We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Molybdenum (RMDB01302)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-16 13:59:59
Update Date 2009-03-27 17:07:54
Accession Number RMDB01302
Common Name Molybdenum
Description Molybdenum is a transition metal with the atomic symbol Mo, atomic number 42, and atomic weight 95.94. The pure metal is silvery white in color, fairly soft, and has one of the highest melting points of all pure elements. Physiologically, it exists as an ion in the body. It is an essential trace element, being a component of the enzymes xanthine oxidase, aldehyde oxidase, and nitrate reductase. There is a trace requirement for molybdenum in plants, and soils can be barren due to molybdenum deficiencies. Plants and animals generally have molybdenum present in amounts of a few parts per million. In animals molybdenum is a cofactor of the enzyme xanthine oxidase which is involved in the pathways of purine degradation and formation of uric acid. In some animals, adding a small amount of dietary molybdenum enhances growth. Francis Crick suggested that since molybdenum is an essential trace element that plays an important role in many enzymatic reactions, despite being less abundant than the more common elements, such as chromium and nickel, that perhaps this fact is indicative of "Panspermia." Crick theorized that if it could be shown that the elements represented in terrestrial living organisms correlate closely with those that are abundant in some class of star - molybdenum stars, for example, that this would provide evidence of such Directed Panspermia. In small quantities, molybdenum is effective at hardening steel. Molybdenum is important in plant nutrition, and is found in certain enzymes, including xanthine oxidase. Molybdenum is used to this day in high-strength alloys and in high-temperature steels. Special molybdenum-containing alloys, such as the Hastelloys, are notably heat-resistant and corrosion-resistant. Molybdenum is used in oil pipelines, aircraft and missile parts, and in filaments. Molybdenum finds use as a catalyst in the petroleum industry, especially in catalysts for removing organic sulfurs from petroleum products. It is used to form the anode in some x-ray tubes, particularly in mammography applications. And is found in some electronic applications as the conductive metal layers in thin-film transistors (TFTs). Molybdenum disulfide is a good lubricant, especially at high temperatures. And Mo-99 is used in the nuclear isotope industry. Molybdenum pigments range from red-yellow to a bright red orange and are used in paints, inks, plastics, and rubber compounds.
Synonyms
  1. Mo
  2. Molybdaen
  3. Molybdene
  4. Molybdenum atom
  5. Molybdenum elemental
  6. Molybdenum insoluble compounds
  7. Molybdenum metallic
Chemical IUPAC Name molybdenum
Chemical Formula [Mo]2+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals; Component of Riboflavin metabolism
Application
Source
  • Exogenous
Average Molecular Weight 95.940
Monoisotopic Molecular Weight 97.905411
Isomeric SMILES [Mo++]
Canonical SMILES [Mo++]
KEGG Compound ID C00150 Link Image
BioCyc ID CPD-8123 Link Image
BiGG ID Not Available
Wikipedia Link Molybdenum Link Image
METLIN ID Not Available
PubChem Compound 23932 Link Image
PubChem Substance 8022232 Link Image
ChEBI ID 28685 Link Image
CAS Registry Number 7439-98-7
InChI Identifier InChI=1/Mo/q+2
Synthesis Reference Not Available
Melting Point (Experimental) 2622 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 76.6 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 0.23 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location Not Available
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 0.0187+/- 0.008 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. MOSC domain-containing protein 2, mitochondrial
  2. Xanthine dehydrogenase/oxidase
  3. Aldehyde oxidase
Enzyme 1 [top]
Enzyme 1 ID 221
Enzyme 1 Name MOSC domain-containing protein 2, mitochondrial
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name MOSC2
Enzyme 1 Protein Sequence >MOSC domain-containing protein 2, mitochondrial
MGAAGSSALARLGLPALPGPRWLGVAALGLAAVALGAVAWRRARPGRRRRLQQVGTVSEL
WIYPIKSCKGVSVDAAECTALGLRSGHLRDRFWLVIKEDGHMVTGRQEPQLVLVSITYED
DCLILRAPGMDQLVLPTKLLSSNKLHDCRVFGLDIQGRDCGDEAAQWFTSFLKTDAFRLV
QFEKNMKARASNEIFPSLDKNYQVAYPDCSPVMILSEASLADLNTRMEKKVKINNFRPNI
VVTGCSAFEEDTWDELLIGNVEMKKILACPRCIMTTVDPDTGVIDRKEPLETLKSYRLCD
PSEKSIYKSSPLFGIYYSVEKIGSLKVGDPVYQMVQ
Enzyme 1 Number of Residues 336
Enzyme 1 Molecular Weight 37287.9
Enzyme 1 Theoretical pI 8.24
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in molybdenum ion binding
Enzyme 1 Specific Function Catalytic component of the benzamidoxime prodrug- converting complex, a complex required to reduce N-hydroxylated structures, such as benzamidoxime
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 94534830 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q1LZH1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name MOSC2_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1011 bp
ATGGGCGCCGCCGGCTCCTCGGCTCTGGCCCGCTTGGGCCTCCCCGCGCTGCCCGGGCCC
CGCTGGCTGGGGGTGGCCGCCCTGGGACTGGCCGCAGTGGCGCTGGGGGCCGTCGCCTGG
CGCCGCGCGCGGCCCGGTCGGCGCCGGCGGCTGCAGCAGGTGGGCACGGTGAGCGAGCTG
TGGATCTACCCGATCAAATCCTGCAAAGGGGTGTCGGTGGACGCGGCCGAGTGCACGGCC
CTGGGGCTGCGCAGCGGCCACCTGCGGGACAGGTTTTGGCTGGTGATAAAGGAAGATGGA
CACATGGTGACTGGCCGGCAGGAACCTCAGCTTGTGCTGGTCTCCATCACCTATGAGGAC
GATTGCCTGATCCTCAGGGCTCCAGGCATGGACCAGCTGGTTTTGCCGACCAAACTGCTT
TCTTCAAACAAGCTCCATGACTGCAGGGTGTTTGGTCTTGACATCCAGGGCAGGGACTGT
GGCGACGAGGCTGCTCAGTGGTTCACCAGCTTCTTGAAAACGGACGCGTTCAGGCTGGTT
CAGTTTGAAAAGAACATGAAGGCAAGAGCGTCAAATGAAATTTTCCCTTCTTTGGACAAG
AATTACCAGGTGGCCTACCCGGACTGCAGCCCCGTCATGATCCTGTCGGAAGCCTCCCTG
GCCGATCTGAATACCAGGATGGAGAAGAAAGTGAAAATAAACAATTTCAGGCCAAATATC
GTGGTGACAGGCTGCAGTGCTTTTGAGGAGGACACTTGGGATGAACTTCTCATTGGCAAT
GTAGAAATGAAAAAGATTTTGGCTTGCCCCAGGTGCATTATGACCACGGTGGACCCAGAT
ACTGGAGTGATTGACAGGAAGGAGCCACTCGAAACCCTGAAGAGTTACCGCCTGTGTGAT
CCTTCTGAGAAGTCAATTTACAAGTCGTCCCCACTGTTTGGAATCTATTACTCGGTGGAA
AAAATTGGAAGCCTGAAAGTTGGTGACCCCGTGTACCAGATGGTGCAGTGA
Enzyme 1 GenBank Gene ID BC116001 Link Image
Enzyme 1 GeneCard ID MOSC2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 1q41
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 603
Enzyme 2 Name Xanthine dehydrogenase/oxidase
Enzyme 2 Synonyms
  1. Xanthine dehydrogenase
  2. XD
  3. Xanthine oxidase
  4. XO
  5. Xanthine oxidoreductase
Enzyme 2 Gene Name XDH
Enzyme 2 Protein Sequence >Xanthine dehydrogenase/oxidase
MTADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDR
LQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAKNGGCCGGNGNNPNCC
MNQKKDHTVTLSPSLFNPEEFMPLDPTQEPIFPPELLRLKDVPPKQLRFEGERVTWIQAS
TLKELLDLKAQHPEAKLVVGNTEIGIEMKFKNQLFPMIICPAWIPELNAVEHGPEGISFG
AACALSSVEKTLLEAVAKLPTQKTEVFRGVLEQLRWFAGKQVKSVASLGGNIITASPISD
LNPVFMASGTKLTIVSRGTRRTVPMDHTFFPSYRKTLLGPEEILLSIEIPYSREDEFFSA
FKQASRREDDIAKVTCGMRVLFQPGSMQVKELALCYGGMADRTISALKTTQKQLSKFWNE
KLLQDVCAGLAEELSLSPDAPGGMIEFRRTLTLSFFFKFYLTVLKKLGKDSKDKCGKLDP
TYTSATLLFQKDPPANIQLFQEVPNGQSKEDTVGRPLPHLAAAMQASGEAVYCDDIPRYE
NELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSADDIPGSNETGLFNDETVFAKDTV
TCVGHIIGAVVADTPEHAERAAHVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGDLK
KGFSEADNVVSGELYIGGQDHFYLETHCTIAIPKGEEGEMELFVSTQNAMKTQSFVAKML
GVPVNRILVRVKRMGGGFGGKETRSTLVSVAVALAAYKTGHPVRCMLDRNEDMLITGGRH
PFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFHMDNCYKIPNIRGTGRL
CKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKEGDLTHFNQRLE
GFSVPRCWDECLKSSQYYARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGAL
IHVYTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYISETSTNTVPNSSPTAAS
VSTDIYGQAVYEACQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVSLSTTGFYRTPNLGY
SFETNSGNAFHYFTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFV
QGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPTEFRVSLLRDCPNKKAIYASKAVG
EPPLFLGASVFFAIKDAIRAARAQHTNNNTKELFRLDSPATPEKIRNACVDKFTTLCVTG
APGNCKPWSLRV
Enzyme 2 Number of Residues 1332
Enzyme 2 Molecular Weight 146789.3
Enzyme 2 Theoretical pI 7.78
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Nucleotide transport and metabolism
Enzyme 2 Specific Function This enzyme can be converted from the dehydrogenase form (D) to the oxidase form (O) irreversibly by proteolysis or reversibly through the oxidation of sulfhydryl groups
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 1321704 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P80457 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name XDH_BOVIN Link Image
Enzyme 2 PDB ID 1V97 Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >3999 bp
ATGACAGCAGATGAATTGGTTTTCTTTGTGAATGGCAAAAAGGTGGTGGAGAAAAATGCA
GATCCAGAAACAACCCTTTTGGCCTACCTGAGAAGAAAGTTGGGGCTGAGAGGAACCAAG
CTGGGCTGTGGAGAAGGGGGCTGTGGGGCTTGTACAGTGATGCTTTCCAAGTATGATCGT
CTCCAAGACAAGATCATCCACTTTTCTGCCAATGCCTGCCTGGCTCCCATCTGCACCTTG
CACCACGTGGCTGTGACGACTGTGGAAGGAATTGGAAGCACCAAGACGAGGCTGCATCCT
GTGCAGGAGAGAATCGCCAAAAGTCACGGCTCTCAGTGTGGGTTCTGCACCCCCGGCATC
GTCATGAGCATGTACACACTGCTTCGGAATCAGCCCGAGCCCACTGTTGAAGAAATCGAG
GATGCTTTCCAAGGAAACTTATGCCGCTGTACAGGCTACAGACCCATCCTCCAGGGCTTC
CGGACCTTTGCCAAGAATGGTGGATGCTGTGGAGGAAATGGGAACAACCCAAACTGCTGC
ATGAACCAGAAGAAAGACCACACCGTTACTCTCTCACCATCTTTATTCAACCCAGAGGAG
TTCATGCCCCTGGATCCTACCCAGGAACCCATCTTCCCTCCAGAGTTGCTGAGGCTGAAA
GACGTTCCACCGAAGCAGCTGCGTTTTGAAGGGGAGCGTGTGACCTGGATCCAAGCCTCC
ACCTTGAAGGAGTTGCTGGACCTCAAAGCTCAGCATCCCGAGGCCAAGCTGGTGGTGGGG
AACACAGAGATCGGCATTGAGATGAAGTTTAAGAATCAGCTATTTCCTATGATCATCTGC
CCAGCCTGGATCCCTGAGCTGAATGCAGTGGAGCACGGACCTGAGGGGATCTCCTTTGGA
GCTGCTTGTGCCCTGAGCTCTGTGGAAAAGACCCTGCTCGAGGCCGTTGCCAAGCTTCCC
ACCCAGAAAACGGAGGTGTTCAGAGGAGTCCTGGAGCAGCTGCGCTGGTTCGCTGGGAAG
CAGGTCAAGTCTGTGGCGTCCCTTGGAGGGAACATCATCACAGCCAGCCCCATCTCTGAC
CTCAACCCTGTGTTCATGGCCAGTGGGACCAAGCTGACCATCGTGTCCAGAGGCACCAGA
AGAACAGTTCCAATGGACCACACCTTCTTCCCCAGCTACAGAAAGACCCTGCTGGGTCCA
GAGGAGATACTGCTCTCCATTGAGATCCCCTACAGCAGGGAGGATGAGTTTTTCTCAGCA
TTCAAGCAGGCAAGCCGGAGAGAAGATGACATAGCCAAGGTGACCTGCGGCATGAGAGTC
CTGTTCCAGCCAGGAAGCATGCAGGTAAAGGAGCTAGCCCTCTGCTATGGCGGAATGGCG
GACAGAACCATCTCAGCCCTCAAGACCACGCAGAAGCAGCTGTCAAAGTTCTGGAATGAG
AAGCTGCTACAGGACGTGTGTGCAGGCCTGGCGGAAGAACTGTCCTTATCCCCAGACGCC
CCTGGAGGCATGATTGAATTCCGACGCACCCTCACCCTCAGCTTCTTCTTCAAGTTCTAC
CTGACAGTACTGAAGAAACTGGGCAAGGACTCGAAAGATAAGTGTGGTAAACTGGACCCC
ACCTACACCAGCGCCACTTTACTCTTTCAGAAACACCCTCCAGCCAACATCCAGCTCTTC
CAAGAGGTGCCCAATGGTCAGTCCAAGGAGGACACAGTGGGCCGGCCCCTGCCCCACCTG
GCCGCGGCCATGCAAGCCTCTGGGGAGGCCGTATACTGTGACGACATCCCTCGCTACGAG
AATGAGCTGTTCCTCCGGCTGGTCACCAGCACCCGGGCCCACGCCAAGATCAAGTCCATT
GATGTTTCAGAAGCTCAGAAAGTGCCAGGATTTGTTTGCTTTCTCTCTGCTGATGATATT
CCCGGGAGTAATGAAACCGGACTCTTTAATGATGAGACAGTCTTTGCGAAGGATACGGTG
ACTTGTGTTGGTCACATCATTGGTGCTGTGGTCGCTGACACCCCAGAACATGCAGAGAGA
GCTGCCCATGTAGTGAAAGTCACCTATGAGGATCTTCCTGCCATTATCACAATTGAGGAT
GCTATAAAAAATAATTCCTTTTATGGATCTGAGCTGAAGATTGAGAAAGGAGACCTCAAG
AAGGGGTTTTCAGAAGCAGATAATGTGGTTTCAGGTGAGCTGTACATTGGTGGCCAAGAC
CACTTCTACCTGGAGACTCACTGCACCATTGCTATCCCGAAAGGCGAGGAAGGGGAGATG
GAGCTCTTTGTGTCCACACAGAATGCCATGAAAACCCAGTCCTTTGTTGCAAAAATGTTG
GGGGTTCCAGTAAACCGGATTTTGGTCCGAGTGAAGAGAATGGGAGGAGGCTTTGGAGGG
AAGGAGACCCGGAGCACCCTGGTGTCTGTGGCTGTGGCCCTGGCTGCATACAAGACTGGA
CACCCGGTGCGCTGCATGCTGGATCGTAATGAGGATATGCTGATAACTGGCGGCAGACAC
CCCTTCTTGGCCAGATACAAGGTTGGCTTCATGAAGACAGGGACGATTGTGGCTCTAGAG
GTGGATCACTACAGCAATGCCGGGAACAGCCGGGACCTCTCTCACAGTATAATGGAACGA
GCTCTATTCCACATGGACAACTGCTATAAAATCCCCAACATCCGGGGCACTGGGCGGCTG
TGCAAGACCAACCTGTCCTCCAACACGGCCTTCCGGGGCTTTGGGGGGCCCCAGGCTCTG
TTCATTGCCGAGAACTGGATGAGCGAAGTTGCAGTGACCTGTGGGCTGCCTGCAGAGGAA
GTGCGGTGGAAGAACATGTACAAAGAAGGGGACCTGACCCACTTCAACCAGAGGCTTGAG
GGGTTCAGCGTGCCCAGGTGCTGGGATGAGTGCCTGAAGAGCTCTCAGTATTACGCTCGG
AAGAGTGAGGTCGACAAGTTCAACAAGGAGAATTGTTGGAAAAAGAGAGGATTGTGCATA
ATTCCTACCAAATTTGGAATAAGCTTCACAGTTCCTTTTCTAAATCAGGCAGGAGCCCTG
ATCCACGTATACACAGATGGCTCCGTGCTGGTGAGCCACGGGGGCACAGAGATGGGCCAA
GGCCTTCACACCAAGATGGTGCAGGTGGCCAGCAAAGCTCTGAAGATCCCCATCTCTAAG
ATCTATATCAGCGAGACGAGCACTAACACGGTGCCCAACTCCTCTCCCACGGCCGCCTCC
GTCAGTACCGACATCTATGGACAGGCCGTCTATGAAGCTTGCCAGACCATCCTGAAAAGG
TTGGAACCCTTCAAGAAAAAGAATCCTGATGGCTCCTGGGAAGACTGGGTCATGGCTGCC
TACCAGGATAGAGTGAGCTTATCTACCACTGGGTTTTACAGGACACCCAACCTTGGCTAC
AGCTTTGAGACCAACTCAGGGAATGCCTTCCACTATTTCACCTACGGGGTGGCTTGCTCA
GAAGTGGAAATTGACTGTTTGACAGGGGATCATAAGAACCTCCGTACAGACATTGTCATG
GATGTTGGCTCCAGTCTGAACCCTGCCATCGATATTGGACAGGTGGAAGGGGCGTTTGTC
CAGGGCCTGGGCCTCTTCACCCTGGAGGAGCTACACTATTCCCCTGAGGGGAGCCTGCAC
ACCCGCGGCCCCAGCACCTACAAGATCCCCGCGTTTGGCAGCATCCCCACAGAGTTCAGG
GTGTCCCTGCTTCGCGACTGCCCCAACAAGAAGGCCATCTATGCCTCCAAGGCGGTCGGG
GAGCCGCCCCTCTTCCTGGGCGCCTCCGTCTTCTTTGCCATCAAGGATGCCATCCGCGCG
GCTCGAGCTCAGCACACAAATAATAACACGAAGGAGCTCTTCCGGCTAGATAGCCCTGCC
ACCCCGGAGAAGATCCGCAATGCCTGCGTGGACAAGTTCACCACTCTGTGTGTCACTGGT
GCACCAGGAAACTGTAAACCCTGGTCTCTGAGGGTCTGA
Enzyme 2 GenBank Gene ID X83508 Link Image
Enzyme 2 GeneCard ID XDH Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 2p23.1
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 677
Enzyme 3 Name Aldehyde oxidase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name AOX1
Enzyme 3 Protein Sequence >Aldehyde oxidase
MEGGSELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKTRIHPVQERIAKCHGTQCGFCTPG
MVMSLYTLLRNHPEPTLTQLNDALGGNLCRCTGYRPIINACKTFCKTSGCCQSKENGVCC
LDQGMNGLPEFEEGNETSLKLFSEEEFLPLDPTQELIFPPELMTMAEKKTQKTRIFGSDR
MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDMKFKGIFHPVIISPDRIEELSVVNYT
DNGLTLGAAVSLAEVKDILANVTRKLPEEKTQMYHALLKHLETLAGPQIRNMASLGGHIV
SRHPDSDLNPLLAVGNCTLNLLSKEGRRQIPLNEQFLRKCPSADLKPEEILISVNIPYSR
KWEFVSAFRQAQRQQNALAIVNSGMRVCFGKGDGIIRELSIAYGGVGPTTILANNSCQKL
IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFKRTLIVSFLFKFYLEVSQILKGMDLV
HYPSLASKYESALEDLHSRHYWSTLKYQNADLKQLSQDPIGHPIMHLSGIKHATGEAIYC
DDMPVVDRELFLTFVTSSRAHAKIVSIDVSAALSLPGVVDILTGEHLPGINTTFGFLTDA
DQLLSTDEVSCVGQLVCAVIADSEVQARRAAQQVKIVYQDLEPVILTIEEAIQNKSFFEP
ERKLEYGNVDEAFKMVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDREIDVYVSAQFPK
YIQDITASVLKVSANKVMCHVKRVGGAFGGKVTKTGVLAAITAFAANKHGRPVRCILERG
EDILITGGRHPYLGKYKAGFMNDGRILALDMEHYNNAGAFLDESLFVIEMGLLKLENAYK
FPNLRCRGWACRTNLPSNTALRGFGFPQAGLITEACITEVAAKCGLPPEKVRMINMYKEI
DQTPYKQEINTKNLTQCWKECMATSSYTLRKAAVEKFNSENYWKKKGLAMVPLKYPIGLG
SVAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPLSSIHLRGTSTET
IPNTNPSGGSVVADLNGLAVKDACQTLLKRLKPIISKNPKGTWKDWAQAAFNESISLSAT
GYFRGYESNINWETGEGHPFEYFVYGAACSEVEIDCLTGAHKNIRTDIVMDVGYSINPAL
DVGQIEGAFIQGMGLYTIEELNYSPQGVLYTRGPNQYKIPAICDIPMELHISFLPPSENS
NTLYSSKGLGESGIFLGCSVFFAIHDAIRAARQERGLPGPLRLNSPLTPEKIRMACEDKF
TKMIPRDEPGSYVPWSVPI
Enzyme 3 Number of Residues 1339
Enzyme 3 Molecular Weight 147610.1
Enzyme 3 Theoretical pI 7.29
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Nucleotide transport and metabolism
Enzyme 3 Specific Function An aldehyde + H(2)O + O(2) = a carboxylic acid + H(2)O(2)
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 1149575 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P48034 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name ADO_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >4020 bp
ATGGAAGGGGGCTCCGAGCTGCTCTTCTACGTGAACGGCCGCAAGGTGACAGAAAAAAAT
GTTGATCCTGAAACAATGCTATTGCCATATCTGAGGAAAAAGCTCCGACTCACAGGAACT
AAATATGGCTGTGGAGGGGGAGGCTGTGGTGCCTGCACAGTGATGATATCACGATATAAC
CCCATTACCAAGAAGATAAGACATTATCCAGCCAACGCCTGTCTGACGCCCATCTGTTCT
CTGTATGGGGCTGCCGTCACCACAGTAGAAGGCATAGGAAGCACCAAGACCAGGATTCAT
CCTGTTCAGGAGAGGATTGCCAAGTGTCACGGCACGCAGTGTGGCTTCTGCACCCCCGGG
ATGGTGATGTCCCTGTACACGCTGCTGAGGAACCATCCGGAGCCCACCCTGACTCAGCTA
AATGATGCTCTTGGTGGTAACCTGTGTCGTTGCACTGGATACAGGCCCATAATCAATGCA
TGCAAGACTTTCTGTAAAACTTCTGGCTGCTGTCAAAGTAAAGAAAATGGGGTTTGCTGT
TTGGATCAAGGAATGAATGGATTACCAGAATTTGAGGAAGGAAATGAGACAAGTCTGAAA
CTCTTCTCAGAAGAGGAGTTTCTGCCATTGGATCCAACTCAAGAGCTGATATTTCCTCCC
GAGCTAATGACAATGGCTGAGAAAAAAACACAGAAGACCAGGATTTTTGGTAGTGATAGA
ATGACCTGGATTTCCCCAGTGACCCTGAAGGAACTTCTAGAAGCCAAAGTCAAGTATCCC
CAGGCCCCTGTTGTCATGGGGAACACCTCTGTGGGCCCTGACATGAAATTTAAAGGCATC
TTTCACCCAGTTATAATTTCTCCTGATAGAATTGAAGAACTGAGTGTTGTAAACTATACA
GATAACGGGCTGACCTTAGGTGCTGCTGTCAGCCTCGCTGAGGTGAAAGACATCCTGGCT
AATGTGACCCGGAAACTCCCTGAGGAGAAGACACAGATGTACCATGCTCTCCTGAAACAT
TTGGAAACTCTGGCTGGGCCGCAGATCAGGAATATGGCTTCTTTAGGGGGCCACATAGTG
AGCAGGCATCCAGATTCAGATCTGAACCCTCTCCTGGCTGTGGGCAACTGTACCCTCAAC
CTGCTGTCAAAAGAAGGAAGACGACAGATTCCTTTAAATGAGCAGTTTCTCAGAAAGTGC
CCAAGTGCCGATCTTAAGCCTGAAGAAATCTTGATCTCAGTGAACATCCCCTATTCAAGG
AAGTGGGAGTTTGTGTCAGCCTTCCGACAAGCCCAGCGGCAACAGAATGCGCTTGCAATA
GTTAATTCGGGAATGAGAGTGTGTTTTGGAAAAGGAGATGGCATCATCAGAGAGTTATCC
ATTGCATACGGAGGCGTTGGTCCAACCACCATCCTTGCAAATAATTCCTGCCAGAAACTC
ATTGGAAGGCCCTGGAATGAAGAGATGCTGGATGCAGCTTGCAGGCTGATTCTGGATGAA
GTCTCCCTCCCAGGCTCAGCCCCAGGTGGGAGGGTGGAGTTCAAGAGGACCCTCATTGTC
AGCTTCCTGTTCAAGTTCTACCTGGAAGTGTCACAGATTTTGAAGGGGATGGACCTTGTT
CACTATCCTAGCCTTGCAAGCAAATATGAGAGTGCTTTAGAAGATCTTCATTCCAGACAT
TACTGGAGTACATTAAAGTACCAGAATGCAGACCTAAAGCAGCTTTCTCAAGACCCAATT
GGCCATCCCATCATGCACCTGTCTGGTATTAAGCATGCCACGGGCGAAGCCATCTACTGT
GACGACATGCCTGTGGTGGACCGGGAACTGTTCTTGACTTTTGTAACAAGTTCAAGAGCT
CATGCTAAGATTGTGTCTATCGATGTCTCTGCAGCTCTCAGCCTGCCTGGGGTGGTAGAC
ATCCTGACTGGGGAACATCTTCCAGGCATCAACACCACCTTTGGCTTTTTAACTGACGCT
GATCAACTTCTGTCAACAGATGAGGTGTCTTGTGTGGGTCAGCTTGTCTGCGCCGTGATA
GCCGATTCCGAGGTCCAGGCAAGGCGAGCTGCTCAGCAAGTGAAGATTGTCTACCAAGAT
TTGGAGCCAGTGATCCTAACCATTGAGGAAGCTATACAAAACAAGTCCTTCTTTGAGCCA
GAGAGGAAACTGGAGTATGGAAATGTGGATGAAGCATTTAAAATGGTGGATCAAATTCTT
GAAGGTGAAATACACATGGGAGGTCAAGAACACTTTTATATGGAAACCCAGAGCATGCTG
GTTGTTCCCAAAGGAGAAGATCGAGAAATCGATGTCTACGTGTCTGCTCAGTTTCCTAAA
TACATACAGGACATAACTGCTTCAGTCTTGAAGGTCTCAGCTAACAAAGTCATGTGTCAC
GTAAAGCGTGTTGGTGGAGCCTTTGGGGGAAAGGTGACAAAAACTGGCGTCCTGGCAGCC
ATCACCGCATTTGCTGCAAACAAGCATGGTCGTCCAGTCCGCTGCATTCTGGAACGAGGA
GAAGACATATTAATAACTGGAGGCCGCCACCCTTACCTTGGAAAGTATAAAGCTGGATTC
ATGAATGATGGCAGAATCTTGGCCCTGGATATGGAGCATTATAACAATGCAGGTGCCTTC
CTGGATGAGTCATTATTTGTAATAGAGATGGGACTTCTGAAACTGGAAAATGCCTACAAG
TTTCCCAACCTGCGCTGCCGGGGGTGGGCGTGCAGAACCAACCTTCCATCCAACACAGCT
TTGCGAGGGTTTGGCTTTCCCCAGGCAGGGCTGATCACCGAAGCCTGTATCACAGAAGTG
GCAGCCAAATGTGGGTTGCCCCCTGAGAAGGTCCGAATGATAAACATGTATAAGGAAATT
GATCAAACACCCTACAAACAGGAGATTAATACCAAGAACCTGACCCAGTGTTGGAAAGAA
TGCATGGCCACGTCTTCCTACACCCTAAGGAAAGCAGCGGTGGAGAAATTCAACTCGGAG
AATTACTGGAAGAAGAAGGGGCTGGCAATGGTCCCCCTGAAGTATCCTATTGGCCTTGGA
TCAGTTGCTGCTGGTCAGGCTGCTGCCCTGGTTCACATTTATCTGGATGGGTCTGTGCTG
GTGACTCACGGTGGAATTGAAATGGGGCAGGGGGTCCACACTAAAATGATTCAGGTGGTG
AGTCGTGAGTTAAGGATGCCACTGTCCAGTATCCACCTCCGGGGAACAAGCACAGAAACC
ATCCCTAATACAAATCCCTCTGGAGGTTCCGTAGTGGCTGATCTCAACGGGTTGGCAGTA
AAGGATGCTTGTCAGACTCTTCTGAAACGCCTTAAACCCATCATCAGCAAGAATCCCAAA
GGCACTTGGAAAGATTGGGCACAGGCTGCCTTTAATGAAAGCATTAGTCTCTCAGCTACT
GGATACTTCAGGGGTTATGAGTCGAACATAAACTGGGAGACAGGCGAAGGCCACCCTTTC
GAATACTTTGTTTATGGAGCAGCCTGTTCCGAGGTTGAGATAGACTGCCTGACAGGTGCT
CATAAGAACATCAGAACAGACATTGTCATGGATGTTGGCTACAGTATAAATCCAGCCCTT
GACGTAGGCCAGATTGAAGGTGCATTTATTCAAGGCATGGGACTTTATACAATAGAGGAA
CTGAATTATTCTCCTCAAGGTGTCCTGTACACCCGGGGCCCGAACCAGTATAAAATCCCT
GCCATCTGTGACATCCCCATGGAGCTGCACATTTCTTTTTTGCCTCCCTCTGAAAACTCG
AATACCCTGTATTCGTCTAAGGGTCTGGGAGAGTCTGGGATATTCCTGGGGTGCTCAGTG
TTTTTCGCCATCCACGATGCAATAAGGGCAGCACGACAGGAGAGAGGCCTGCCTGGACCA
CTGAGGCTCAACAGCCCACTGACTCCAGAGAAGATTAGAATGGCCTGTGAAGACAAGTTC
ACAAAAATGATTCCAAGAGATGAACCTGGATCGTATGTTCCTTGGAGTGTACCCATATGA
Enzyme 3 GenBank Gene ID X87251 Link Image
Enzyme 3 GeneCard ID AOX1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 2q33
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available