGTTCCCCAGAAAGATGCCGTGAAGCGAATATTCTCGGGC
ATTCAGCCTACAGGAATCCCCCACCTCGGCAACTATCTGGGAGCCATTGAGAGCTGGGTG
AGGTTACAGGACGAGCATGACTCCGTGCTGTACAGTATTGTTGACCTGCATTCCATCACT
GTCCCCCAGGACCCAACCATCCTCCGGCAGAGCATCTTGGACATGACTGCTGCTCTTCTT
GCTTGTGGCATCAACCCAGAGAAGAGCATCCTTTTCCAGCAATCTCAGGTGTCTGAGCAC
ACACAATTAAGTTGGATCCTTACCTGCATGGTCAGATTACCTCGATTACAACATTTACAC
CAGTGGAAGGCAAAGACTGCCAAGGAGAAACATAATGGAACCGTGGGGCTGCTCACATAC
CCAGTGCTCCAGGCAGCTGACATTCTGCTGTACAAGTCCACACATGTTCCTGTTGGGGAG
GATCAAGTCCAGCACATGGAGCTAGTTCAGGATCTAGCACAAAGTTTTAACAAGAAGTAT
GGGGAGTTCTTCCCAGTACCCAAGTCCATTCTGACATCAATGAAGAAGGTGAAGTCGCTG
CGTGATCCCTCTGCCAAAATGTCGAAATCAGACCCCGATAAACTGGCCACTGTCAGAATA
ACCGACAGCCCAGAGGAGATAGTGCAGAAGTTCCGCAAGGCTATGACAGACTTCACCTCG
GAGGTCACCTACGAGCCCGCCAGCCGAGGAGGCGTGTCCAACCTGGTGGCCATTCACGCA
GCGGTGGCCGGGCTCCCCGTGGAGGAGGTGGTCCGCCGCAGCGCTGGGATGGACACTGCT
CGCTACAAGCTGGTGGTGGCAGATGCTGTGATTGAGAAATTTGCTCCAATTAAGAGTGAG
ATTGAAAAACTGAAGATGAACAAGGACCACTTAGAGAAAGTTTTGCAAGTTGGGTCGGCA
AGAGCCAAAGAATTAGCATATCCCGTGTGCCAGGAGGTGAAGAAATTGGTGGGCTTTCTA
TAA
Enzyme 3 GenBank Gene ID BC102487 Link Image
Enzyme 3 GeneCard ID WARS2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1p13.3-p13.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available