We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Zinc (RMDB01303)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-16 14:00:23
Update Date 2009-07-05 16:00:25
Accession Number RMDB01303
Common Name Zinc
Description Zinc is an essential element, necessary for sustaining all life.Physiologically, it exists as an ion in the body. It is estimated that 3000 of the hundreds of thousands of proteins in the human body contain zinc prosthetic groups. In addition, there are over a dozen types of cells in the human body that secrete zinc ions, and the roles of these secreted zinc signals in medicine and health are now being actively studied. Intriguingly, brain cells in the mammalian forebrain are one type of cell that secretes zinc, along with its other neuronal messenger substances. Cells in the salivary gland, prostate, immune system and intestine are other types that secrete zinc. Obtaining a sufficient zinc intake during pregnancy and in young children is a problem, especially among those who cannot afford a good and varied diet. Brain development is stunted by zinc deficiency in utero and in youth. Zinc is an activator of certain enzymes, such as carbonic anhydrase. Carbonic anhydrase is important in the transport of carbon dioxide in vertebrate blood. Even though zinc is an essential requirement for a healthy body, too much zinc can be harmful. Excessive absorption of zinc can also suppress copper and iron absorption. The free zinc ion in solution is highly toxic to plants, invertebrates, and even vertebrate fish. The Free Ion Activity Model (FIAM) is well-established in the literature, and shows that just micromolar amounts of the free ion kills some organisms.
Synonyms
  1. Zinc
  2. Zinc ion
Chemical IUPAC Name zinc
Chemical Formula [Zn]2+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals; Anti-oxidant
Application
Source
  • Exogenous
Average Molecular Weight 65.409
Monoisotopic Molecular Weight 63.929138
Isomeric SMILES [Zn++]
Canonical SMILES [Zn++]
KEGG Compound ID C00038 Link Image
BioCyc ID ZN%2b2 Link Image
BiGG ID Not Available
Wikipedia Link Zinc Link Image
METLIN ID Not Available
PubChem Compound 23994 Link Image
PubChem Substance 26736170 Link Image
ChEBI ID 30185 Link Image
CAS Registry Number 7440-66-6
InChI Identifier InChI=1/Zn/q+2
Synthesis Reference Not Available
Melting Point (Experimental) 419.5 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 344 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.47 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 1.391 +/- 0.51 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
  2. 5'-nucleotidase
  3. Alkaline phosphatase
  4. Disintegrin and metalloproteinase domain-containing protein 10
  5. Cytosine-specific methyltransferase
  6. Cytosol aminopeptidase
  7. Carboxypeptidase E
  8. Carboxypeptidase B
  9. Aspartoacylase
  10. Glutamyl aminopeptidase
  11. Activation-induced cytidine deaminase
  12. Superoxide dismutase [Cu-Zn]
  13. Superoxide dismutase [Cu-Zn]
  14. N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
  15. Cytosolic non-specific dipeptidase
  16. Peptidyl-glycine alpha-amidating monooxygenase
  17. Sorbitol dehydrogenase
  18. A disintegrin and metalloproteinase with thrombospondin motifs 4
  19. Aprataxin and PNK-like factor
  20. DNA-(apurinic or apyrimidinic site) lyase 2
  21. Carboxypeptidase N catalytic chain
  22. Alcohol dehydrogenase class-3
  23. Angiotensin-converting enzyme
  24. Carbonic anhydrase 1
  25. Protein kinase C, zeta
  26. Aminopeptidase B
  27. A disintegrin and metalloproteinase with thrombospondin motifs 5
  28. Protein kinase C, alpha
  29. Angiotensin-converting enzyme 2
  30. Lys-63-specific deubiquitinase BRCC36
  31. Breast cancer type 1 susceptibility protein homolog
  32. Carboxypeptidase A1 (Pancreatic)
  33. Disintegrin and metalloproteinase domain-containing protein 2
  34. Carbonic anhydrase 6
  35. Translocase of inner mitochondrial membrane 13
  36. Matrix metallopeptidase 2 (Gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
  37. Pancreatic carboxypeptidase B
  38. Ubiquitin carboxyl-terminal hydrolase
  39. A disintegrin and metalloproteinase with thrombospondin motifs 2
  40. AFG3-like protein 2
  41. DNA topoisomerase
  42. Ubiquitin isopeptidase T
  43. Cytochrome c oxidase subunit 5B, mitochondrial
  44. Cleavage and polyadenylation specificity factor subunit 3
  45. Carboxypeptidase B2
  46. Probable C->U-editing enzyme APOBEC-2
  47. Betaine--homocysteine S-methyltransferase 1
  48. Aminopeptidase N
  49. Aprataxin
  50. Carbonic anhydrase 2
  51. tRNA-specific adenosine deaminase 2
  52. Carbonic anhydrase 3
  53. Protein kinase C, delta
  54. Diacylglycerol kinase alpha
  55. Ubiquitin carboxyl-terminal hydrolase
  56. Carbonic anhydrase 4
  57. Ester hydrolase C11orf54 homolog
  58. Carboxypeptidase A1
  59. Carboxypeptidase A5
  60. Carboxypeptidase O
  61. E3 ubiquitin-protein ligase BRE1A
Enzyme 1 [top]
Enzyme 1 ID 133
Enzyme 1 Name Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
Enzyme 1 Synonyms
  1. CDP-choline phosphohydrolase
  2. ADPRibase-Mn
Enzyme 1 Gene Name Not Available
Enzyme 1 Protein Sequence >Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
MDYKPEPELHSESSERLFSFGVIADIQYADLEDGYNFQGNRRRYYRHSLLHLQGAIEHWN
QERSPPRCVLQLGDIIDGYNAQYKASEKSLERVMNTFQMLRVPVHHTWGNHEFYNFSRDY
LTNSKLNTKFLEDQIAHHPETVPSEDYYAYHFVPFPKFRFILLDAYDMSVLGVDQSSPKY
QQCLKILREHNPNTELNSPQGLREPQFVQFNGGFSPEQLNWLNAVLTFSDRNQEKVVIVS
HLPIYPEASDSVCLAWNYRDALAVIWSHKCVVCFFAGHTHDGGYSEDPYGVHHVNIEGVI
ETAPDSQAFGTVHVYPDKMMLEGRGRVPHRIMNYRKE
Enzyme 1 Number of Residues 337
Enzyme 1 Molecular Weight 39234.7
Enzyme 1 Theoretical pI 6.29
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in ADP-ribose diphosphatase activity
Enzyme 1 Specific Function hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP- choline and CDP-ethanolamine, but not other non-reducing ADP- sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 154425892 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A7YY53 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ADPRM_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >618 bp
ATGGATTATAAGCCCGAACCTGAACTCCACAGTGAGAGCTCTGAACGTCTCTTCTCCTTT
GGAGTGATAGCAGATATTCAATATGCTGATTTGGAAGATGGCTATAATTTCCAGGGAAAC
AGAAGGAGGTACTACAGACACAGTCTTCTTCACTTACAGGGTGCTATCGAACACTGGAAT
CAAGAACGCAGCCCGCCCCGTTGTGTGCTTCAGCTTGGAGACATCATCGACGGATACAAT
GCGCAGTACAAAGCATCAGAAAAGTCACTGGAGCGCGTCATGAACACATTCCAAATGCTG
AGAGTCCCTGTTCATCACACGTGGGGAAACCACGAATTCTATAATTTCAGCAGAGACTAT
TTAACAAACTCCAAACTTAACACAAAGTTTCTGGAAGACCAGATTGCCCACCATCCTGAG
ACTGTGCCCTCGGAGGATTATTACGCGTATCATTTTGTACCATTCCCTAAATTCCGCTTC
ATTTTACTCGATGCTTATGACATGAGTGTCTTGGGCGTGGATCAGTCTTCTCCAAAATAC
CAGCAGTGTCTGAAGATACTGAGGGAGCACAACCCAAATACGGAACTGAATAGTCCTCAA
GGTGAATTATTCCTTTGA
Enzyme 1 GenBank Gene ID BC151325 Link Image
Enzyme 1 GeneCard ID Not Available
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 159
Enzyme 2 Name 5'-nucleotidase
Enzyme 2 Synonyms
  1. Ecto-5'-nucleotidase
  2. 5'-NT
  3. CD73 antigen
Enzyme 2 Gene Name NT5E
Enzyme 2 Protein Sequence >5'-nucleotidase
MNPGAARTPALRILALGALLWPAARPWELTILHTNDVHSRLEQTSEDSSKCVNASRCVGG
VARLATKVHQIRRAEPHVLLLDAGDQYQGTIWFTVYKGTEVAHFMNALGYDAMALGNHEF
DNGVEGLIDPLLKEVNFPILSANIKAKGPLASKISGLYSPYKILTVGDEVVGIVGYTSKE
TPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEVDKLIAQKVKGVDVVV
GGHSNTFLYTGNPPSKEVPAGQYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDEKGNV
VTSHGNPILLNSSIPEDPNIKADINKWRVKLDNYSTQELGKTIVYLDGTAQSCRFRECNM
GNLICDAMINNNLRHPDEMSWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGT
FDLVQLKGSTLKKAFEHSVHRYGQATGEFLQVGGIHVVYDISRNPGDRVVKLEVLCTQCR
VPSYEPLRMDKVYKVILPSFLVSGGDGFQMIKDEKIKHDSGDQDINVVSGYISKMKVLYP
AVEGRIQFSAGSHCCGSFSLIFLSVLAVIIILYQ
Enzyme 2 Number of Residues 574
Enzyme 2 Molecular Weight 62965.8
Enzyme 2 Theoretical pI 6.94
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Nucleotide transport and metabolism
Enzyme 2 Specific Function Hydrolyzes extracellular nucleotides into membrane permeable nucleosides
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • 1-26
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 285642 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q05927 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name 5NTD_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1725 bp
ATGAATCCCGGAGCGGCTCGCACCCCGGCGCTGAGGATCCTGCCGCTGGGCGCGTTGCTG
TGGCCCGCGGCGCGCCCCTGGGAGCTCACCATCTTGCACACCAACGACGTACACAGCCGC
CTGGAGCAGACGAGTGAGGACTCGAGCAAGTGTGTCAACGCCAGCCGCTGCGTGGGCGGC
GTGGCACGGCTTGCCACCAAGGTGCACCAGATCCGCCGCGCCGAGCCCCACGTGCTGCTG
CTCGACGCCGGCGACCAGTACCAGGGCACCATCTGGTTCACCGTGTACAAGGGCACCGAG
GTGGCGCACTTCATGAACGCCCTGGGTTATGAGTCCATGGCACTGGGAAATCATGAATTT
GATAATGGTGTGGAAGGCCTGATTGATCCACTACTCAAAGAGGTCAATTTTCCAATTCTG
AGCGCAAACATTAAAGCCAAGGGGCCTCTAGCGTCTAAAATTTCAGGACTTTATTCACCA
TATAAAATTCTTACTGTTGGTGATGAAGTTGTGGGGATTGTTGGATACACTTCAAAGGAA
ACCCCTTTCCTCTCAAATCCAGGAACGAATTTAGTATTCGAAGATGAAATCACTGCATTG
CAACCAGAAGTAGATAAGTTAAAAACTCTAAATGTGAACAAAATTATTGCACTGGGACAC
TCTGGTTTTGAAGTGGATAAACTCATTGCTCAGAAAGTGAAGGGTGTGGATGTGGTGGTG
GGAGGACATTCCAACACGTTTCTCTACACAGGCAATCCACCTTCCAAAGAGGTGCCAGCA
GGGCAGTACCCATTCATAGTCACTTCTGATGATGGACGGAAGGTTCCTGTGGTCCAGGCC
TATGCTTTTGGCAAATACCTAGGCTATTTGAAGGTTGAGTTTGATGAAAAAGGAAATGTT
GTCACTTCACATGGAAATCCCATTCTTCTCAACAGCAGCATCCCAGAAGATCCAAACATA
AAAGCAGACATTAACAAATGGCGGGTAAAATTAGATAACTATTCAACCCAGGAATTGGGG
AAAACAATTGTCTATCTGGATGGTACTGCTCAGTCCTGCCGCTTTCGAGAATGCAACATG
GGCAATCTGATTTGTGATGCTATGATTAACAACAACCTGAGACACCCGGATGAGATGTCC
TGGAACCATGTGTCCATGTGCATTTTAAATGGAGGTGGCATCCGGTCGCCCATTGACGAG
CGGAACAATGGCACGATTACCTGGGAGAACCTGGCTGCTGTGTTGCCCTTTGGAGGCACC
TTTGACCTGGTCCAGTTAAAAGGCTCCACCCTGAAGAAGGCCTTCGACGACACGGTGCAC
CGCTATGGCCAGCGCACAGGCGAGTTTCTGCAGGTGGGAGGAATTCACGTGGTGTATGAT
ATTTCCCGAAACCCTGGGGACAGGGTGGTCAAGTTAGAGGTTCTTTGCACCCAGTGTCGT
GTGCCCAGTTATGAGCCTCTTAGAATGGATAAGGTGTACAAGGTGATCCTCCCAAGCTTC
CTTGTCAGTGGTGGAGACGGATTCCAGATGATAAAAGATGAAAAGATAAAACATGACTCT
GGTGACCAAGATATCAACGTGGTTTCTGGATACATCTCAAAAATGAAAGTGCTTTATCCA
GCAGTTGAAGGTCGGATCCAGTTTTCTGCAGGAAGTCATTGCTGTGGAAGTTTTTCTTTA
ATATTTCTTTCAGTTTTGGCAGTGATCATTATTTTATACCAATAG
Enzyme 2 GenBank Gene ID D14541 Link Image
Enzyme 2 GeneCard ID NT5E Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:6
Enzyme 2 Locus 6q14-q21
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 198
Enzyme 3 Name Alkaline phosphatase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name LOC100125266
Enzyme 3 Protein Sequence >Alkaline phosphatase
MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLG
DGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLC
GVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDA
SVNGVRKDKQNLVQAWQAKQQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQD
PTKDPTLQEMTEVALRVLSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAVMFDNAIAKA
NELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYAL
GGGSRPDVNDSTSEDPSYQQQAAVPLASETHGGEDVAVFARGPQAHLVHGVQEETFVAHI
MAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY
Enzyme 3 Number of Residues 533
Enzyme 3 Molecular Weight 57049.1
Enzyme 3 Theoretical pI 5.71
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Inorganic ion transport and metabolism
Enzyme 3 Specific Function A phosphate monoester + H(2)O = an alcohol + phosphate
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 151556049 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID A6QQR9 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name A6QQR9_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1602 bp
ATGCAGGGGGCCTGCGTGCTGCTGCTGCTGGGCCTGCATCTACAGCTCTCCCTAGGCCTC
GTCCCAGTTGAGGAGGAAGACCCCGCCTTCTGGAACCGCCAGGCAGCCCAGGCCCTCGAT
GTGGCTAAGAAGCTGCAGCCCATCCAGACAGCCGCCAAGAATGTCATCCTCTTCTTGGGG
GATGGGATGGGGGTGCCTACGGTGACAGCCACTCGGATCCTAAAGGGGCAGATGAATGGC
AAACTGGGACCTGAGACACCCCTGGCCATGGACCAGTTCCCATACGTGGCTCTGTCCAAG
ACATACAACGTGGACAGACAGGTGCCAGACAGCGCAGGCACTGCCACTGCCTACCTGTGT
GGGGTCAAGGGCAACTACAGAACCATTGGTGTAAGTGCAGCCGCCCGCTACAACCAGTGC
AAAACGACACGTGGGAATGAGGTCACGTCTGTGATGAACCGGGCCAAGAAAGCAGGGAAG
TCCGTGGGAGTGGTGACCACCACCAGGGTGCAGCATGCCTCCCCAGCCGGGGCCTACGCG
CACACGGTGAACCGAAACTGGTACTCAGACGCCGACCTGCCTGCTGATGCACAGATGAAT
GGCTGCCAGGACATCGCCGCACAGCTGGTCAACAACATGGATATTGACGTGATCCTGGGT
GGAGGCCGAAAATACATGTTTCCTGTGGGGACCCCAGACCCTGAATACCCAGATGATGCC
AGTGTGAATGGAGTCCGGAAGGACAAGCAGAACCTGGTGCAGGCATGGCAGGCCAAGCAG
CAGGGAGCCCAGTATGTGTGGAACCGCACTGCGCTCCTTCAGGCGGCCGATGACTCCAGT
GTAACACACCTCATGGGCCTCTTTGAGCCGGCAGACATGAAGTATAATGTTCAGCAAGAC
CCCACCAAGGACCCGACCCTGCAGGAAATGACAGAGGTGGCCCTGCGAGTGCTAAGCAGG
AACCCCAGGGGCTTCTACCTCTTTGTGGAGGGAGGCCGCATTGACCACGGTCACCATGAT
GACAAAGCTTATATGGCACTGACCGAGGCGGTCATGTTTGACAATGCCATCGCCAAGGCT
AATGAGCTCACTAGCGAACTGGACACGCTGATCCTTGTCACTGCAGACCACTCTCATGTC
TTCTCTTTTGGTGGCTATACACTGCGTGGGACCTCCATTTTTGGTCTGGCCCCCAGCAAG
GCCTTAGACAGCAAGTCCTACACCTCCATCCTCTATGGCAATGGCCCTGGCTATGCGCTT
GGCGGGGGCTCGAGGCCCGATGTTAATGACAGCACAAGCGAGGACCCCTCGTACCAGCAG
CAGGCGGCCGTGCCCCTGGCTAGCGAGACCCACGGGGGCGAGGACGTGGCGGTGTTCGCG
CGCGGCCCGCAGGCGCACCTGGTGCACGGCGTGCAGGAGGAGACCTTCGTGGCGCACATC
ATGGCCTTTGCGGGCTGCGTGGAGCCCTACACCGACTGCAATCTGCCAGCCCCCACCACC
GCCACCAGCATCCCCGACGCCGCGCACCTGGCGGCCAGCCCGCCTCCACTGGCGCTGCTG
GCTGGGGCGATGCTGCTGCTGCTGGCGCCCACCTTGTACTAA
Enzyme 3 GenBank Gene ID BC149968 Link Image
Enzyme 3 GeneCard ID LOC100125266 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Not Available
Enzyme 3 Locus Not Available
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 233
Enzyme 4 Name Disintegrin and metalloproteinase domain-containing protein 10
Enzyme 4 Synonyms
  1. ADAM 10
  2. Mammalian disintegrin-metalloprotease
  3. Myelin-associated metalloproteinase
  4. Kuzbanian protein homolog
  5. CD156c antigen
Enzyme 4 Gene Name ADAM10
Enzyme 4 Protein Sequence >Disintegrin and metalloproteinase domain-containing protein 10
MVLLRVLILLLSWVAGLGGQYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFL
RLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVI
DGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEVTQTPQEKHAINGPELLRKKRTTVAEKNTCQLYIQTDHLFFKYYGTRE
AVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKF
LELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNT
GIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYAR
ATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCK
DECCYDANQPEGKKCKLKPGKQCSPSQGPCCTAHCAFKSKTEKCRDDSDCAKEGICNGIT
ALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKHGLEECTCASSDGKDDKELCHVCCMK
KMEPSTCASTGSVQWNKYFLGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKA
IFSPELYENIAEWIVAYWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTL
KRRRPPQPIQQPQRQRPRESYQMGHMRR
Enzyme 4 Number of Residues 748
Enzyme 4 Molecular Weight 84187.8
Enzyme 4 Theoretical pI 7.81
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in metalloendopeptidase activity
Enzyme 4 Specific Function Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form. Responsible for the proteolytic release of several other cell-surface proteins, including heparin-binding epidermal growth-like factor, ephrin-A2 and for constitutive and regulated alpha-secretase cleavage of amyloid precursor protein (APP). Contributes to the normal cleavage of the cellular prion protein. Involved in the cleavage of the adhesion molecule L1 at the cell surface and in released membrane vesicles, suggesting a vesicle-based protease activity. Controls also the proteolytic processing of Notch
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-19
Enzyme 4 Transmembrane Regions
  • 673-696
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 1044811 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q10741 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name ADA10_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >2247 bp
ATGGTGTTGCTGAGAGTGTTAATTCTGCTCCTCTCCTGGGTTGCGGGGCTGGGAGGTCAG
TATGGAAATCCTTTAAATAAATACATTAGACATTATGAAGGATTATCATATGATGTGGAT
TCATTACACCAAAAACACCAGCGTGCCAAAAGAGCAGTATCACATGAGGACCAGTTTTTA
CGGCTAGATTTTCATGCTCATGGAAGACATTTCAACCTTCGAATGAAGAGGGATACTTCC
CTTTTCAGTGAGGAGTTTAGGGTGGAAACATCAAATGCAGTACTGGATTATGATACTTCT
CATATTTACACTGGACATATTTATGGTGAAGAAGGAAGTTTTAGCCATGGGTCTGTTATT
GATGGAAGATTTGAAGGATTCATTCAGACTCATGGTGGCACATTTTATGTTGAACCAGCA
GAGAGATATATTAAAGACCGAACTCTGCCATTTCACTCTGTCATTTATCATGAAGATGAT
ATTAAGTATCCCCATAAATATGGTCCACAGGGGGGTTGTGCAGATCATTCAGTGTTTGAA
AGAATGAGGAAGTACCAGATGACTGGTGTAGAAGAAGTAACACAGACACCTCAAGAAAAA
CATGCTATTAATGGTCCAGAACTCCTGAGGAAAAAACGTACAACTGTAGCTGAAAAAAAT
ACCTGTCAGCTTTATATTCAGACCGATCATCTGTTCTTTAAATATTACGGAACACGAGAA
GCTGTGATTGCCCAGATATCCAGTCATGTTAAAGCAATTGACACAATTTACCAGACAACA
GACTTCTCTGGAATCCGTAACATCAGTTTCATGGTGAAACGCATAAGAATCAACACAACT
GCTGATGAGAAGGACCCTACAAATCCATTCCGTTTTCCAAATATTGGTGTGGAGAAGTTT
CTGGAGCTGAATTCTGAGCAGAATCATGATGACTACTGTTTGGCCTACGTTTTCACAGAT
CGAGATTTTGATGATGGTGTCCTTGGTCTGGCGTGGGTTGGAGCACCTTCAGGAAGCTCT
GGAGGAATATGTGAAAAAAGTAAGCTCTATTCAGATGGTAAGAAGAAGTCTTTAAACACT
GGAATTATTACTGTTCAGAACTATGGGTCTCACGTACCCCCCAAAGTCTCTCACATTACG
TTTGCTCATGAAGTTGGACATAACTTTGGATCTCCGCATGATTCTGGAACAGAGTGCACT
CCAGGAGAATCTAAGAATTTAGGACAAAAAGAAAATGGCAACTACATCATGTATGCAAGA
GCAACATCTGGGGACAAACTTAACAACAATAAATTCTCACTCTGTAGTATTAGAAATATA
AGTCAAGTTCTTGAGAAGAAGAGAAACAACTGTTTTGTTGAATCTGGCCAACCTATTTGT
GGAAATGGGATGGTAGAACAAGGTGAAGAATGTGATTGTGGTTATAGTGACCAGTGTAAA
GACGAGTGCTGCTACGATGCAAATCAGCCGGAGGGGAAAAAATGCAAGCTGAAACCTGGA
AAGCAGTGCAGTCCAAGTCAAGGTCCCTGTTGTACAGCACATTGTGCATTCAAGTCAAAA
ACTGAAAAGTGTCGGGATGATTCAGACTGTGCAAAAGAAGGAATATGTAATGGCATCACA
GCTCTCTGCCCAGCCTCTGATCCTAAACCGAACTTCACAGACTGTAATAGACATACGCAA
GTGTGCATTAATGGGCAATGTGCAGGTTCTATCTGTGAGAAACATGGCTTGGAGGAGTGT
ACCTGTGCCAGTTCTGATGGCAAAGATGATAAGGAATTATGCCATGTCTGCTGTATGAAG
AAGATGGAGCCATCAACTTGTGCCAGTACAGGGTCTGTGCAGTGGAACAAGTACTTCCTT
GGTCGAACTATCACCCTGCAACCTGGATCCCCATGCAATGATTTTAGAGGCTACTGTGAT
GTTTTCATGCGGTGCAGATTAGTAGATGCTGATGGTCCTCTAGCGAGGCTTAAAAAAGCA
ATTTTCAGTCCAGAGCTCTATGAAAACATAGCTGAATGGATTGTGGCTTACTGGTGGGCA
GTATTACTTATGGGAATTGCCCTGATCATGTTAATGGCTGGTTTTATTAAGATATGCAGT
GTACACACTCCAAGTAGTAATCCAAAGTTGCCTCCTCCTAAACCTCTTCCAGGCACTTTA
AAGAGGAGAAGACCTCCCCAGCCCATTCAACAGCCCCAGCGTCAGAGGCCCCGGGAGAGT
TATCAGATGGGACACATGAGACGTTAA
Enzyme 4 GenBank Gene ID Z21961 Link Image
Enzyme 4 GeneCard ID ADAM10 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 15q2|15q22
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 408
Enzyme 5 Name Cytosine-specific methyltransferase
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name Dnmt1
Enzyme 5 Protein Sequence >Cytosine-specific methyltransferase
AGPEEKEPERVKPQVSDEKDEDEKFWRIQFTYQSTSREEKRRRTTYRELTEKKMTRTKIA
VVSKTNPPKCTECLQYLDDPELRYEQHPPDAVEEIQILTNERLSIFDANESGFESYEDLP
QHKLTCFSVYCKRGHLCPIDTGLIEKDVELLFSGSAKPIYEDDPSPEGGINGKNFGPINE
WWIAGFDGGEKALLGFSTSFAEYILMDPSPEYAPLFSVMQEKIYISKIVVEFLQSNPDST
YEDLINKIETTVPPCMLNLNRFTEDSLLRHAQFVVEQVESYDRAGDSDEQPIFLSPCMRD
LIKLAGVTLGKRRAERRQTIRQPAKEKDKGPTKATTTKLVYQIFDTFFAEQIEKDDKEDK
ENAFKRRRCGVCEICQQPECGKCKACKDMVKFGGSGRSKQACQKRRCPNMAMKEADDDEE
VDDNIPEMPSPKKMHQGKKKKQNKNRISWVGDAVKTDGKKSYYKKVCIDSETLEVGDCVS
VIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQ
LSYIHSKVQVIYKAPSENWAMEGGVDPEALMSEDDGKTYFYQLWYDQDYARFESPPKTQP
TEDNKYKFCASCARLAEMRQKEIPRVVEQLQDLEGRVLYSLATKNGVQYRVGDGVYLPPE
AFTFNIKLSSPVKRPRKEPVDEALYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCSKK
SNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEY
GEDLPQCLQDFSAGGPDRFYFLEAYNAKSKSFEDPPNHARSTGNKGKGKGKGKNRTKSQT
CEPSELETEIKLPKLRTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGS
TVFTEDCNVLLKLVMAGEVTNSRGQKLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFK
NSLVVSFLSYCDYYRPRYFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQY
GVAQTRRRAIILAAAPGEPLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRT
ITVRDTMSDLPEIRNGASALEISYNGEPQSWFQRQLRGSQYQPILRDHICKDMSALVAAR
MRHIPLAPGSDWRDLPNIEVRLSDGTLARKLRYNYHDKKNGCSSSGALRGVCSCVEGKPC
EPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQH
RVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKRCMLAKARESAS
LKSRRRLPRTSSLLLSPMFLPPEIPNVH
Enzyme 5 Number of Residues 1348
Enzyme 5 Molecular Weight 153084.6
Enzyme 5 Theoretical pI 7.79
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Replication, recombination and repair
Enzyme 5 Specific Function S-adenosyl-L-methionine + DNA = S-adenosyl-L- homocysteine + DNA containing 5-methylcytosine
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 168805279 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID B1P383 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name B1P383_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence Not Available
Enzyme 5 GenBank Gene ID EU273277 Link Image
Enzyme 5 GeneCard ID Dnmt1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 19p13.2
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 499
Enzyme 6 Name Cytosol aminopeptidase
Enzyme 6 Synonyms
  1. Leucine aminopeptidase
  2. Leucyl aminopeptidase
  3. Leucine aminopeptidase 3
  4. LAP
  5. Proline aminopeptidase
  6. Prolyl aminopeptidase
  7. Peptidase S
Enzyme 6 Gene Name LAP3
Enzyme 6 Protein Sequence >Cytosol aminopeptidase
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
Enzyme 6 Number of Residues 519
Enzyme 6 Molecular Weight 56288.9
Enzyme 6 Theoretical pI 6.44
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Amino acid transport and metabolism
Enzyme 6 Specific Function Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 410689 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID P00727 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name AMPL_BOVIN Link Image
Enzyme 6 PDB ID 1LAP Link Image
Enzyme 6 PDB File Show
Enzyme 6 3D Structure
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1542 bp
ATGCCACCACCTGGATCCCCTTGGCCTTCAGAGCGTCAGCCTGCTCCACGAACCCTGGCA
GGTGGGTGCTCAGACATGACGAAGGGCCTTGTTTTAGGAATCTATAGCAAAGAAAAAGAA
GAAGATGAGCCTCAGTTTACAAGTGCAGGAGAGAATTTTAATAAATTGGTGTCTGGAAAG
CTGAGAGAAATTTTGAACATATCTGGACCATCCCTGAAGGCAGGCAAAACCCGAACCTTT
TATGGTCTACATGAGGACTTCCCTAGCGTGGTGGTGGTTGGCCTTGGCAAAAAGACGGCT
GGAATTGATGAACAGGAGAACTGGCATGAAGGCAAAGAAAACATCAGAGCTGCTGTTGCA
GCGGGGTGCAGACAGATTCAGGACCTGGAGATCCCGTCGGTGGAGGTGGACCCCTGCGGA
GATGCCCAGGCGGCTGCGGAAGGAGCGGTGCTCGGGCTCTATGAATATGATGACCTGAAG
CAGAAAAGGAAGGTGGTGGTGTCGGCCAAACTCCATGGAAGTGAGGACCAGGAGGCCTGG
CAGAGAGGCGTCCTCTTTGCTTCTGGGCAGAACCTGGCACGCCGCTTGATGGAGACGCCT
GCCAACGAGATGACGCCAACCAAATTTGCCGAAATTGTTGAGGAGAATCTCAAAAGTGCT
AGTATTAAAACAGACGTCTTCATCAGACCCAAGTCTTGGATTGAGGAACAGGAAATGGGA
TCATTTCTAAGTGTGGCCAAAGGGTCCGAAGAGCCTCCAGTCTTCCTGGAAATTCACTAC
AAAGGCAGTCCCAATGCAAGTGAACCTCCCTTGGTGTTTGTTGGGAAGGGGATTACCTTT
GACAGTGGTGGCATCTCCATCAAGGCTGCTGCAAACATGGACCTCATGAGGGCCGACATG
GGAGGAGCTGCCACTATCTGTTCAGCCATCGTGTCTGCTGCCAAGCTCGACCTGCCCATC
AACATCGTAGGTTTGGCTCCTCTTTGTGAAAATATGCCCAGTGGGAAGGCCAACAAGCCT
GGGGATGTTGTTAGAGCCAGGAACGGGAAGACCATACAGGTGGATAACACCGATGCTGAG
GGGAGACTTATCCTGGCCGATGCGCTCTGCTACGCTCACACTTTTAACCCAAAGGTCATC
ATTAATGCCGCCACCCTGACAGGTGCCATGGACATAGCTTTGGGATCTGGTGCCACTGGG
GTCTTTACCAACTCTTCTTGGCTGTGGAACAAACTATTTGAGGCCAGCATTGAAACAGGA
GACCGTGTCTGGAGGATGCCTCTCTTTGAACATTACACAAGACAGGTTATAGATTGCCAA
CTTGCTGATGTTAATAACATTGGAAAATATAGATCTGCAGGAGCGTGTACAGCTGCAGCA
TTCCTGAAAGAATTTGTGACTCATCCTAAGTGGGCACATTTAGACATAGCAGGTGTGATG
ACCAACAAAGATGAGGTTCCTTATCTTCGCAAAGGCATGGCTGGGAGGCCCACGAGGACC
CTGATTGAATTCCTGTTTCGGTTCAGTCAAGACAGTGCTTAG
Enzyme 6 GenBank Gene ID S65367 Link Image
Enzyme 6 GeneCard ID LAP3 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:4
Enzyme 6 Locus 4p15.32
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 552
Enzyme 7 Name Carboxypeptidase E
Enzyme 7 Synonyms
  1. CPE
  2. Carboxypeptidase H
  3. CPH
  4. Enkephalin convertase
  5. Prohormone-processing carboxypeptidase
Enzyme 7 Gene Name CPE
Enzyme 7 Protein Sequence >Carboxypeptidase E
MARRGGCALLVLCGSLAACAWLLGAEARGPGGPVAGARRRRRPQEDGISFEYHRYPELRE
ALVSVWLQCAAVSRIYTVGRSFEGRELLVLELSDNPGVHEPGEPEFKYIGNMHGNEAVGR
ELLIFLAQYLCNEYQKGNETIVQLIHNTRIHIMPSLNPDGFEKAASQLGELKDWFVGRSN
AQGIDLNRNFPDLDRIVYINEKEGGPNNHLLKNLKKIVDQNTKLAPETKAVIHWIMDIPF
VLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDDIFQSLARAYSSFNPPMSDPDRPPCR
KNDDDSSFVEGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKNYWEDN
KNSLISYIQQIHRGVKGFVRDLQGNPIANATLSVEGIDHDVTSAKDGDYWRLLVPGNYKL
TASAPGYLAIAKKVAVPYSPAVRVDFELESFSERKEEEKEELMEWWKMMSETLNF
Enzyme 7 Number of Residues 475
Enzyme 7 Molecular Weight 53308.5
Enzyme 7 Theoretical pI 4.94
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Amino acid transport and metabolism
Enzyme 7 Specific Function Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • 1-27
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 148743816 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID P04836 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name CBPE_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1428 bp
ATGGCCCGGCGAGGGGGCTGCGCGCTGCTGGTGCTGTGCGGCTCGCTGGCCGCCTGTGCC
TGGCTGCTGGGCGCCGAGGCCCGGGGGCCTGGGGGCCCTGTGGCGGGCGCAAGGCGGCGC
CGGCGGCCCCAGGAGGACGGCATCTCCTTTGAGTACCACCGCTACCCAGAGCTTCGTGAA
GCGCTCGTGTCCGTGTGGCTGCAGTGCGCCGCGGTCAGCAGGATCTACACGGTGGGGCGC
AGCTTCGAGGGCCGCGAGCTGCTGGTGCTCGAGCTGTCCGACAACCCCGGCGTCCACGAG
CCGGGTGAGCCTGAATTTAAATACATCGGGAATATGCATGGCAATGAAGCTGTCGGACGG
GAGCTGCTCATTTTTCTGGCCCAGTACCTGTGCAATGAGTACCAAAAAGGGAATGAGACA
ATTGTCCAGCTGATCCACAACACCCGAATCCACATCATGCCTTCTCTGAACCCTGATGGC
TTTGAAAAGGCAGCATCTCAGCTTGGTGAGCTGAAGGACTGGTTCGTGGGTCGAAGCAAT
GCCCAGGGAATAGATCTGAACCGGAACTTTCCCGACCTGGACAGAATAGTTTATATTAAT
GAGAAAGAAGGTGGTCCAAATAATCATCTGTTGAAAAATCTGAAGAAAATTGTGGATCAA
AACACAAAGCTTGCTCCTGAGACGAAGGCTGTCATTCATTGGATTATGGATATTCCTTTT
GTGCTCTCTGCCAATCTTCACGGAGGAGACCTTGTGGCCAATTATCCATATGATGAGACG
AGGAGTGGTAGTGCTCATGAATACAGCTCCTGCCCAGATGACGACATCTTCCAAAGCTTA
GCTCGGGCATACTCATCCTTCAACCCCCCAATGTCGGACCCAGATCGGCCCCCATGTCGC
AAGAATGATGATGACAGCAGCTTTGTAGAAGGAACGACCAATGGTGCTGCATGGTACAGC
GTGCCTGGAGGAATGCAAGATTTCAATTACCTCAGCAGCAACTGCTTTGAGATTACTGTG
GAGCTTAGCTGTGAAAAGTTTCCACCTGAAGAGACTTTGAAGAACTACTGGGAGGATAAC
AAAAACTCCCTCATTAGCTACATTCAGCAGATACACCGAGGAGTTAAAGGATTTGTCCGA
GATCTTCAGGGTAACCCAATTGCTAATGCCACCCTCTCTGTGGAAGGAATAGACCATGAT
GTCACATCTGCAAAGGATGGTGATTACTGGAGATTGCTCGTCCCTGGAAACTATAAACTT
ACAGCCTCAGCACCGGGCTATCTGGCAATAGCAAAGAAAGTGGCAGTTCCTTATAGCCCT
GCTGTCAGGGTTGATTTTGAACTGGAGTCATTTTCTGAAAGGAAAGAAGAAGAGAAGGAA
GAATTAATGGAATGGTGGAAGATGATGTCAGAAACTTTAAACTTTTAA
Enzyme 7 GenBank Gene ID BC142181 Link Image
Enzyme 7 GeneCard ID CPE Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:4
Enzyme 7 Locus 4q32.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 554
Enzyme 8 Name Carboxypeptidase B
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name CPB1
Enzyme 8 Protein Sequence >Carboxypeptidase B
MLAFLILVTVTLASAHHSGEHFEGDKVFRVHVEDENHISLLHELASTRQMDFWKPDSVTQ
VKPHSTVDFRVKAEDTVAVEDFLGQNGLRYEVLISNLRSMLEAQFDSRVRTTGHSYEKYN
NWETIEAWTEQVASENPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTR
AGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAY
LTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYTYGPGASTIYPASG
GSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHLY
Enzyme 8 Number of Residues 417
Enzyme 8 Molecular Weight 47347.9
Enzyme 8 Theoretical pI 6.39
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Amino acid transport and metabolism
Enzyme 8 Specific Function Preferential release of a C-terminal lysine or arginine amino acid
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • 1-16
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein Not Available
Enzyme 8 UniProtKB/Swiss-Prot ID P00732 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name CBPB1_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID Not Available
Enzyme 8 GeneCard ID CPB1 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:3
Enzyme 8 Locus 3q24
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 562
Enzyme 9 Name Aspartoacylase
Enzyme 9 Synonyms
  1. Aminoacylase-2
  2. ACY-2
Enzyme 9 Gene Name ASPA
Enzyme 9 Protein Sequence >Aspartoacylase
MTSCHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKK
CTRYIDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS
NMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVG
PQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCAIEVYKIMRKVDYPRNESGEIS
AIIHPKLQDQDWKPLHPEDPVFLTLDGKTIPLGGDQTVYPVFVNEAAYYEKKEAFAKTTK
LTLNANSIRSSLH
Enzyme 9 Number of Residues 313
Enzyme 9 Molecular Weight 35737.6
Enzyme 9 Theoretical pI 6.65
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Amino acid transport and metabolism
Enzyme 9 Specific Function Catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 4262832 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID P46446 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name ACY2_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence Not Available
Enzyme 9 GenBank Gene ID S74726 Link Image
Enzyme 9 GeneCard ID ASPA Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 17pter-p13
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 572
Enzyme 10 Name Glutamyl aminopeptidase
Enzyme 10 Synonyms
  1. EAP
  2. Aminopeptidase A
  3. APA
  4. CD249 antigen
Enzyme 10 Gene Name ENPEP
Enzyme 10 Protein Sequence >Glutamyl aminopeptidase
MILEERSSWEGSKRYCIKTKHVAIICAVVVAVGLIVGLSVGLTRSCDSTEGMTQGTTQGT
TQAPSHLPPVTSPPEDQGVCPASEDESGGWKDFRLPDFIKPVHYDLEVKPLMEQDTYTGS
VDISINVSSSTRYLWLHLRETRITRLPVLRRPSGEQVQVRQCFEYKKQEYVVVEAEEELE
PNTGEGPYHLILEFAGWLNGSLVGFYRTTYVEKGQTKSIAATDHEPTDARKSFPCFDEPN
KKATYTISIVHSKEYKALSNMPVEKEESVDDIWSRTTFQKSVPMSTYLVCFAVHQFDSVT
RISNRGIPLTIYVQPEQKHTAEYAANITKSVFDYFEDYFGMSYSLPKLDKIAIPDFGTGA
MENWGLITYRETNLLYDPDESASSNKQRVAAVIAHELVHQWFGNIVTMEWWDDLWLNEGF
ASFFEYLGVAYAEKDWQMRDQMILDDVLPVQEDDSLMSSHPIVVTVATPDEITSVFDGIS
YSKGASILRMLENWITREKFQIGCQNYLKKHKFENAKTSDFWAALEEASNLPVKEVMDTW
TNQMGYPVLNVDNMKNITQKRFLLDPRANASEPHSAFGYTWNIPIKWTEDDEQRITLYNR
SETGGITLESTLSGNAFLKINPDHIGFYRVNYEVSTWEWIATNLSVNHTDFSSADRASFI
DDAFALARAQLLNYKEALNLTKYLKEEKEYLPWHRVISAVTYIISMFEDDKELYPVIEKY
FRDQVKPIADSLGWNDVGDHLTKLLRASVLGLACKMGDSDALNNASQLFQEWLTGTVSLP
VNLRLLVYRYGMQNSGNETSWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLL
KDSNLIKTQDVFTVIQYISYNSYGKTMAWNWIQLNWEYLVNRYTLNNRNLGRIVTIAEPF
NTELQLWQIKSFFERYPEAGAGQKPREQVLETVKNNIEWLKQNRDTIRNWFLDLNG
Enzyme 10 Number of Residues 956
Enzyme 10 Molecular Weight 109800.1
Enzyme 10 Theoretical pI 4.92
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Amino acid transport and metabolism
Enzyme 10 Specific Function Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • 22-42
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 81674650 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q32LQ0 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name AMPE_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >2871 bp
ATGATCTTGGAGGAGAGATCATCTTGGGAAGGCTCTAAGAGATACTGCATTAAGACGAAA
CATGTGGCCATTATCTGCGCAGTGGTGGTGGCTGTCGGATTAATAGTAGGACTTTCTGTG
GGTCTGACCAGATCATGTGACTCTACAGAGGGCATGACCCAGGGCACGACCCAGGGCACG
ACCCAGGCTCCTTCCCACCTGCCTCCCGTTACCAGCCCTCCAGAGGACCAGGGGGTCTGC
CCTGCCAGTGAGGATGAAAGCGGAGGCTGGAAAGACTTCAGGCTGCCGGACTTCATCAAA
CCAGTGCACTACGACCTGGAGGTGAAGCCCCTGATGGAGCAGGACACGTACACGGGCAGC
GTGGACATCTCCATCAACGTGAGCTCATCCACCCGGTACCTGTGGCTACATCTCCGGGAG
ACGAGGATCACCAGGCTCCCGGTGCTGAGGAGGCCGTCTGGGGAGCAGGTTCAAGTCAGG
CAGTGCTTCGAATACAAGAAGCAGGAGTATGTGGTGGTGGAAGCAGAAGAAGAGCTTGAG
CCCAACACTGGCGAGGGTCCCTACCACCTGATCCTGGAGTTCGCCGGCTGGCTGAACGGC
TCGCTCGTGGGATTTTACAGAACGACATACGTGGAGAAAGGACAAACCAAGAGCATAGCA
GCCACTGATCATGAACCAACAGATGCCAGGAAATCCTTCCCTTGTTTTGATGAGCCCAAC
AAAAAGGCAACGTATACAATATCCATTGTCCACTCCAAAGAATATAAGGCGCTTTCGAAT
ATGCCAGTGGAGAAAGAAGAGTCAGTGGATGATATATGGAGTCGGACAACTTTCCAGAAG
TCTGTTCCCATGAGTACTTACCTGGTGTGCTTTGCAGTGCATCAGTTTGACTCTGTAACG
AGAATATCAAACAGGGGGATACCTCTCACTATATATGTCCAGCCAGAGCAAAAGCACACA
GCTGAATATGCTGCAAACATAACTAAAAGTGTGTTTGACTATTTTGAAGACTACTTTGGT
ATGAGTTATTCTCTTCCTAAATTAGATAAAATTGCTATTCCAGATTTCGGCACTGGGGCT
ATGGAGAACTGGGGACTCATCACTTACAGAGAAACAAACCTGCTTTATGACCCTGATGAA
TCTGCCTCATCAAACAAACAGAGGGTGGCTGCTGTGATAGCCCATGAGCTTGTGCATCAG
TGGTTTGGAAATATTGTGACCATGGAATGGTGGGACGACTTGTGGCTAAATGAAGGATTT
GCTTCCTTCTTTGAGTACCTGGGAGTAGCCTATGCAGAAAAAGACTGGCAAATGCGTGAT
CAGATGATACTTGATGATGTATTACCTGTGCAAGAGGATGATTCTTTGATGTCTTCACAC
CCAATAGTAGTCACTGTAGCAACTCCTGATGAAATAACATCTGTTTTTGATGGAATTTCC
TATAGTAAGGGAGCTTCCATTCTGAGAATGCTTGAAAACTGGATAACACGAGAGAAATTT
CAAATAGGATGTCAGAATTACTTGAAAAAACACAAATTTGAGAATGCCAAAACTTCAGAT
TTCTGGGCAGCACTTGAAGAGGCAAGTAATCTCCCAGTGAAAGAAGTAATGGACACCTGG
ACCAATCAGATGGGTTACCCTGTACTTAACGTGGACAATATGAAGAACATCACACAGAAA
CGCTTTCTATTGGACCCGAGAGCTAATGCTTCTGAGCCACATTCAGCTTTTGGTTACACA
TGGAATATTCCAATTAAATGGACTGAAGATGATGAACAAAGGATTACATTATACAATAGG
TCAGAAACAGGAGGAATCACTTTGGAATCTACTCTTAGTGGGAATGCTTTTCTCAAAATA
AACCCTGATCATATTGGCTTTTATCGTGTAAATTATGAAGTGTCAACTTGGGAATGGATA
GCTACGAATCTTTCCGTCAACCACACGGACTTTTCTTCTGCTGATCGTGCAAGTTTTATT
GATGATGCTTTTGCCTTGGCACGAGCTCAGCTTCTAAATTATAAGGAGGCTCTGAACTTG
ACCAAGTATCTCAAGGAAGAAAAGGAATATTTACCATGGCACAGAGTCATTTCAGCTGTA
ACCTATATTATTAGCATGTTTGAAGATGATAAAGAGCTATACCCTGTGATTGAGAAATAC
TTCCGAGATCAAGTGAAGCCCATTGCAGATTCTCTGGGATGGAATGATGTTGGAGACCAC
CTCACAAAATTACTCCGTGCGTCTGTATTAGGACTGGCGTGCAAGATGGGAGACAGCGAT
GCCTTGAACAACGCTTCCCAGTTATTTCAGGAGTGGCTAACTGGGACTGTAAGTCTTCCT
GTAAATCTCAGGCTTCTGGTATATCGGTATGGTATGCAGAACTCTGGCAATGAGACTTCA
TGGAATTACACTCTCGAGCAATACCAGAAAACTTCATTAGCTCAAGAAAAAGAAAAGCTA
CTGTATGGATTAGCATCAGTGAAGAATGTTACTCTTTTGTCAAGGTATTTGGATTTACTC
AAGGACTCAAACCTTATTAAAACGCAGGATGTGTTTACAGTCATTCAGTACATCTCATAC
AACAGCTATGGGAAGACTATGGCCTGGAATTGGATACAACTCAACTGGGAATATCTAGTC
AACAGGTATACACTCAATAACAGAAACCTTGGCCGGATTGTCACTATAGCAGAGCCATTC
AACACTGAACTACAACTCTGGCAGATCAAGAGCTTTTTCGAAAGATATCCTGAAGCTGGA
GCGGGACAAAAACCTAGGGAGCAAGTACTGGAAACAGTGAAAAACAATATCGAGTGGCTA
AAACAAAACAGGGACACCATAAGAAACTGGTTTCTTGATTTGAATGGTTAA
Enzyme 10 GenBank Gene ID BC109476 Link Image
Enzyme 10 GeneCard ID ENPEP Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:4
Enzyme 10 Locus 4q25
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 580
Enzyme 11 Name Activation-induced cytidine deaminase
Enzyme 11 Synonyms
  1. Cytidine aminohydrolase
Enzyme 11 Gene Name AICDA
Enzyme 11 Protein Sequence >Activation-induced cytidine deaminase
MDSLLKKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSPTSFSLDFGHLRNKAGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFTARLYFCDKER
KAEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRI
LLPLYEVDDLRDAFRTLGL
Enzyme 11 Number of Residues 199
Enzyme 11 Molecular Weight 24051.4
Enzyme 11 Theoretical pI 9.65
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in cytidine deaminase activity
Enzyme 11 Specific Function RNA-editing deaminase involved in somatic hypermutation, gene conversion, and class-switch recombination. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 83755095 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q2PT36 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name AICDA_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence Not Available
Enzyme 11 GenBank Gene ID DQ303466 Link Image
Enzyme 11 GeneCard ID AICDA Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 12p13
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References Not Available
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 587
Enzyme 12 Name Superoxide dismutase [Cu-Zn]
Enzyme 12 Synonyms Not Available
Enzyme 12 Gene Name SOD1
Enzyme 12 Protein Sequence >Superoxide dismutase [Cu-Zn]
XAXKGXGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPL
SKKHGGPKDEERHVGDLGNVTADKNGVAXVDIVDPLISLSGE
Enzyme 12 Number of Residues 102
Enzyme 12 Molecular Weight 10295.2
Enzyme 12 Theoretical pI 5.81
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Inorganic ion transport and metabolism
Enzyme 12 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 134289051 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID A4URH1 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name A4URH1_BOVIN Link Image
Enzyme 12 PDB ID 1SXZ Link Image
Enzyme 12 PDB File Show
Enzyme 12 3D Structure
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID EF471304 Link Image
Enzyme 12 GeneCard ID SOD1 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:2
Enzyme 12 Locus 21q22.1|21q22.11
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 589
Enzyme 13 Name Superoxide dismutase [Cu-Zn]
Enzyme 13 Synonyms Not Available
Enzyme 13 Gene Name ECSOD
Enzyme 13 Protein Sequence >Superoxide dismutase [Cu-Zn]
MLALLCASVVLVAYASADQIQQQMGSNTEEQIRDMHAKVTEIWQEMMQRQAAAIDPDAAL
HAVCRVLPSATLEAEQPRVSGLVLFRQLRPGALLEAFFHLEGFPNEPNGTNRAIHVHQFG
DLSQGCDSTGPHYNPMSVPHPQHPGDFGNFAVRDGQVWKYRSGLAASLTGPHSIAGRAVV
VHAGEDDMGRGGNQASLENGNAGRRLACCVVGLCGPGPWARQTQEHAERKKRRRESECKA
V
Enzyme 13 Number of Residues 241
Enzyme 13 Molecular Weight 26176.4
Enzyme 13 Theoretical pI 7.09
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Inorganic ion transport and metabolism
Enzyme 13 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 63034211 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID A3KLR9 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name A3KLR9_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >726 bp
ATGCTGGCGCTGCTCTGTGCCTCTGTGGTCCTGGTGGCCTATGCCTCGGCCGACCAGATC
CAGCAGCAGATGGGCTCCAACACGGAGGAGCAGATCCGCGACATGCACGCCAAGGTGACG
GAGATCTGGCAGGAGATGATGCAGCGGCAGGCGGCGGCCATCGACCCGGACGCGGCGCTC
CATGCCGTCTGCCGGGTGCTGCCGTCGGCCACGCTGGAGGCGGAGCAGCCCCGGGTCAGC
GGCCTCGTGCTCTTCCGGCAGCTCCGGCCTGGCGCCCTGCTGGAGGCCTTCTTCCACCTT
GAGGGCTTCCCGAACGAGCCCAACGGCACAAACCGTGCCATCCACGTGCACCAGTTTGGG
GACCTGAGCCAGGGCTGCGACTCCACCGGGCCGCACTACAACCCGATGTCCGTGCCGCAC
CCGCAGCACCCGGGCGACTTCGGCAACTTCGCCGTGCGCGATGGCCAGGTCTGGAAGTAC
CGCTCCGGCCTGGCTGCCTCGCTCACCGGCCCGCATTCGATCGCGGGCCGTGCCGTGGTG
GTCCACGCGGGCGAGGACGACATGGGCCGCGGCGGCAATCAGGCCAGTCTGGAGAACGGT
AACGCCGGCCGCCGGCTTGCCTGCTGCGTGGTGGGTCTGTGTGGCCCCGGGCCCTGGGCA
CGCCAAACGCAGGAGCACGCGGAGCGCAAGAAGCGGCGGCGCGAGAGCGAGTGTAAAGCC
GTCTGA
Enzyme 13 GenBank Gene ID AY957404 Link Image
Enzyme 13 GeneCard ID ECSOD Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Not Available
Enzyme 13 Locus Not Available
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 612
Enzyme 14 Name N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
Enzyme 14 Synonyms
  1. Dimethylarginine dimethylaminohydrolase 1
  2. DDAH-1
  3. DDAHI
  4. Dimethylargininase-1
Enzyme 14 Gene Name DDAH1
Enzyme 14 Protein Sequence >N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
MASLGHPATFGRATHVVVRALPESLAQQALRRTKGDEVDFARAERQHQLYVGVLGSKLGL
QVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEADMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVVDALHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDTAANCIYLNIPSKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSNSELEKVDGLLTCSSVLINKKVDS
Enzyme 14 Number of Residues 285
Enzyme 14 Molecular Weight 31288.6
Enzyme 14 Theoretical pI 5.88
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Amino acid transport and metabolism
Enzyme 14 Specific Function Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in nitric oxide generation
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 151554584 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID P56965 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name DDAH1_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >858 bp
ATGGCTTCTCTCGGCCACCCAGCCACCTTTGGCCGGGCCACCCATGTCGTGGTACGGGCG
CTGCCCGAGTCCCTCGCCCAACAGGCGCTGAGGCGCACCAAGGGCGACGAGGTGGATTTC
GCCCGCGCTGAGCGGCAGCACCAGCTCTACGTGGGCGTGCTGGGCAGTAAACTGGGGCTG
CAGGTGGTGCAGCTGCCCGCCGACGAGAGCCTCCCAGACTGCGTGTTCGTGGAGGACGTG
GCCGTGGTGTGCGAGGAGACGGCCCTGATCACCCGCCCCGGGGCGCCGAGCCGGAGGAAG
GAGGCTGACATGATGAAAGAAGCACTAGAAAAACTTCAGCTCAACATAGTAGAGATGAAA
GATGAAAATGCAACTTTAGATGGTGGAGATGTCTTATTCACAGGCAGAGAATTTTTTGTG
GGCCTTTCCAAAAGGACAAATCAACGAGGTGCGGAAATCTTGGCTGATACTTTTAAGGAC
TATGCGGTCTCCACGGTCCCTGTGGTGGATGCTTTGCACTTGAAGAGTTTCTGCAGCATG
GCTGGGCCTAACCTAATCGCTATTGGATCCAGTGAATCTGCACAGAAGGCCCTCAAGATC
ATGCAACAGATGAGTGATCATCGCTACGACAAACTCACAGTGCCTGATGACACGGCCGCA
AACTGCATATACCTGAATATCCCCAGCAAAGGCCACGTCTTGCTGCACCGAACCCCAGAA
GAGTACCCAGAGAGTGCAAAGGTTTATGAAAAGCTGAAGGACCATATGCTGATCCCCGTG
AGCAATTCTGAACTGGAAAAGGTGGACGGGCTGCTCACCTGCAGCTCGGTTTTAATTAAC
AAGAAAGTAGACTCCTGA
Enzyme 14 GenBank Gene ID BC149998 Link Image
Enzyme 14 GeneCard ID DDAH1 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 1p22
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 650
Enzyme 15 Name Cytosolic non-specific dipeptidase
Enzyme 15 Synonyms
  1. CNDP dipeptidase 2
Enzyme 15 Gene Name CNDP2
Enzyme 15 Protein Sequence >Cytosolic non-specific dipeptidase
MSALTTLFKYVDENQDRYVKKLAEWVAIQSVSAWPEKRGEIRRMMEVAAADIKQLGGSVQ
LVDIGTQKLPDGSEIPLPPILLGKLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVE
RDGKLFGRGATDDKGPVAGWINALEAFQKTKQEVPVNVRFCLEGMEESGSEGLDALIFAQ
KDAFFKDVDYVCISDNYWLGKNKPCITYGLRGICYFFIEVECSDKDLHSGVYGGSVHEAM
TDLIMLMGCLMDKKGKILIPGISEAVAPVTEEELELYDKIDFDLEEYARDVGAGTLLHGC
KKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTPEVVSEQVTSY
LTKKFAELHSPNKFKVYMGHGGKPWVSDFNHPHYLAGRRALKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRRNYIEGTKMLAAYLYEVSQLKD
Enzyme 15 Number of Residues 475
Enzyme 15 Molecular Weight 52655.0
Enzyme 15 Theoretical pI 5.67
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Amino acid transport and metabolism
Enzyme 15 Specific Function Not Available
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 73586898 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q3ZC84 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name CNDP2_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1428 bp
ATGTCGGCCCTCACCACCCTGTTTAAGTACGTGGACGAAAATCAGGATCGATATGTTAAG
AAGCTTGCGGAATGGGTGGCCATCCAGAGCGTGTCAGCGTGGCCAGAGAAGAGAGGCGAG
ATCCGCAGGATGATGGAGGTGGCGGCCGCCGACATCAAGCAGCTGGGCGGCTCTGTGCAG
CTGGTGGACATCGGGACCCAGAAGCTCCCTGATGGCTCCGAGATCCCACTTCCGCCCATT
TTACTCGGCAAGCTGGGCTCTGACCCACAGAAGAAGACGGTGTGCATCTACGGCCACCTG
GACGTGCAGCCGGCGGCCCTGGAGGACGGCTGGGACAGCGAGCCCTTCACCCTGGTGGAG
CGAGACGGCAAACTGTTTGGGAGAGGAGCCACCGACGACAAGGGGCCGGTGGCCGGCTGG
ATCAATGCCCTGGAAGCCTTCCAGAAAACCAAGCAGGAAGTCCCGGTCAACGTCCGCTTC
TGCCTGGAGGGCATGGAGGAGTCGGGCTCCGAGGGCCTGGACGCGCTGATCTTCGCGCAG
AAAGACGCATTCTTCAAGGATGTGGACTACGTGTGCATCTCCGACAACTACTGGCTGGGC
AAGAACAAGCCCTGCATCACCTACGGGCTGCGGGGCATCTGCTACTTCTTCATCGAGGTG
GAATGCAGCGACAAGGACCTGCACTCGGGCGTGTACGGCGGCTCGGTGCACGAGGCCATG
ACCGACCTCATCATGCTGATGGGCTGCCTGATGGACAAGAAGGGGAAGATCCTCATCCCG
GGCATCAGTGAGGCCGTGGCCCCCGTGACCGAGGAGGAGCTGGAGCTCTACGACAAGATC
GATTTTGACCTGGAGGAGTACGCCCGGGACGTGGGCGCTGGGACCCTCCTGCATGGCTGC
AAGAAGGACATCCTGATGCACAGATGGCGTTACCCATCCCTGTCTCTTCATGGCATCGAA
GGTGCCTTCTCCGGGTCAGGGGCCAAGACCGTGATTCCACGAAAGGTGGTCGGCAAGTTC
TCCATCCGACTCGTCCCGAACATGACTCCGGAAGTGGTCAGCGAGCAGGTTACAAGCTAC
TTGACCAAGAAGTTTGCTGAGCTTCACAGTCCCAACAAGTTCAAGGTGTACATGGGCCAC
GGCGGGAAGCCCTGGGTGTCCGACTTCAACCACCCTCACTACCTGGCTGGGAGGAGGGCC
CTGAAGACAGTGTTTGGTGTCGAGCCGGACTTGACCAGGGAAGGCGGCAGCATCCCAGTG
ACACTGACGTTCCAGGAGGCCACAGGCAAGAACGTCATGCTGCTGCCCGTGGGCTCGGCG
GACGACGGAGCGCACTCCCAGAACGAGAAGCTCAACCGGCGCAACTACATTGAGGGGACC
AAGATGCTGGCCGCGTACCTGTACGAAGTCTCCCAGCTGAAGGACTGA
Enzyme 15 GenBank Gene ID BC102835 Link Image
Enzyme 15 GeneCard ID CNDP2 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:1
Enzyme 15 Locus 18q22.3
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References Not Available
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 665
Enzyme 16 Name Peptidyl-glycine alpha-amidating monooxygenase
Enzyme 16 Synonyms
  1. PAM
  2. Peptidylglycine alpha-hydroxylating monooxygenase
  3. PHM
  4. Peptidyl-alpha-hydroxyglycine alpha-amidating lyase
  5. Peptidylamidoglycolate lyase
  6. PAL
Enzyme 16 Gene Name PAM
Enzyme 16 Protein Sequence >Peptidyl-glycine alpha-amidating monooxygenase
MAGFRSLLVLLLVFPSGCVGFRSPLSVFKRFKETTRSFSNECLGTTRPVIPIDSSDFALD
IRMPGVTPKQSDTYFCMSVRLPMDEEAFVIDFKPRASMDTVHHMLLFGCNMPASTGNYWF
CDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKD
CSGVSLHLTRLPQPLIAGMYLMMSVDTVIPPGGKVVNSDISCHYKKYPMHVFAYRVHTHH
LGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTH
IGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDIFRTIPPEANIPIPVKSDMVMMHG
HHKETENKDKTSLLQQPKREEEGVLEQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESES
DLVAEIANVVQKKDLGRSDTRESAEQERGNAILVRDRIHKFHRLVSTLRPAESRVLSLQQ
PLPGEGTWEPEHTGDFHVEEALDWPGVYLLPGQVSGVALDPQNNLVIFHRGDHVWDGNSF
DSKFVYQQRGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVALH
QVFKLDPKSKEGPLLTLGRSMQPGSDQNHFCQPTDVAVDPDTGTIYVSDGYCNSRLVQFS
PSGKFITQWGEASLESSPKPGQFRVPHSLALVPPLGQLCVADRENGRIQCFKTDTKEFVR
EIKHPSFGRNVFAISYIPGLLFAVNGKPYFEDQEPVQGFVMNFSSGEIIDVFKPVRKHFD
MPHDIAASEDGTVYVGDAHTNTVWKFTSTEKMEHRSVKKAGIEVQEIKESEAVVETKMEN
KPASSELQKIQEKQKLVKEPGSGVPAVLITTLLVIPVVVLLAIALFIRWKKSRAFGDSER
KLEASSGRVLGRLRGKGGGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKDEDASESEEE
YSAPPPAPAPSS
Enzyme 16 Number of Residues 972
Enzyme 16 Molecular Weight 108176.1
Enzyme 16 Theoretical pI 6.59
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in copper ion binding
Enzyme 16 Specific Function Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • 1-20
Enzyme 16 Transmembrane Regions
  • 874-897
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 163482 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID P10731 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name AMD_BOVIN Link Image
Enzyme 16 PDB ID 1SDW Link Image
Enzyme 16 PDB File Show
Enzyme 16 3D Structure
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >2919 bp
ATGGCTGGCTTTCGGAGCCTGCTAGTTCTTCTCCTCGTGTTTCCCAGTGGCTGTGTGGGC
TTCCGAAGCCCACTTTCTGTCTTTAAGAGGTTTAAAGAAACTACCAGATCATTTTCCAAT
GAATGTCTTGGTACCACCAGACCAGTAATTCCTATCGATTCATCAGATTTTGCGTTGGAT
ATTCGCATGCCTGGGGTCACACCCAAACAGTCTGATACGTACTTCTGCATGTCAGTGCGT
TTGCCAATGGATGAGGAAGCCTTCGTGATTGACTTCAAACCCCGTGCCAGCATGGATACT
GTCCATCATATGTTACTGTTTGGATGCAATATGCCAGCGTCCACTGGAAATTACTGGTTT
TGTGATGAAGGCACCTGTACAGATAAAGCCAATATTCTCTATGCCTGGGCAAGAAATGCT
CCCCCAACGAGACTCCCCAAAGGTGTTGGATTCAGAGTTGGAGGAGAGACTGGAAGCAAA
TACTTTGTACTCCAAGTACACTATGGGGATATTAGTGCTTTTAGAGATAATCACAAGGAC
TGCTCTGGTGTTTCCTTACACCTCACACGCCTGCCACAGCCTTTAATTGCTGGCATGTAC
CTTATGATGTCTGTTGACACTGTTATACCACCAGGAGGGAAAGTGGTGAATTCTGATATT
TCATGCCATTATAAAAAGTATCCAATGCATGTCTTTGCCTACAGAGTTCACACTCACCAT
TTAGGCAAGGTAGTCAGTGGATACAGAGTAAGAAATGGACAGTGGACCCTGATTGGACGC
CAAAGCCCCCAACTGCCACAGGCCTTCTACCCAGTAGAGCACCCAGTGGATGTGAGTTTT
GGTGACATCCTGGCAGCAAGATGTGTGTTCACTGGGGAAGGGAGGACAGAAGTCACACAC
ATTGGTGGCACGTCTAGTGATGAAATGTGCAACTTATACATTATGTATTACATGGAAGCC
AAGCATGCAGTTTCTTTCATGACCTGTACACAGAATGTAGCTCCAGATATATTCAGAACC
ATACCACCAGAGGCCAATATTCCAATTCCTGTGAAATCCGATATGGTTATGATGCATGGA
CATCACAAAGAAACAGAGAACAAAGACAAGACTTCTTTACTACAGCAGCCCAAACGAGAA
GAAGAAGGAGTGTTAGAACAGGGTGATTTCTATTCACTACTTTCCAAGCTGCTAGGAGAA
AGGGAAGATGTTGTTCATGTGCATAAATATAATCCTACAGAAAAGGCAGAATCAGAGTCT
GACCTGGTAGCTGAGATTGCAAACGTAGTCCAAAAGAAGGATCTTGGTCGGTCCGATACC
AGAGAGAGTGCAGAACAGGAGAGGGGCAATGCTATTCTTGTCAGAGACAGAATTCACAAA
TTCCACAGACTAGTGTCTACCTTGAGGCCTGCAGAGAGCAGAGTTCTGTCGTTACAGCAG
CCCCTACCTGGTGAAGGCACCTGGGAACCAGAACACACAGGAGATTTCCATGTAGAAGAG
GCACTGGATTGGCCTGGAGTATACTTGTTACCAGGCCAGGTTTCTGGGGTGGCTCTGGAC
CCTCAGAATAATCTCGTGATTTTCCACCGAGGTGACCACGTCTGGGATGGAAACTCTTTT
GATAGCAAGTTTGTTTACCAGCAAAGAGGTCTTGGACCAATTGAAGAAGACACTATTCTT
GTCATAGATCCAAATAATGCTGCAGTACTCCAGTCCAGTGGAAAAAATCTGTTTTACTTG
CCACATGGCTTGAGTATAGATAAAGATGGAAATTATTGGGTCACAGACGTGGCGCTTCAT
CAGGTGTTCAAACTAGATCCAAAGAGTAAAGAAGGCCCTCTGCTAACCCTGGGAAGGAGC
ATGCAACCAGGCAGTGACCAGAATCACTTCTGTCAGCCCACCGATGTGGCTGTGGATCCA
GACACCGGAACCATCTATGTGTCAGATGGCTACTGCAACAGTCGCCTTGTGCAGTTTTCA
CCAAGTGGAAAATTCATCACACAGTGGGGAGAAGCGTCTCTAGAGAGCAGTCCTAAACCA
GGCCAGTTCAGAGTTCCTCACAGCTTGGCCCTGGTGCCTCCCCTGGGCCAGCTGTGTGTG
GCAGACCGGGAAAACGGTCGGATCCAGTGTTTCAAAACCGACACCAAAGAATTTGTGCGC
GAGATTAAGCACCCATCGTTTGGAAGAAATGTGTTTGCAATTTCATACATACCAGGTTTG
CTCTTTGCGGTGAATGGAAAGCCTTACTTTGAGGACCAAGAACCCGTGCAAGGATTTGTG
ATGAACTTTTCCAGCGGGGAAATTATCGATGTCTTCAAGCCAGTGCGCAAGCACTTCGAC
ATGCCCCACGACATTGCTGCGTCCGAGGACGGGACCGTGTATGTCGGAGACGCTCACACC
AACACCGTGTGGAAGTTCACCTCGACCGAAAAAATGGAACATCGATCAGTTAAGAAGGCT
GGCATTGAGGTTCAGGAAATCAAAGAATCCGAGGCAGTTGTTGAAACCAAAATGGAGAAC
AAGCCCGCCTCCTCAGAATTGCAGAAGATACAAGAGAAACAGAAGCTGGTCAAAGAGCCG
GGCTCCGGAGTGCCGGCTGTTCTCATTACAACCCTTCTGGTTATTCCTGTGGTTGTCCTG
CTGGCCATTGCCTTATTTATTCGGTGGAAAAAATCAAGGGCCTTTGGAGATTCTGAACGT
AAACTTGAGGCCAGTTCGGGAAGAGTTCTGGGAAGACTTAGAGGAAAGGGAGGCGGAGGC
CTAAACCTGGGCAACTTCTTCGCCAGCCGGAAGGGCTACAGCCGGAAGGGGTTCGACCGC
CTCAGCACGGAAGGAAGCGACCAGGAGAAAGATGAGGACGCAAGCGAGTCCGAAGAAGAG
TACTCGGCCCCGCCGCCCGCCCCTGCCCCTTCCTCCTGA
Enzyme 16 GenBank Gene ID M18683 Link Image
Enzyme 16 GeneCard ID PAM Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:5
Enzyme 16 Locus 5q14-q21
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 784
Enzyme 17 Name Sorbitol dehydrogenase
Enzyme 17 Synonyms
  1. L-iditol 2-dehydrogenase
Enzyme 17 Gene Name SORD
Enzyme 17 Protein Sequence >Sorbitol dehydrogenase
MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFV
VKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCA
TPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGA
GPIGLVSLLAAKAMGAAQVVVTDLSASRLSKAKEVGADFILQISNESPQEIAKKVEGLLG
SKPEVTIECTGVETSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYC
NTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIKCDPNDQNP
Enzyme 17 Number of Residues 356
Enzyme 17 Molecular Weight 38098.9
Enzyme 17 Theoretical pI 7.50
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Amino acid transport and metabolism
Enzyme 17 Specific Function L-iditol + NAD(+) = L-sorbose + NADH
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 61554779 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q58D31 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name DHSO_BOVIN Link Image
Enzyme 17 PDB ID 1PL8 Link Image
Enzyme 17 PDB File Show
Enzyme 17 3D Structure
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >1071 bp
ATGGCGGCGGCCAAGCCCGAGAACCTCTCCCTGGTGGTGCACGGACCCGGAGACTTGCGC
TTGGAAAACTATCCTATCCCTGAACCAGGCCCAAATGAGGTGCTTCTGAAGATGCATTCT
GTTGGAATTTGTGGCTCAGATGTCCATTACTGGCAGCATGGTCGAATTGGAGATTTTGTT
GTGAAAAAGCCAATGGTGCTGGGGCATGAAGCTTCAGGAACAGTCGTAAAAGTGGGATCA
TTGGTCAGGCACCTACAACCAGGTGATCGTGTCGCCATCGAGCCTGGTGCTCCTCGAGAA
ACTGATGAGTTCTGCAAGATTGGCCGATACAATCTGTCACCTACCATCTTCTTCTGCGCC
ACGCCCCCTGATGATGGGAACCTCTGCCGGTTCTACAAGCACAATGCTAACTTCTGCTAC
AAGCTTCCTGACAATGTCACCTTTGAGGAAGGGGCCCTGATTGAGCCACTGTCTGTGGGG
ATCCATGCCTGCCGGCGAGCTGGAGTCACGCTGGGGAACAAGGTCCTTGTGTGTGGAGCT
GGGCCAATTGGACTGGTCAGTTTGCTTGCAGCCAAGGCAATGGGTGCAGCTCAAGTGGTG
GTGACTGATCTGTCAGCCTCTCGGTTGTCTAAAGCCAAGGAAGTCGGGGCTGATTTCATC
CTCCAGATCTCCAACGAGAGCCCTCAGGAAATAGCCAAGAAAGTGGAAGGCCTGCTGGGC
AGCAAGCCAGAAGTCACAATTGAGTGCACAGGGGTGGAGACCTCCATCCAAGCCGGCATC
TACGCCACTCATTCTGGTGGGACCCTGGTGTTGGTGGGGCTGGGCTCTGAGATGACCAGC
GTGCCCCTCGTGCACGCAGCCACCAGGGAGGTGGACATCAAGGGCGTGTTTCGATACTGC
AATACATGGCCGATGGCGATTTCAATGCTTGCATCCAAGTCTGTGAATGTAAAGCCCTTG
GTCACCCATCGGTTTCCTCTGGAGAAAGCTCTGGAGGCCTTTGAAACATCCAAAAAGGGT
TTGGGGTTGAAAGTCATGATCAAGTGTGACCCCAACGACCAGAATCCATGA
Enzyme 17 GenBank Gene ID BT021766 Link Image
Enzyme 17 GeneCard ID SORD Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 15q15.3
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References
  1. [PubMed Link Image]
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 820
Enzyme 18 Name A disintegrin and metalloproteinase with thrombospondin motifs 4
Enzyme 18 Synonyms
  1. ADAMTS-4
  2. ADAM-TS 4
  3. ADAM-TS4
  4. Aggrecanase-1
  5. ADMP-1
Enzyme 18 Gene Name ADAMTS4
Enzyme 18 Protein Sequence >A disintegrin and metalloproteinase with thrombospondin motifs 4
MSHMDSHPGRGLADGWLWGIQPRLLLPTVPVSGSRLVWLLLLASLLPSAWPASPLPREEE
IVFPEKLNGSVLPGLGAPARLLYRLPAFGETLLLELEKDPGVQVEGLTVQYLGRAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGTELHIQPLEGGAPNSAGGPGAHI
LRRKSPVSGQGPMCNVKAPPGKPSPSPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVVLGPGEEGPQVGPSAAQTLRSFCAWQRGLN
TPDDADPGHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFSMLHDNSKQCTGLNGPESTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGF
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHVDQLQAFNVPQAGGWGPWGSWGDCSRSCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTQDCPTGSALTFREEQCAAYNHRTDLFKNF
PGPMDWVPRYTGVAPRDQCKLTCQTRALGYYYVLDPRVADGTPCSPDSSSVCVQGRCIHA
GCDRVIGSKKKFDKCMVCGGDGSSCSKQSGSFKKFRYGYNNVVTIPAGATHILVRQQGSP
SVRSLYLALKLPDGSYALNGEYTLIPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAEP
LTLQVLVAGNPQNARLRYSFFVPRPRPVPSTPRPTPQDWLRRKSQILEILRRRSWAGRK
Enzyme 18 Number of Residues 839
Enzyme 18 Molecular Weight 90279.1
Enzyme 18 Theoretical pI 8.24
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in metalloendopeptidase activity
Enzyme 18 Specific Function Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. Cleaves aggrecan at the '392-Glu-|-Ala-393' site
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • 1-51
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 31324244 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q9TT93 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name ATS4_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >2520 bp
ATGTCCCACATGGACTCGCATCCCGGGAGGGGCTTGGCGGACGGCTGGCTGTGGGGAATC
CAACCCCGCCTGCTGCTCCCCACTGTGCCCGTCTCCGGCTCCAGGCTAGTGTGGCTGCTG
CTGCTAGCCTCCCTCCTGCCCTCAGCCTGGCCGGCCAGCCCCCTCCCCCGGGAGGAGGAG
ATCGTGTTTCCAGAGAAGCTCAACGGCAGCGTCCTGCCTGGTTTGGGCGCCCCTGCCAGG
CTGTTGTACCGCTTGCCAGCCTTTGGGGAGACGCTGCTGCTAGAGCTGGAGAAGGACCCC
GGCGTGCAGGTTGAGGGGCTGACGGTGCAATACTTGGGCCGAGCGCCTGAGCTGCTAGGT
GGGGCGGAGCCAGGCACCTACCTCACCGGCACCATCAACGGAGATCCGGAGTCGGTGGCA
TCTCTGCACTGGGACGGGGGAGCACTTTTAGGGGTGCTGCAGTACCGAGGGACTGAACTC
CACATCCAGCCCCTGGAGGGAGGCGCGCCTAACTCCGCTGGGGGGCCTGGGGCTCACATC
CTACGCCGGAAGAGTCCTGTCAGCGGCCAGGGCCCCATGTGCAACGTCAAGGCTCCTCCT
GGGAAACCCAGCCCCAGCCCCCGAAGGGCTAAGCGCTTTGCCTCACTGAGCAGATTTGTG
GAGACTCTGGTGGTGGCAGATGACAAGATGGCGGCATTCCATGGTGCAGGGCTCAAGCGC
TACCTGCTGACAGTTATGGCAGCGGCGGCCAAGGCCTTCAAGCACCCGAGCATCCGCAAC
CCCGTCAGCTTGGTGGTGACTCGGCTAGTGGTTCTGGGGCCAGGTGAGGAAGGGCCCCAA
GTGGGCCCCAGTGCCGCCCAGACCCTGCGCAGCTTCTGTGCCTGGCAACGAGGACTCAAC
ACCCCTGACGACGCGGACCCTGGCCACTTTGACACAGCCATTCTGTTTACCCGGCAGGAC
CTGTGCGGAGTTTCTACCTGTGACACTCTAGGCATGGCTGACGTGGGCACCGTGTGTGAC
CCTGCCCGGAGCTGCGCCATTGTGGAGGATGATGGGCTGCAGTCAGCTTTCACCGCTGCT
CATGAACTGGGCCATGTCTTCAGCATGCTCCATGACAACTCGAAGCAATGCACTGGTCTG
AATGGGCCTGAGAGCACCTCCCGCCACGTCATGGCTCCTGTGATGGCTCACGTGGATCCC
GAGGAGCCCTGGTCCCCCTGCAGCGCCCGCTTCATCACTGACTTCCTAGACAATGGCTTC
GGGCACTGTCTCCTAGACAAGCCGGAGGCTCCTCTGCATCTGCCCGTGACCTTCCCCGGC
AAGGACTACGACGCTGACCGCCAGTGCCAGCTGACCTTTGGGCCTGACTCGCGCCATTGT
CCACAGCTGCCGCCGCCCTGTGCTGCCCTCTGGTGCTCTGGCCATCTGAATGGCCATGCC
ATGTGCCAGACTAAGCACTCACCCTGGGCCGACGGTACCCCTTGCGGGCCCGCACAGGCT
TGTATGGGTGGCCGCTGCCTCCATGTGGACCAGCTCCAGGCTTTCAATGTCCCACAGGCT
GGTGGCTGGGGTCCCTGGGGATCGTGGGGTGACTGCTCTCGGAGCTGTGGGGGTGGTGTC
CAGTTCTCTTCCCGGGACTGCACACGGCCCGTCCCCCGGAATGGTGGCAAGTACTGTGAG
GGCCGCCGTACCCGCTTCCGTTCCTGCAACACCCAGGACTGCCCAACTGGCTCAGCACTG
ACCTTCCGCGAAGAGCAGTGTGCTGCCTACAACCACCGCACTGACCTCTTCAAGAACTTC
CCCGGGCCCATGGACTGGGTTCCTCGCTACACTGGTGTGGCCCCCCGGGACCAGTGCAAA
CTCACCTGCCAGACCCGGGCACTGGGCTACTATTACGTGCTGGACCCACGGGTGGCAGAT
GGGACCCCCTGTTCCCCGGACAGCTCCTCAGTCTGTGTCCAGGGCCGCTGCATCCATGCC
GGCTGTGACCGCGTCATTGGCTCCAAAAAGAAGTTCGACAAGTGCATGGTGTGTGGTGGG
GATGGTTCCAGCTGCAGCAAGCAGTCTGGCTCCTTCAAAAAATTCAGGTACGGATACAAC
AACGTGGTCACCATCCCCGCTGGGGCCACCCACATCCTGGTGCGACAGCAGGGGAGCCCT
AGCGTCCGGAGCCTCTACCTGGCCCTGAAGCTCCCCGATGGCTCCTATGCCCTCAACGGT
GAATACACGCTGATCCCGTCCCCCACAGACGTGGTACTGCCCGGGGCCGTCAGCCTGCGC
TACAGCGGGGCCACTGCAGCCTCGGAGACACTGTCAGGACACGGGCCCCTGGCTGAGCCC
TTAACGCTGCAGGTCCTAGTGGCTGGCAACCCGCAGAACGCCCGCCTCAGATACAGCTTC
TTCGTGCCGCGACCGCGACCGGTCCCCTCCACGCCACGCCCCACTCCCCAGGACTGGCTG
CGCCGCAAGTCACAGATTCTGGAGATCCTCCGGCGGCGCTCCTGGGCCGGCAGGAAATAA
Enzyme 18 GenBank Gene ID AF516915 Link Image
Enzyme 18 GeneCard ID ADAMTS4 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:1
Enzyme 18 Locus 1q21-q23
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 825
Enzyme 19 Name Aprataxin and PNK-like factor
Enzyme 19 Synonyms
  1. Apurinic-apyrimidinic endonuclease APLF
Enzyme 19 Gene Name APLF
Enzyme 19 Protein Sequence >Aprataxin and PNK-like factor
MSGGFELQPQDGGPRVALAPGETVIGRGPLLGLHRNPCYYQSSEKSQLLPLKTNIWCWLN
PGDHFSLLVDKYIFCVLSTHSEMEMECTLRNSQMLDEDDILNEIPKSSSADLPDKTPSAP
RRERSTETAKPQAAANNMSFIGESRDLSKQQPNPSERKRILPAWMLTENSSDQNLSVISG
GNNVTWESEKERVCKDKTQVNITQPGKKRLISSGSSESTSAKQDTGKKCKNDDQEESIIS
SKEMPQSFSAAMLHNTEIDNTKTNPQRSKVPVEALGKVSEHKIITKGSSNEDSTARSCSE
SYSSTQSKSFCDKPQKSHPEPSSNPPSPECVQAKATDSVPNGSEENKVQRTSCMYGANCY
RKNPVHFQHFSHPGDSDYGGVNITCQDEADDRPECPYGASCYRKNPQHKIEYRHSTFPVR
SISDEDDNVGQPNEYNLNDSFIDDEEEEYEPTDEDSDWEPEKEDLEKEDMEGLLKEAKKF
MKRKK
Enzyme 19 Number of Residues 485
Enzyme 19 Molecular Weight 54325.4
Enzyme 19 Theoretical pI 4.87
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Involved in 3'-5' exonuclease activity
Enzyme 19 Specific Function Nuclease involved in single-strand and double-strand DNA break repair. Recruited to sites of DNA damage through interaction with poly(ADP-ribose), a polymeric post-translational modification synthesized transiently at sites of chromosomal damage to accelerate DNA strand break repair reactions. Displays apurinic- apyrimidinic (AP) endonuclease and 3'-5' exonuclease activities in vitro. Also able to introduce nicks at hydroxyuracil and other types of pyrimidine base damage
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 117306365 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID A0JNH9 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name APLF_BOVIN Link Image
Enzyme 19 PDB ID Not Available
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >1458 bp
ATGTCCGGGGGCTTCGAGCTGCAGCCGCAGGACGGCGGCCCCCGGGTGGCCTTGGCGCCC
GGGGAGACGGTCATCGGCCGCGGGCCGCTTCTGGGACTACACAGAAATCCATGTTATTAT
CAGTCTTCTGAGAAGAGCCAGCTCTTACCATTGAAGACAAATATATGGTGCTGGTTGAAT
CCTGGAGATCACTTTTCTTTATTAGTTGACAAATACATTTTCTGTGTCTTGTCTACACAT
TCTGAAATGGAAATGGAGTGTACTTTAAGAAATAGTCAAATGCTTGATGAAGATGATATA
TTGAATGAAATACCAAAATCTTCCTCAGCTGATTTGCCTGATAAAACACCCAGTGCCCCA
CGGCGGGAAAGAAGTACAGAAACAGCAAAGCCCCAGGCCGCTGCAAATAACATGTCTTTC
ATAGGTGAAAGTAGAGACTTGAGTAAGCAACAGCCAAATCCTTCCGAGAGGAAAAGAATC
CTCCCAGCATGGATGTTAACAGAAAATTCAAGTGATCAGAACCTTTCAGTCATCAGTGGA
GGTAATAATGTAACCTGGGAAAGTGAAAAAGAAAGAGTCTGCAAAGATAAAACCCAAGTA
AACATAACACAGCCAGGAAAAAAGCGATTAATTTCATCAGGAAGTTCAGAAAGTACATCA
GCAAAGCAAGACACAGGAAAAAAGTGCAAAAATGATGATCAGGAAGAGTCTATCATTTCA
TCCAAGGAAATGCCACAGTCATTTTCTGCAGCCATGTTACATAACACAGAGATAGATAAC
ACTAAGACTAATCCACAGAGAAGCAAAGTCCCAGTAGAGGCACTTGGTAAGGTTTCTGAA
CATAAAATCATCACTAAGGGAAGTTCAAATGAAGACAGCACGGCGAGAAGTTGTTCTGAG
AGTTATTCCAGTACCCAGAGCAAGTCTTTCTGTGACAAGCCTCAAAAATCTCATCCTGAG
CCCAGCTCTAATCCGCCCAGTCCTGAATGTGTGCAGGCGAAGGCAACCGATTCAGTTCCA
AATGGTTCTGAAGAAAACAAGGTACAGAGAACATCCTGCATGTATGGGGCAAACTGCTAC
AGGAAAAATCCTGTCCATTTTCAACACTTCAGTCACCCTGGTGATAGTGATTATGGAGGT
GTAAACATCACGTGTCAAGATGAAGCTGATGACCGACCTGAATGTCCCTATGGAGCATCT
TGTTATAGGAAGAATCCCCAGCACAAGATAGAATATAGACATAGTACATTTCCAGTGAGA
AGCATTTCAGATGAAGATGACAATGTTGGGCAACCCAATGAATACAACCTGAATGACAGC
TTTATAGATGATGAGGAAGAAGAATACGAGCCAACAGACGAAGATTCCGACTGGGAACCA
GAAAAGGAAGACCTAGAGAAGGAAGATATGGAAGGGCTTTTGAAAGAAGCAAAAAAATTT
ATGAAAAGAAAAAAGTGA
Enzyme 19 GenBank Gene ID BC126691 Link Image
Enzyme 19 GeneCard ID APLF Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:2
Enzyme 19 Locus 2p14
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References Not Available
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 828
Enzyme 20 Name DNA-(apurinic or apyrimidinic site) lyase 2
Enzyme 20 Synonyms
  1. Apurinic-apyrimidinic endonuclease 2
  2. AP endonuclease 2
  3. APEX nuclease 2
Enzyme 20 Gene Name APEX2
Enzyme 20 Protein Sequence >DNA-(apurinic or apyrimidinic site) lyase 2
MLRLVSWNINGIRSPLQGVRCEEPSSCSAMAMGRILDKLDADIVCLQETKVTRDVLTEPL
AIIEGYNSYFSFSRNRSGYSGVATFCKDSATPVAAEEGLSGLLSTQNGDVGCYGNMDDFT
QEELRALDSEGRALLTQHKICTWEGKEKTLTLINVYCPHADPGKPERLTFKMRFYRLLQI
RAEALLAAGSHVIILGDLNTAHRPIDHWDAVNMECFEEDPGRKWMDGLLSNLGCESGSHM
GPFIDSYRCFQPKQKGAFTCWSTVSGARHLNYGSRLDYVLGDRTLVIDTFQSSFLLPEVM
GSDHCPVGAVLSVSSVPAKQCPPLCTCFLPEFAGTQLKILRFLVHFKQDPVFKQSALQPS
NQTQVHMRKNKARVRSTRSRPSKTGSSRGQKNLMSYFQPSSSGPQTSNLDLPSLGTLITP
KTSEEDVMANVVEGQTKASEAKDEKEIRTSFWKSLLGGPSPMPLCGGHREPCVMRTVKKP
GPNLGRHFYMCARPQGPPTDPSSRCNFFLWSRPS
Enzyme 20 Number of Residues 514
Enzyme 20 Molecular Weight 56937.5
Enzyme 20 Theoretical pI 8.24
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Replication, recombination and repair
Enzyme 20 Specific Function May participate in both nuclear and mitochondrial post- replicative base excision repair (BER). In the nucleus functions in the PCNA-dependent BER pathway
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 59858127 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q5E9N9 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name APEX2_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >1545 bp
ATGTTGCGCTTGGTGAGCTGGAACATCAATGGGATACGGAGCCCCTTGCAAGGGGTGAGA
TGCGAGGAGCCCAGCAGCTGCAGCGCCATGGCTATGGGGCGCATTTTGGACAAGCTGGAT
GCAGACATCGTCTGTCTTCAGGAGACCAAAGTGACCAGGGATGTGCTGACAGAGCCCCTG
GCTATCATTGAGGGCTACAACTCCTATTTCAGCTTCAGCCGTAACCGCAGTGGCTATTCT
GGTGTAGCCACTTTCTGTAAGGACAGTGCTACCCCAGTGGCTGCTGAAGAAGGCCTGAGT
GGCCTGCTTTCCACTCAGAATGGGGATGTGGGTTGCTATGGAAACATGGATGACTTCACC
CAAGAGGAACTTCGAGCTCTGGATAGTGAGGGCCGGGCCCTCCTCACACAACACAAAATC
TGCACATGGGAAGGGAAGGAGAAGACCTTGACCCTAATCAACGTGTACTGCCCCCATGCG
GACCCTGGGAAGCCTGAGCGACTCACCTTTAAGATGCGCTTCTATCGCTTGCTGCAGATC
CGAGCAGAAGCTCTCCTGGCAGCTGGCAGCCATGTTATCATTCTGGGTGATCTGAATACA
GCCCACCGCCCCATTGATCACTGGGATGCAGTCAACATGGAATGCTTTGAAGAGGACCCA
GGGCGCAAGTGGATGGATGGTTTGCTCAGTAACCTGGGGTGTGAGAGTGGCTCCCACATG
GGACCCTTCATCGATAGCTACCGCTGCTTCCAGCCAAAGCAGAAGGGGGCCTTCACCTGT
TGGTCAACAGTCAGTGGTGCCCGCCATTTGAACTATGGCTCCCGGCTTGACTACGTGTTG
GGGGATAGGACCCTGGTCATAGACACCTTTCAGTCTTCCTTCTTGCTGCCTGAGGTGATG
GGCTCTGATCACTGCCCTGTGGGTGCAGTCTTAAGCGTGTCCTCTGTGCCAGCAAAACAG
TGCCCACCTCTGTGCACCTGCTTCCTCCCTGAGTTTGCAGGTACCCAACTCAAGATCCTA
CGATTCCTGGTTCACTTCAAACAAGATCCTGTGTTCAAGCAGTCAGCACTTCAGCCCAGC
AATCAAACACAGGTACACATGCGCAAAAACAAAGCCCGTGTGCGCTCAACTAGGTCCCGG
CCAAGTAAAACTGGCTCCAGTAGAGGCCAAAAAAACCTGATGAGCTACTTCCAGCCATCC
TCCAGTGGCCCCCAAACTTCTAACTTGGATCTTCCTAGCCTGGGCACCCTTATAACCCCA
AAGACCTCAGAAGAGGATGTGATGGCCAATGTGGTGGAGGGGCAGACCAAGGCTTCAGAG
GCCAAGGATGAAAAGGAGATACGGACCTCATTCTGGAAGTCTCTGCTGGGGGGACCCTCG
CCCATGCCCCTCTGTGGGGGACACAGGGAGCCATGTGTAATGCGAACTGTAAAGAAGCCA
GGACCCAACCTGGGCCGCCACTTCTACATGTGTGCCAGGCCCCAGGGTCCTCCCACTGAC
CCCTCTTCCCGCTGCAATTTCTTCCTCTGGAGCAGGCCCAGCTGA
Enzyme 20 GenBank Gene ID BT020881 Link Image
Enzyme 20 GeneCard ID APEX2 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Not Available
Enzyme 20 Locus Xp11.21
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 974
Enzyme 21 Name Carboxypeptidase N catalytic chain
Enzyme 21 Synonyms
  1. CPN
  2. Carboxypeptidase N polypeptide 1
  3. Carboxypeptidase N small subunit
Enzyme 21 Gene Name CPN1
Enzyme 21 Protein Sequence >Carboxypeptidase N catalytic chain
MSDLVSIFLHLLLFKLVAPVTFRHHRYDDLVRMLYKVHNECPHITRVYSIGRSVKGRHLY
VLEFSDYPGIHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRIVRLVEDT
RIHIMPSMNPDGYEVAAAAQERDISGYLVGRNNANGVDLNRNFPDLNTYIYYNEKNGGPN
HHFPLPDNWKSQVEPETQAVIQWIRSFNFVLSANLHGGAVVANYPYDKSLGHRVRGFRRT
ANTPTPDDKLFQKLAKIYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPLQGELQREWLGNREALIQFLEQVHQGIKGMVRDENYNNLADAVIS
VGGINHDVTSGAHGDYFRLLLPGTYTVTATAPGFDPETVSVTVGPAEPKLVNFQLKRSTP
QAAPKRRIPNSGHRGRVLPKKVQPRAARKKETMMKQPQRGPA
Enzyme 21 Number of Residues 462
Enzyme 21 Molecular Weight 52668.5
Enzyme 21 Theoretical pI 8.79
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Amino acid transport and metabolism
Enzyme 21 Specific Function Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • 1-19
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 86821877 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID Q2KJ83 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name CBPN_BOVIN Link Image
Enzyme 21 PDB ID Not Available
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >1389 bp
ATGTCAGACCTGGTCTCAATCTTCCTCCACCTCCTTCTCTTCAAGTTGGTTGCCCCAGTG
ACCTTTCGCCACCACCGCTATGATGACCTCGTGCGGATGCTGTACAAGGTGCACAACGAA
TGTCCCCACATCACTCGGGTTTACAGCATTGGGCGCAGTGTGAAGGGGAGACACCTCTAT
GTGCTGGAATTCAGCGACTACCCTGGAATCCACGAACCCTTGGAACCGGAAGTCAAGTAC
GTGGGGAATATGCACGGCAATGAGGTGCTAGGCCGTGAGCTGCTGCTGCAGCTGTCGGAG
TTCCTGTGTGAGGAATTCCGCAACAGGAACCAGCGCATCGTCCGGCTGGTGGAGGACACG
CGCATCCACATCATGCCGTCCATGAACCCTGACGGCTACGAGGTGGCCGCTGCTGCCCAG
GAACGGGACATCTCTGGGTATCTGGTTGGCAGGAACAATGCAAATGGGGTGGACCTGAAC
CGCAACTTCCCCGATCTCAATACCTACATCTACTACAATGAGAAGAACGGAGGCCCCAAC
CACCACTTCCCCCTTCCAGACAACTGGAAAAGTCAGGTGGAACCCGAGACCCAGGCTGTG
ATACAGTGGATCCGATCCTTCAACTTTGTCCTTTCAGCCAATCTCCACGGAGGGGCAGTG
GTAGCCAATTATCCATATGACAAGTCCCTTGGGCACCGGGTCCGAGGTTTCCGCCGCACT
GCCAATACCCCCACGCCTGATGACAAGCTTTTCCAGAAGCTGGCGAAGATCTACTCCTAT
GCACATGGATGGATGCACCAAGGTTGGAACTGTGGGGATTACTTCCCAGACGGCATCACC
AATGGGGCTTCCTGGTATTCCCTCAGCAAGGGAATGCAAGACTTCAATTATCTCCATACC
AATTGCTTTGAGATCACGCTGGAACTTAGTTGTGACAAGTTTCCGCTGCAAGGGGAATTA
CAGCGCGAGTGGCTGGGTAATAGGGAAGCCCTCATCCAATTCTTGGAACAGGTCCACCAG
GGCATCAAGGGAATGGTGAGGGATGAGAATTATAATAATCTTGCGGATGCTGTCATTTCT
GTCGGTGGGATTAATCATGATGTCACTTCGGGTGCCCATGGCGATTACTTCCGGCTGCTG
CTTCCGGGTACCTACACGGTCACTGCCACAGCACCTGGGTTCGACCCAGAGACCGTGAGT
GTGACCGTGGGTCCTGCGGAACCCAAGCTGGTTAATTTCCAACTCAAAAGAAGCACCCCT
CAAGCAGCCCCTAAGAGGAGAATTCCCAACTCAGGGCATAGAGGCAGAGTCTTACCAAAG
AAAGTGCAGCCCCGGGCAGCTAGGAAAAAAGAAACGATGATGAAGCAACCCCAGAGAGGC
CCTGCCTGA
Enzyme 21 GenBank Gene ID BC105475 Link Image
Enzyme 21 GeneCard ID CPN1 Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:1
Enzyme 21 Locus 10q24.2
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References Not Available
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 991
Enzyme 22 Name Alcohol dehydrogenase class-3
Enzyme 22 Synonyms
  1. Alcohol dehydrogenase class-III
  2. Alcohol dehydrogenase 5
  3. S-(hydroxymethyl)glutathione dehydrogenase
  4. Glutathione-dependent formaldehyde dehydrogenase
  5. GSH-FDH
  6. FALDH
  7. FDH
Enzyme 22 Gene Name ADH5
Enzyme 22 Protein Sequence >Alcohol dehydrogenase class-3
MANQVIKCKAAVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGN
YPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAALNAAKVEPGSTCAVFGLGGVGLAVIMGCKMAGAARIIGVDINKDKFARAKEFGASEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGISVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHSLPFDQINEAFD
LMHAGKSIRTVVKL
Enzyme 22 Number of Residues 374
Enzyme 22 Molecular Weight 39676.8
Enzyme 22 Theoretical pI 7.56
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Energy production and conversion
Enzyme 22 Specific Function Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • None
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 73586689 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID Q3ZC42 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name ADHX_BOVIN Link Image
Enzyme 22 PDB ID 1MC5 Link Image
Enzyme 22 PDB File Show
Enzyme 22 3D Structure
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >1125 bp
ATGGCGAACCAGGTTATCAAGTGCAAGGCTGCAGTTGCCTGGGAGGCTGGGAAGCCTCTT
TCTATAGAGGAGGTAGAGGTGGCACCCCCAAAGGCTCATGAAGTTCGAATTAAGATTATT
GCCACTGCAGTTTGCCACACTGACGCCTATACACTGAGTGGGGCTGATCCTGAAGGGAAT
TATCCAGTGATCTTGGGACACGAAGGTGCTGGAATTGTGGAGAGTGTTGGTGAAGGAGTT
ACTAAGCTGAAGGCAGGTGATACTGTCATCCCACTTTACATCCCCCAGTGTGGAGAATGC
AAGTTTTGTCTGAATCCTAAAACAAACCTTTGCCAGAAGATAAGAGTCACTCAAGGAAAA
GGATTAATGCCAGATGGCACTAGCAGATTTACTTGTAAAGGAAAGACAATTTTACATTAC
ATGGGAACCAGCACATTTTCTGAATACACAGTTGTGGCTGACATTTCTGTTGCTAAAATT
GATCCTTTAGCACCTTTGGATAAAGTTTGCCTTCTGGGTTGTGGCATTTCAACTGGCTAT
GGTGCTGCTTTGAATGCTGCCAAGGTGGAGCCTGGCTCTACTTGTGCTGTCTTTGGCCTG
GGAGGAGTTGGATTGGCAGTTATCATGGGCTGTAAGATGGCTGGTGCAGCCCGGATCATT
GGTGTGGACATCAATAAGGATAAATTCGCAAGAGCCAAGGAGTTCGGGGCCTCTGAGTGT
ATTAACCCCCAGGACTTCAGTAAACCGATCCAGGAAGTGCTCATTGAGATGACTGACGGG
GGAGTCGACTACTCCTTTGAGTGTATTGGTAATGTGAAAGTCATGAGAGCAGCGCTGGAG
GCCTGCCACAAAGGCTGGGGCATCAGCGTGGTAGTGGGAGTAGCTGCCTCTGGTGAAGAA
ATCGCCACTCGTCCGTTCCAGCTAGTCACGGGCCGCACGTGGAAAGGCACTGCCTTTGGA
GGATGGAAGAGTGTAGAAAGTGTCCCAAAGTTGGTGTCTGAATATATGTCCAAAAAGATA
AAAGTTGATGAGTTTGTGACTCACAGTCTGCCTTTTGACCAAATTAATGAAGCCTTTGAT
CTGATGCATGCCGGAAAGAGCATCCGAACGGTTGTAAAGCTTTAA
Enzyme 22 GenBank Gene ID BC102926 Link Image
Enzyme 22 GeneCard ID ADH5 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:4
Enzyme 22 Locus 4q21-q25
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 1005
Enzyme 23 Name Angiotensin-converting enzyme
Enzyme 23 Synonyms
  1. ACE
  2. Dipeptidyl carboxypeptidase I
  3. Kininase II
  4. CD143 antigen
  5. Fragment
Enzyme 23 Gene Name ACE
Enzyme 23 Protein Sequence >Angiotensin-converting enzyme
MGAASGRRSPPLLLPLLLLLLPPPPVILELDPALQPGNFPADEAGAQIFAASFNSSAEQV
LFQSTAASWAHDTNITEENARLQEEAALLSQEFSEAWGQK
Enzyme 23 Number of Residues 100
Enzyme 23 Molecular Weight 10680.9
Enzyme 23 Theoretical pI 3.95
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Involved in carboxypeptidase activity
Enzyme 23 Specific Function Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • 1-28
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 160419759 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID P12820 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name ACE_BOVIN Link Image
Enzyme 23 PDB ID Not Available
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence Not Available
Enzyme 23 GenBank Gene ID DQ885942 Link Image
Enzyme 23 GeneCard ID ACE Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Chromosome:1
Enzyme 23 Locus 17q23.3
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References
  1. [PubMed Link Image]
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 1034
Enzyme 24 Name Carbonic anhydrase 1
Enzyme 24 Synonyms
  1. Carbonic anhydrase I
  2. CA-I
  3. Carbonate dehydratase I
Enzyme 24 Gene Name CA1
Enzyme 24 Protein Sequence >Carbonic anhydrase 1
MASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVSYNPATAKEI
VNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGITDDCGSEHLVDGAKFSAELH
LVHWNSAKYPSFADAASQADGLALIGVLVKVGQANPNLQKVLDALKAVKNKNKKAPFTNF
DPSVLLPPSLDYWAYSGSLTHPPLHESVTWIIFKETISVSSEQLAQFRSLLANAEGDREV
HIKQNNRPPQPLNGRTVKASF
Enzyme 24 Number of Residues 261
Enzyme 24 Molecular Weight 28822.0
Enzyme 24 Theoretical pI 7.14
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Inorganic ion transport and metabolism
Enzyme 24 Specific Function Reversible hydration of carbon dioxide
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • None
Enzyme 24 Transmembrane Regions
  • None
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 94534956 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID Q1LZA1 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name CAH1_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence >786 bp
ATGGCAAGTCCTGACTGGGGATATGATGGTGAAAACGGTCCTGAACACTGGGGCAAGCTG
TACCCCATCGCAAATGGAAATAACCAATCTCCTATCGACATCAAAACCAGTGAAACCAAG
CGTGATCCCTCTCTGAAACCCCTCAGTGTCTCCTACAATCCAGCCACAGCCAAAGAAATC
GTCAACGTGGGACATTCCTTTCATGTAAACTTTGAGGACAGTGATAATAGATCAGTGCTG
AAAGGGGGTCCTCTATCTGAAAGCTACAGGCTGCGGCAGTTCCATTTTCACTGGGGCATC
ACAGATGACTGTGGCTCTGAGCACTTAGTGGATGGAGCCAAATTTTCTGCAGAGCTTCAT
TTAGTTCACTGGAATTCTGCCAAGTACCCCAGCTTCGCTGATGCTGCCTCGCAGGCTGAT
GGTTTGGCGTTGATTGGCGTTTTGGTGAAGGTGGGTCAGGCCAACCCAAACCTTCAGAAA
GTACTTGATGCCCTAAAAGCAGTTAAAAATAAGAACAAGAAAGCTCCATTCACAAATTTC
GACCCCTCTGTCCTCCTGCCTCCATCCCTGGATTACTGGGCCTACTCTGGTTCACTGACT
CACCCTCCTCTTCACGAGAGTGTCACCTGGATCATCTTTAAAGAGACCATCAGTGTGAGC
TCGGAACAGCTGGCGCAGTTCCGCAGTCTGCTGGCAAATGCTGAAGGCGATAGAGAAGTC
CACATCAAGCAGAACAACCGACCACCCCAGCCTCTGAACGGCAGGACAGTGAAAGCTTCA
TTCTGA
Enzyme 24 GenBank Gene ID BC116126 Link Image
Enzyme 24 GeneCard ID CA1 Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Chromosome:8
Enzyme 24 Locus 8q13-q22.1
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 1035
Enzyme 25 Name Protein kinase C, zeta
Enzyme 25 Synonyms Not Available
Enzyme 25 Gene Name PRKCZ
Enzyme 25 Protein Sequence >Protein kinase C, zeta
MPSRTGPKMDGSGGRGRVRLKAHYSGDLLITSLDSATTFDELCAEVREMCWLHPGHPLTL
KWVDNEGDPCTVSSQMELEEAFRLSCQHKDEGLTLHVFPSIPKEPGMPCPGEDKSIYRRG
ARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCIHCKLLVHKRCYVLVPL
TCSRHMDSVMPSQEPAVDDKSDDVDLPSEESDGIAYISSTRKHDNIKDDAEDLKPVIDGM
DGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQVYAMKVVKKELVHDDEDIDWVQ
TEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAA
EICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYI
APEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIP
RFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLGKKQALPPFQPQ
ITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
Enzyme 25 Number of Residues 594
Enzyme 25 Molecular Weight 67732.5
Enzyme 25 Theoretical pI 5.72
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Involved in ATP binding
Enzyme 25 Specific Function ATP + a protein = ADP + a phosphoprotein
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 117306623 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID A0JNH7 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name A0JNH7_BOVIN Link Image
Enzyme 25 PDB ID Not Available
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence >1785 bp
ATGCCCAGCAGGACGGGCCCCAAGATGGACGGGAGCGGCGGCCGCGGCCGCGTCCGCCTA
AAGGCGCACTATAGCGGGGACCTCCTCATCACCAGCCTGGACTCCGCCACCACCTTCGAC
GAGCTCTGCGCAGAGGTGCGGGAGATGTGCTGGCTGCACCCGGGCCACCCGCTCACCCTT
AAGTGGGTGGACAATGAAGGTGACCCCTGCACTGTGTCCTCCCAGATGGAGCTGGAGGAG
GCCTTCCGCCTGTCCTGTCAGCACAAGGATGAAGGGCTCACCCTTCACGTTTTCCCCAGC
ATCCCCAAGGAACCAGGCATGCCCTGTCCGGGAGAAGACAAATCCATCTACCGCCGTGGA
GCCAGAAGATGGCGGAAGCTGTACCGCGCCAACGGCCACCTCTTCCAGGCCAAGCGCTTT
AACAGGAGAGCGTACTGCGGCCAGTGCAGCGAGAGGATATGGGGCCTCGCGAGGCAGGGC
TACAGGTGCATCCACTGCAAACTGCTGGTTCATAAGCGCTGCTACGTGCTCGTCCCACTG
ACCTGCAGCAGGCATATGGATTCCGTCATGCCTTCCCAGGAGCCTGCAGTGGACGACAAG
AGCGACGACGTGGACCTTCCCTCCGAGGAGAGTGATGGAATTGCTTATATTTCTTCAACC
CGGAAACATGACAACATTAAAGATGATGCTGAGGACCTCAAGCCAGTCATCGACGGGATG
GACGGGATCAAGATATCTCAGGGGCTCGGGCTGCAGGACTTCGACCTGATCAGGGTCATC
GGGCGCGGGAGCTACGCCAAGGTCCTGCTGGTGCGGCTGAAGAAGAACGACCAGGTCTAC
GCCATGAAGGTGGTAAAGAAGGAGCTGGTCCATGACGATGAGGATATTGACTGGGTACAG
ACAGAGAAGCACGTGTTTGAGCAGGCATCCAGCAACCCTTTCTTGGTCGGCTTACACTCC
TGCTTCCAGACAACAAGTCGGTTGTTCCTGGTCATCGAGTACGTCAACGGGGGCGACCTC
ATGTTCCACATGCAGAGGCAGAGGAAGCTGCCCGAGGAGCACGCCAGGTTCTATGCTGCT
GAAATTTGTATCGCACTCAACTTCCTACACGAGAGAGGGATTATCTACCGGGACCTGAAG
CTGGACAATGTCCTCCTTGACGCCGATGGCCACATCAAGCTGACGGACTATGGCATGTGC
AAGGAAGGCCTGGGCCCTGGTGATACAACAAGCACTTTCTGCGGAACCCCGAACTACATC
GCCCCTGAAATCCTGCGCGGAGAAGAGTATGGGTTCAGCGTGGACTGGTGGGCGCTGGGC
GTGCTGATGTTCGAGATGATGGCAGGCCGCTCCCCCTTCGACATCATCACTGACAACCCC
GACATGAACACTGAAGACTACCTTTTCCAAGTCATCCTGGAGAAGCCCATCCGGATCCCC
CGGTTCCTGTCCGTCAAGGCCTCCCACGTGTTGAAAGGATTTTTAAACAAGGACCCCAAG
GAGAGGCTTGGCTGCCGGCCGCAGACTGGATTTTCTGATATCAAGTCTCACGCCTTCTTC
CGCAGTATAGACTGGGACCTGCTGGGGAAGAAGCAGGCCCTCCCGCCCTTCCAGCCGCAG
ATCACAGACGACTATGGCCTGGACAACTTCGATACGCAGTTCACCAGCGAGCCGGTGCAG
CTGACCCCTGACGACGAGGACGTAATCAAGAGGATCGACCAGTCAGAGTTTGAAGGGTTC
GAGTACATCAACCCACTGCTGCTGTCCACTGAGGAGTCCGTATGA
Enzyme 25 GenBank Gene ID BC126688 Link Image
Enzyme 25 GeneCard ID PRKCZ Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:1
Enzyme 25 Locus 1p36.33-p36.2
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References Not Available
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 1036
Enzyme 26 Name Aminopeptidase B
Enzyme 26 Synonyms Not Available
Enzyme 26 Gene Name AP-B
Enzyme 26 Protein Sequence >Aminopeptidase B
MAAGQPKAGGRALRAAQVDDVASASNFRAFELLHLHLDLRAEFGPPGPGPGSRGLSGSAV
LDLRCRAPGGATELRLDSHPCVDVTAAALRRGRPEPGRPEPEPEPLPVCTQPFSHYGQAL
CLRFSQPCAAGECLQVRITYRVGEGPGVCWLAPEQTAGRKKPFVYTQGQAVLNRAFFPCF
DTPAVKCRYSALLEVPDGFTAVMSADAGQERGPNKFFLRMSQPIPSYLIALAIGDLVSAE
VGPRSRVWAEPCLIDAAKEEYDGVIEEFLATGEKLFGPYVWGRYDVLFMPPSFPFGGMEN
PCLTFVTPCLLAGDRSLADVIIHEIAHSWFGNLVTNANWGEFWLNEGFTMYAQRRISSVL
FGPAYTCLEAATGRALLRQHMDVTGEDHPLNKLRVRIEPGVDPDDTYNETPYEKGFCFVS
YLAHLVGDQGQFDDFLKAYVDEFKFQSILADDFLDFFLDSFPELKKQRVDSIPGLEFDRW
LDTPGWPPYLPDLSPGDSLMRPAEELAQLWAAEELDPRAINAMPTSAWKTYQLVYFLDKI
LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIVLKNDHQEDFWKVKEFLHSQGKQK
YTLPLYHAMMAGSKAAQTLAKETFAATAPQLHSNVVHYVQQIVEPLGR
Enzyme 26 Number of Residues 648
Enzyme 26 Molecular Weight 71975.4
Enzyme 26 Theoretical pI 5.52
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Amino acid transport and metabolism
Enzyme 26 Specific Function Not Available
Enzyme 26 Pathways Not Available
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 94490309 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID A2T1U6 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name A2T1U6_BOVIN Link Image
Enzyme 26 PDB ID Not Available
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence >1947 bp
ATGGCGGCCGGCCAGCCTAAGGCCGGCGGGCGGGCGCTGCGCGCGGCGCAGGTGGACGAC
GTGGCGTCGGCCTCCAACTTCCGCGCCTTCGAGCTGCTGCACCTGCACCTGGACCTGAGG
GCCGAGTTCGGGCCGCCGGGGCCAGGCCCGGGCAGCCGCGGGCTGAGCGGCTCGGCGGTG
CTGGACTTGCGCTGCCGGGCGCCCGGCGGCGCCACGGAGCTGCGGCTGGACTCGCACCCG
TGCGTGGACGTGACGGCGGCGGCCCTGAGGCGGGGGCGGCCGGAGCCGGGGCGGCCGGAG
CCGGAGCCTGAGCCGCTGCCGGTGTGCACGCAGCCGTTCTCGCACTACGGCCAGGCCCTG
TGCTTGCGCTTCTCGCAGCCCTGCGCCGCAGGCGAGTGCCTGCAGGTGCGGATCACCTAC
CGCGTCGGCGAGGGACCCGGGGTGTGCTGGCTGGCTCCGGAGCAGACGGCGGGAAGGAAG
AAGCCCTTCGTCTACACCCAGGGCCAGGCCGTCCTGAACCGAGCCTTCTTCCCGTGCTTT
GACACTCCCGCCGTGAAGTGCAGATACTCCGCTCTTCTCGAGGTCCCAGATGGCTTCACC
GCCGTAATGAGTGCTGACGCTGGGCAGGAGCGAGGCCCCAATAAGTTCTTCTTGCGGATG
AGTCAGCCCATCCCGTCCTATCTGATAGCCTTGGCCATCGGAGATCTGGTTTCGGCTGAA
GTTGGACCCAGGAGCCGGGTGTGGGCTGAGCCCTGCCTCATCGACGCTGCCAAGGAGGAG
TATGACGGAGTCATAGAGGAGTTTCTGGCAACGGGAGAGAAGCTCTTTGGACCCTATGTG
TGGGGAAGGTACGACGTGCTCTTCATGCCCCCGTCCTTCCCGTTCGGGGGGATGGAGAAC
CCCTGCTTGACCTTCGTCACTCCCTGCCTTCTGGCTGGGGACCGCTCCCTGGCCGACGTC
ATCATCCACGAGATCGCCCACAGCTGGTTTGGGAACCTGGTGACCAACGCCAACTGGGGG
GAGTTCTGGCTGAACGAAGGCTTCACCATGTACGCCCAGAGGAGGATCTCCTCCGTTCTG
TTTGGGCCCGCCTACACCTGCTTGGAAGCCGCCACCGGCCGGGCGCTGCTGCGGCAGCAC
ATGGACGTCACGGGCGAGGACCACCCGCTGAACAAGCTGCGCGTGAGGATCGAGCCAGGG
GTCGACCCAGACGACACCTACAACGAGACCCCCTACGAGAAGGGCTTCTGCTTCGTCTCC
TACCTGGCCCACCTGGTGGGTGACCAGGGCCAGTTTGACGACTTCCTCAAGGCCTACGTG
GACGAATTCAAGTTCCAGAGCATCTTAGCTGACGACTTCCTGGACTTCTTCCTGGACTCT
TTCCCTGAGCTGAAGAAACAGAGGGTGGATTCCATCCCGGGACTGGAGTTTGATCGCTGG
CTGGACACCCCGGGCTGGCCACCTTACCTCCCGGACCTCTCCCCCGGGGACTCGCTCATG
AGGCCGGCTGAGGAGCTGGCCCAGCTGTGGGCGGCCGAGGAGCTGGACCCGAGGGCCATC
AATGCCATGCCCACCTCTGCCTGGAAAACCTACCAGCTGGTGTACTTCCTGGATAAGATC
CTGCAGAAGTCCCCGCTCCCTCCTGGGAACGTGAAGAAACTTGGAGAGACGTACCCAAAG
ATCTCAAACGCCCAGAATGCAGAGCTGCGGCTGCGATGGGGCCAGATTGTCCTCAAGAAT
GACCACCAGGAGGACTTCTGGAAAGTGAAGGAATTCCTGCACAGCCAGGGGAAACAGAAG
TACACCCTCCCGCTGTACCACGCCATGATGGCGGGCAGCAAGGCCGCCCAGACCCTCGCC
AAGGAGACCTTTGCCGCCACAGCTCCCCAGCTGCATAGCAACGTGGTGCACTACGTCCAG
CAGATCGTGGAGCCCCTGGGCAGGTAG
Enzyme 26 GenBank Gene ID DQ486899 Link Image
Enzyme 26 GeneCard ID AP-B Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Not Available
Enzyme 26 Locus Not Available
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References Not Available
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 1037
Enzyme 27 Name A disintegrin and metalloproteinase with thrombospondin motifs 5
Enzyme 27 Synonyms
  1. ADAMTS-5
  2. ADAM-TS 5
  3. ADAM-TS5
  4. Aggrecanase-2
  5. ADMP-2
Enzyme 27 Gene Name ADAMTS5
Enzyme 27 Protein Sequence >A disintegrin and metalloproteinase with thrombospondin motifs 5
HAAFTVAHEIGHLLGLSHDDSKFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITE
FLDDGHGNCLLDLPRKQIPGPEELPGQTYDASQQCNLTFGPEYSVCPGMDVCARLWCAVV
RQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRS
CGGGVQFAYRHCNNPAPKNNGRYCTGK
Enzyme 27 Number of Residues 207
Enzyme 27 Molecular Weight 22575.4
Enzyme 27 Theoretical pI 8.05
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Involved in metalloendopeptidase activity
Enzyme 27 Specific Function Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 6319134 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID Q9TT92 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name ATS5_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence Not Available
Enzyme 27 GenBank Gene ID AF192771 Link Image
Enzyme 27 GeneCard ID ADAMTS5 Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:2
Enzyme 27 Locus 21q21.3
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References
  1. [PubMed Link Image]
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 1038
Enzyme 28 Name Protein kinase C, alpha
Enzyme 28 Synonyms Not Available
Enzyme 28 Gene Name PRKCA
Enzyme 28 Protein Sequence >Protein kinase C, alpha
MADVFPAAEPAAPQDVANRFARKGALRQKNVHEVKNHRFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPRWDESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMNMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Enzyme 28 Number of Residues 672
Enzyme 28 Molecular Weight 76792.5
Enzyme 28 Theoretical pI 7.05
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Involved in ATP binding
Enzyme 28 Specific Function ATP + a protein = ADP + a phosphoprotein
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 154426188 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID B0JYP1 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name B0JYP1_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >2019 bp
ATGGCTGACGTCTTCCCGGCCGCCGAGCCGGCGGCGCCGCAGGACGTGGCCAACCGCTTC
GCCCGCAAAGGGGCGCTGAGGCAGAAGAACGTGCACGAGGTGAAGAACCACCGCTTCATC
GCGCGCTTCTTCAAGCAGCCCACCTTCTGCAGCCACTGCACCGACTTCATCTGGGGGTTT
GGGAAACAAGGCTTCCAGTGCCAAGTTTGCTGTTTTGTGGTTCACAAGAGGTGCCATGAA
TTTGTTACTTTTTCTTGTCCGGGGGCGGATAAAGGACCCGACACAGATGACCCGAGGAGC
AAGCACAAGTTCAAGATCCACACGTATGGCAGCCCCACCTTCTGTGATCACTGCGGCTCC
CTGCTCTACGGACTCATCCACCAGGGGATGAAATGTGACACCTGTGATATGAACGTGCAC
AAGCAGTGCGTGATCAACGTGCCCAGCCTCTGCGGGATGGACCACACGGAGAAGAGGGGC
CGCATCTACCTGAAGGCCGAGGTCACGGATGAAAAGCTGCACGTCACAGTACGAGACGCG
AAAAACCTAATCCCTATGGATCCAAATGGGCTTTCAGATCCTTACGTGAAGCTGAAGCTT
ATTCCTGACCCCAAGAACGAGAGCAAACAGAAAACCAAGACCATCCGCTCGACGCTGAAC
CCCCGGTGGGACGAGTCCTTCACGTTCAAATTAAAACCTTCTGATAAAGACCGGCGACTG
TCTGTGGAAATCTGGGACTGGGATCGAACCACACGGAACGACTTTATGGGGTCCCTTTCC
TTTGGGGTCTCGGAGCTGATGAATATGCCGGCCAGCGGATGGTACAAGCTGCTGAACCAA
GAGGAGGGCGAGTACTACAACGTGCCGATCCCCGAAGGCGACGAGGAAGGCAACGTGGAG
CTCAGGCAGAAATTCGAGAAAGCCAAGCTTGGCCCTGCCGGCAACAAAGTCATCAGTCCC
TCCGAGGACAGGAGACAGCCTTCCAACAACCTGGACAGAGTGAAGCTCACGGACTTCAAC
TTCCTCATGGTGCTGGGCAAAGGCAGCTTTGGGAAGGTGATGCTGGCCGACCGGAAGGGG
ACAGAGGAGCTGTACGCCATCAAGATCCTGAAGAAGGACGTGGTCATCCAGGACGACGAC
GTGGAGTGCACCATGGTGGAGAAGCGGGTCCTGGCGCTGCTCGACAAGCCGCCGTTCCTG
ACGCAGCTGCACTCCTGCTTCCAGACGGTGGACCGGCTGTACTTCGTCATGGAGTACGTC
AACGGCGGGGACCTCATGTACCACATCCAGCAGGTCGGGAAGTTCAAGGAGCCGCAAGCA
GTGTTCTATGCAGCAGAGATTTCCATCGGGCTGTTCTTTCTTCATAAAAGAGGAATCATT
TATCGGGACCTGAAGTTAGACAACGTCATGCTGGACTCGGAAGGACACATTAAGATCGCG
GACTTCGGGATGTGCAAGGAGCACATGATGGACGGCGTCACGACCAGGACCTTCTGCGGG
ACCCCCGACTACATCGCCCCAGAGATAATCGCCTATCAGCCGTACGGGAAGTCCGTGGAC
TGGTGGGCCTACGGCGTCCTGTTGTACGAGATGTTGGCCGGGCAGCCTCCGTTCGACGGC
GAGGACGAGGACGAGCTGTTCCAGTCCATCATGGAGCACAACGTCTCGTACCCCAAGTCC
TTGTCCAAGGAGGCCGTGTCCATCTGCAAAGGGCTGATGACCAAGCACCCCGGGAAGCGG
CTGGGCTGCGGGCCCGAGGGCGAGCGCGACGTGCGGGAGCATGCCTTCTTCCGGAGGATC
GACTGGGAGAAGCTGGAGAACCGTGAGATCCAGCCACCCTTCAAGCCCAAAGTGTGCGGC
AAAGGAGCAGAGAACTTTGACAAGTTCTTCACGCGAGGGCAGCCTGTCTTGACGCCGCCC
GACCAGCTGGTCATCGCTAACATCGACCAGTCTGATTTTGAAGGCTTCTCCTACGTCAAC
CCCCAGTTCGTGCACCCCATCCTGCAGAGCGCGGTATGA
Enzyme 28 GenBank Gene ID BC151471 Link Image
Enzyme 28 GeneCard ID PRKCA Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:1
Enzyme 28 Locus 17q22-q23.2
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References Not Available
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 1039
Enzyme 29 Name Angiotensin-converting enzyme 2
Enzyme 29 Synonyms
  1. ACE-related carboxypeptidase
  2. Processed angiotensin-converting enzyme 2
Enzyme 29 Gene Name ACE2
Enzyme 29 Protein Sequence >Angiotensin-converting enzyme 2
MTGSFWLLLSLVAVTAAQSTTEEQAKTFLEKFNHEAEDLSYQSSLASWNYNTNITDENVQ
KMNEARAKWSAFYEEQSRMAKTYSLEEIQNLTLKRQLKALQHSGTSALSAEKSKRLNTIL
NKMSTIYSTGKVLDPNTQECLALEPGLDDIMENSRDYNRRLWAWEGWRAEVGKQLRPLYE
EYVVLENEMARANNYEDYGDYWRGDYEVTGAGDYDYSRDQLMKDVERTFAEIKPLYEQLH
AYVRAKLMHTYPSYISPTGCLPAHLLGDMWGRFWTNLYSLTVPFEHKPSIDVTEKMENQS
WDAERIFKEAEKFFVSISLPYMTQGFWDNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMC
TKVTMDDFLTAHHEMGHIQYDMAYAAQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKAL
GLLAPDFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKQQWMEKWWEMK
REIVGVVEPLPHDETYCDPACLFHVAEDYSFIRYYTRTIYQFQFHEALCKTAKHEGALFK
CDISNSTEAGQRLLQMLRLGKSEPWTLALENIVGIKTMDVKPLLNYFEPLFTWLKEQNRN
SFVGWSTEWTPYSDQSIKVRISLKSALGENAYEWNDNEMYLFQSSVAYAMRKYFSEARNE
TVLFGEDNVWVSDKKPRISFKFFVTSPNNVSDIIPRTEVENAIRLSRDRINDVFQLDDNS
LEFLGIQPTLGPPYEPPVTIWLIIFGVVMGVVVIGIVVLIFTGIRNRRKKNQASSEENPY
GSVDLNKGENNSGFQNIDDVQTSL
Enzyme 29 Number of Residues 804
Enzyme 29 Molecular Weight 93066.7
Enzyme 29 Theoretical pI 4.97
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Involved in carboxypeptidase activity
Enzyme 29 Specific Function Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin- 13 and dynorphin-13 with high efficiency. May be an important regulator of heart function
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • 1-17
Enzyme 29 Transmembrane Regions
  • 740-760
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 61554143 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q58DD0 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name ACE2_BOVIN Link Image
Enzyme 29 PDB ID Not Available
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >2415 bp
ATGACAGGCTCTTTCTGGCTCCTTCTCAGCCTTGTTGCTGTAACTGCTGCTCAATCCACC
ACTGAAGAACAGGCCAAGACATTTTTGGAGAAGTTTAACCATGAAGCCGAAGACCTGTCT
TATCAAAGTTCACTTGCTTCTTGGAATTATAACACCAATATTACCGATGAGAATGTCCAA
AAGATGAATGAAGCCAGAGCCAAATGGTCTGCCTTTTATGAAGAACAGTCCCGGATGGCC
AAAACTTACTCACTCGAAGAAATTCAGAATCTCACACTCAAGCGTCAATTGAAGGCCCTT
CAGCATAGCGGGACCTCAGCGCTCTCGGCAGAGAAGAGCAAACGATTGAACACGATTCTA
AATAAAATGAGCACCATCTACAGTACTGGGAAAGTTTTGGACCCAAATACACAGGAGTGC
TTAGCACTTGAACCAGGTTTAGATGACATAATGGAAAACAGCAGAGACTACAATCGGAGG
CTCTGGGCTTGGGAAGGCTGGAGGGCTGAAGTTGGCAAGCAACTAAGGCCATTGTATGAA
GAGTATGTGGTCCTAGAAAATGAGATGGCAAGAGCCAACAATTATGAGGACTACGGGGAC
TATTGGAGAGGGGATTATGAGGTGACTGGGGCAGGGGACTATGACTACAGCCGTGACCAG
TTGATGAAAGATGTGGAACGCACCTTTGCAGAGATTAAACCATTATATGAACAACTTCAT
GCTTATGTGAGGGCAAAGTTGATGCATACCTACCCTTCCTATATCAGCCCTACTGGATGC
CTCCCTGCGCATTTGCTTGGTGATATGTGGGGGAGATTTTGGACAAATCTGTACTCTTTG
ACAGTCCCCTTTGAACACAAACCAAGCATAGATGTTACTGAAAAAATGGAGAACCAGTCC
TGGGATGCAGAAAGGATATTCAAGGAGGCTGAGAAGTTCTTTGTGTCTATCAGCCTTCCT
TACATGACTCAAGGATTCTGGGACAACTCCATGCTGACTGAGCCAGGCGATGGCCGGAAG
GTGGTCTGCCACCCCACAGCGTGGGACTTAGGGAAGGGTGACTTCAGGATCAAGATGTGC
ACGAAGGTCACAATGGATGATTTCCTGACAGCCCATCATGAGATGGGCCACATCCAGTAT
GACATGGCGTATGCCGCACAGCCCTACCTGCTCAGGAATGGCGCTAATGAAGGTTTCCAT
GAGGCTGTCGGGGAAATCATGTCACTGTCCGCAGCCACACCTCACTATTTGAAAGCGCTT
GGTCTTCTGGCACCTGATTTTCATGAAGACAATGAAACAGAAATAAACTTCCTGCTCAAA
CAAGCACTTACAATTGTTGGAACTCTACCATTTACTTACATGTTAGAAAAGTGGAGGTGG
ATGGTCTTTAAGGGTGAAATTCCCAAACAGCAGTGGATGGAAAAGTGGTGGGAGATGAAG
CGAGAGATAGTCGGAGTGGTGGAGCCTCTGCCCCATGATGAGACATACTGTGATCCTGCG
TGTCTGTTCCATGTGGCTGAAGATTACTCATTCATCCGGTATTACACAAGGACCATTTAT
CAATTCCAGTTTCATGAAGCCCTTTGTAAAACAGCTAAACATGAAGGTGCCCTGTTCAAA
TGTGATATCTCAAATTCCACGGAAGCTGGGCAGAGGCTGCTCCAAATGCTGCGCCTTGGA
AAATCAGAACCCTGGACCTTAGCATTGGAAAATATTGTGGGCATAAAGACTATGGATGTA
AAACCCCTGCTCAACTACTTTGAGCCCTTGTTTACCTGGCTGAAAGAGCAGAACAGGAAT
TCATTCGTGGGATGGAGCACGGAATGGACTCCATATTCTGACCAAAGCATCAAAGTGAGG
ATAAGCCTAAAATCAGCTCTTGGAGAAAATGCTTATGAATGGAATGACAACGAAATGTAC
TTGTTCCAGTCGTCTGTGGCATATGCCATGAGAAAGTATTTTTCAGAAGCCAGAAATGAG
ACCGTTCTTTTTGGAGAAGACAACGTGTGGGTGAGTGACAAGAAACCAAGGATCTCCTTC
AAGTTCTTTGTCACGTCACCTAACAACGTGTCTGACATCATTCCGAGAACTGAAGTTGAA
AACGCCATCAGGTTGTCCCGGGACCGTATCAATGATGTCTTCCAGCTGGATGACAACAGC
CTGGAGTTTCTGGGGATTCAGCCGACGCTGGGACCCCCTTACGAGCCACCTGTCACCATA
TGGCTGATTATCTTTGGGGTCGTGATGGGAGTGGTAGTGATTGGTATTGTTGTGCTCATC
TTCACTGGGATCAGAAATCGAAGGAAGAAAAATCAAGCAAGCAGTGAAGAAAATCCTTAT
GGCTCTGTGGACTTGAATAAAGGAGAAAATAATTCAGGATTCCAAAATATTGATGATGTT
CAGACTTCGCTTTAG
Enzyme 29 GenBank Gene ID BT021667 Link Image
Enzyme 29 GeneCard ID ACE2 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Not Available
Enzyme 29 Locus Xp22
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References
  1. [PubMed Link Image]
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 1040
Enzyme 30 Name Lys-63-specific deubiquitinase BRCC36
Enzyme 30 Synonyms
  1. BRCA1-A complex subunit BRCC36
  2. BRISC complex subunit BRCC36
  3. BRCA1/BRCA2-containing complex subunit 3
  4. BRCA1/BRCA2-containing complex subunit 36
Enzyme 30 Gene Name BRCC3
Enzyme 30 Protein Sequence >Lys-63-specific deubiquitinase BRCC36
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDLRNDPKFTYTGTEMR
TVAEKVDTVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGW
YHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQK
SSESPRGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILC
QEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHVQE
LQQEKEELLQELSSLE
Enzyme 30 Number of Residues 316
Enzyme 30 Molecular Weight 36151.8
Enzyme 30 Theoretical pI 5.84
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Involved in metallopeptidase activity
Enzyme 30 Specific Function Metalloprotease that specifically cleaves 'Lys-63'- linked polyubiquitin chains. Does not have activity toward 'Lys- 48'-linked polyubiquitin chains. Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). In the BRCA1-A complex, it specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX, antagonizing the RNF8-dependent ubiquitination at double- strand breaks (DSBs). Catalytic subunit of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates. Mediates the specific 'Lys-63'- specific deubiquitination associated with the COP9 signalosome complex (CSN), via the interaction of the BRISC complex with the CSN complex
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • None
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 61554599 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID A5PJP6 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name BRCC3_BOVIN Link Image
Enzyme 30 PDB ID Not Available
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >876 bp
ATGGCGGTGCAGGTGGTGCAGGCGGTGCAAGCGGTCCATCTGGAGTCAGACGCCTTCCTG
GTGTGTCTCAATCACGCTCTGAGCACGGAGAAGGAAGAGGTGATGGGGCTGTGCATTGGG
GAGTTAAATGATGACTTAAGGAATGACCCCAAATTTACATATACTGGAACTGAAATGCGC
ACAGTTGCTGAAAAGGTTGACACCGTCAGAATTGTTCACATTCATTCTGTCATCATCCTG
CGTCGTTCCGATAAGAGGAAGGATCGTGTGGAAATTTCTCCAGAGCAGCTGTCTGCGGCT
TCAACAGAGGCAGAGAGGTTGGCTGAACTGACAGGTCGTCCCATGAGAGTTGTGGGTTGG
TATCACTCCCATCCCCATATAACTGTTTGGCCTTCACATGTTGATGTCCGCACACAAGCC
ATGTACCAGATGATGGATCAAGGTTTTGTAGGACTTATCTTTTCCTGCTTCATAGAAGAT
AAAAATACAAAGACTGGACGGGTACTCTATACTTGCTTTCAATCCATACAGGCCCAAAAG
AGCTCAGAGTATGAGAGAATTGAAATCCCAATTCATATTGTACCTCACGTAACCATTGGG
AAAGTATGCCTTGAGTCAGCAGTTGAGCTGCCCAAGATCCTGTGCCAAGAAGAACAAGAT
GCATATAGGAGGATCCACAGCCTTACACATCTGGACTCAGTAACCAAGATCCATAATGGC
TCAGTATTTACCAAGAATCTGTGCAGTCAGATGTCAGCGGTCAGCGGACCTCTACTGCAG
TGGTTGGAGGACAGACTGGAGCAAAACCAACAGCATGTGCAGGAGCTGCAACAAGAAAAG
GAAGAGCTTCTGCAAGAACTTTCTTCTCTAGAATAA
Enzyme 30 GenBank Gene ID BT021737 Link Image
Enzyme 30 GeneCard ID BRCC3 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Not Available
Enzyme 30 Locus Xq28
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References
  1. [PubMed Link Image]
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 1041
Enzyme 31 Name Breast cancer type 1 susceptibility protein homolog
Enzyme 31 Synonyms Not Available
Enzyme 31 Gene Name BRCA1
Enzyme 31 Protein Sequence >Breast cancer type 1 susceptibility protein homolog
MDLSADHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSRKEDNSPEHLKE
EVSIIQSMGYRNRAKRLWQSEPENPTLQETSLTVELSNLGIVRSLRTKQQTQSQNKSVYI
ELGSDSSEDTVNKASYFSVGDHELLEITPQGAKAKTNLNPAEKAACEFSEKDITNTEHHQ
LSIKDLITTQKHATETHPEKYQGISVSDFHVEPCGTDTHASSLQHENSSLLLTENRLNVE
KAEFCNKSKQPVLVKSQQSRWAESKGTCKDRQIPSTEKKIVLNTDPLYRRKELRKQKPAC
PDSPGDSQDVPWVTLNNSIQKVNDWFSRSDEILTSDDSCDGGSESNNEVAGAVEIPNKVD
GYSGSSEKINLMASDPHGTLIHERVHSKPVESNIEDKIFGKTYRRKSSLPNFSHIAEDLI
LGAFTVEPQITQEQPLTNKLKCKRRGTSGLQPEDFIKKVDLTIVPKTPEKMTEGTDQTEQ
KCHGMNITSDGHENKTKRDYVQKEQNANPAESLEKESVFRTEAEPISISISNMELELNIH
RSKAPKNRLKRKSSTRKIPELELVVSRNPSLPNHTELPIDSSSSNEEMKKKHSSQMPVRQ
SQKLQLIGDKELTAGAKNNKTYEQINKRLASDAFPELKLTNTPGYFTNCSSKPEEFVHPS
LQREENLGTIQVSNSTKDPKDLILREGKALQIERSVESTNISLVPDTDYSTQDSISLLEA
KTPEKAKTAPNPCVSLCTATKNLKELIHRDFKDTKNNTEGFQDLLGHDINYVIQETSREM
EDSELDTQYLQNTFKASKRQTFALFSNPGNPQKECATVFAHSGSLRDQSPRDPLKCRQKE
DSQGKSESKSQHVQAICTTVHFPVADQQDRTPGDDAKCSAKEVTRVCQSSQLRGHKTELV
FANKQGVSEKPNLIPSLSPIKSSVKTICKKSPSEKFEEPVTSPEKTLGSESIIQSAVSTI
SQNNIQESTFKEVSSNSVNEVGSSTNEVGSSVNEVGSSGENIQAEPGRNREPKLRALLGL
GLTQPEVYKQSLPVSNCHHPEIKRQGENEDMPQAVKADFSPCLISDNLEQPTGSRHASQV
CSETPDNLLNDDEIKENSHFAESDIKERSAVFSESVQKGEFRGSPGPFTHTHLAQGHQRG
AGKLESEETVSSEDEELPCFQQLLFGKVTSTLSPSTGCNTVATEGLSKETEGNLESLKSG
LNDCSGQVTSAKVSQEHHLNEEARCSGSLFSSQCSAMEDLTTNTNTQDPFLMFERPSKQV
YQSESEEVLSDKELVSDDEERETGLEEDSCQEEQSVDSDLGEAVSDHVSETSLSEDGVGL
SSQSDILTTQQRDTMQDNLLKLQQEMAELEAVLERHGSQPSHSSASLTADSRGPEHLLNL
EQDTSERAILTSEKSRDYSRSQNPESLSADKFPVSLDSSTNKNKEPGMERSSASKFQLSY
NRWYMHSSRSLQDRNCPSQKEPINVADMEEQQLAKREAQDLMGSFLPRQDQEGTPYLKSG
ISLFSHEPESDPSEDRAAEPAHVHSMPPSASALKLSQFRVEESTKNPAAAHIANTTRCNL
REESMSKEKPEVISSTERSKKRLSMVASGLTPKELMLVQKFARKHHVTLTNLITEETTHV
IMKTDPEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKEGKMLDEHDFEVRGDVVNGRNHQ
GPKRARESRDKKIFKGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEPSSFTPDQGTHPV
VVVQPDAWTEDAGFHVIGQMCEAPVVTREWVLDSVALYQCQELDTYLVP
Enzyme 31 Number of Residues 1849
Enzyme 31 Molecular Weight 206277.0
Enzyme 31 Theoretical pI 5.29
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Involved in DNA binding
Enzyme 31 Specific Function The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. Plays a central role in DNA repair by facilitating cellular response to DNA repair. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation
Enzyme 31 Pathways
  • Protein modification
  • protein ubiquitination
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function
Enzyme 31 Signals
  • None
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 29640734 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID Q864U1 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name BRCA1_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence Not Available
Enzyme 31 GenBank Gene ID AY077732 Link Image
Enzyme 31 GeneCard ID BRCA1 Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:1
Enzyme 31 Locus 17q21
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References
  1. [PubMed Link Image]
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 1042
Enzyme 32 Name Carboxypeptidase A1 (Pancreatic)
Enzyme 32 Synonyms Not Available
Enzyme 32 Gene Name CPA1
Enzyme 32 Protein Sequence >Carboxypeptidase A1 (Pancreatic)
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVAALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTVNNLY
Enzyme 32 Number of Residues 419
Enzyme 32 Molecular Weight 47009.6
Enzyme 32 Theoretical pI 5.41
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Amino acid transport and metabolism
Enzyme 32 Specific Function Not Available
Enzyme 32 Pathways Not Available
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • None
Enzyme 32 Transmembrane Regions
  • None
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 148878436 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID A6H6Y4 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name A6H6Y4_BOVIN Link Image
Enzyme 32 PDB ID Not Available
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >1260 bp
ATGCAGGGGCTGCTGATTTTGAGTGTGCTGCTGGGGGCTGCCCTTGGCAAAGAGGACTTT
GTGGGCCACCAGGTGCTCCGAATCACTGCCGCCGATGAGGCCGAGGTGCAGACGGTGAAG
GAGCTGGAGGACCTGGAGCACCTGCAGTTGGACTTCTGGAGGGGCCCTGGCCAGCCAGGC
TCCCCCATCGACGTCCGAGTGCCCTTCCCCAGCCTCCAGGCTGTTAAAGTCTTCCTGGAA
GCCCATGGCATCAGATACAGGATCATGATCGAGGACGTGCAGTCCCTGCTAGACGAGGAG
CAGGAGCAGATGTTCGCCTCCCAGAGCCGGGCCCGCAGCACCAACACATTTAACTACGCC
ACCTACCACACCCTGGATGAGATCTATGACTTCATGGACCTGCTGGTGGCCGAGCACCCA
CAGCTTGTCAGCAAACTCCAGATTGGCAGAAGCTATGAAGGCCGTCCCATCTACGTGCTG
AAGTTCAGCACTGGGGGAAGCAACCGTCCAGCCATCTGGATCGACTTAGGCATCCATTCC
AGGGAGTGGATCACCCAGGCCACTGGGGTCTGGTTTGCAAAGAAGTTCACAGAAGACTAT
GGCCAGGACCCGAGTTTCACCGCCATTCTTGACAGCATGGACATATTCTTGGAGATTGTC
ACCAACCCTGATGGTTTTGCCTTCACCCACAGCCAGAATCGATTGTGGCGCAAGACTCGA
TCTGTCACGTCAAGCTCCCTCTGTGTTGGGGTGGACGCCAACCGGAACTGGGATGCCGGC
TTTGGGAAGGCAGGAGCCAGCAGCAGCCCCTGCTCGGAGACTTATCATGGCAAGTATGCC
AATTCTGAAGTGGAGGTCAAGTCCATCGTGGACTTTGTGAAAGACCATGGGAACTTCAAG
GCCTTCCTCTCCATCCACAGCTACTCCCAGCTCCTCCTCTATCCCTATGGCTACACAACA
CAATCAATCCCTGACAAGACTGAGCTGAATCAGGTGGCTAAGTCCGCTGTTGCGGCCCTG
AAGTCTCTGTATGGGACCAGCTACAAGTATGGCAGCATCATCACAACAATTTACCAAGCC
AGTGGAGGCAGCATTGACTGGTCCTACAACCAAGGCATCAAGTACTCCTTCACCTTTGAA
CTCCGGGACACGGGGCGCTATGGCTTCCTGCTGCCAGCCTCCCAGATCATCCCCACAGCC
CAGGAGACGTGGCTGGGGGTTCTGACCATCATGGAGCACACGGTGAATAACCTTTACTGA
Enzyme 32 GenBank Gene ID BC146042 Link Image
Enzyme 32 GeneCard ID CPA1 Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:7
Enzyme 32 Locus 7q32
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References Not Available
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 1043
Enzyme 33 Name Disintegrin and metalloproteinase domain-containing protein 2
Enzyme 33 Synonyms
  1. ADAM 2
  2. Fertilin subunit beta
  3. PH-30
  4. PH30
  5. PH30-beta
Enzyme 33 Gene Name ADAM2
Enzyme 33 Protein Sequence >Disintegrin and metalloproteinase domain-containing protein 2
MLCLLFLLLGLTGLQTDDNSERLRVQFTVPEKIRSTSSGGVETHVSYIILIEGKTYTVNL
MQKAFLPHNFRVYGYSGTGSMKPLEHEFQNFCYYQGYIEGYPNSMAIISTCTGLRGLLQF
ENVSYGIEPLEPSIGFEHMVYQIKPRDSSSSVYTEREIELREKPYKIQNVEPLPDFSQYI
EMHIVVEKDLYNHMGADTTVVIQKIFQLTGLTNAIFTSLNITVILSSLELWIDENKIPVT
GDANELLHRFVKWKRSYLVLRPHDMAFLLVYREKSNYIGATFQGRMCDKHYGGGVALHSS
TISLESLAVIIAQLLSLSMGIPYDDINKCHCPGDVCIMNPAAVHSSGVKLFSNCSVEDFL
RFISKPKSQCLQNQPRLDPTYKSAVCGNGKVEEGEQCDCGNKKACDALPDTCCVADTCRF
QPGSACDTGLCCESCAFIPKGHICRGSTDECDLHEYCNGSSAACQEDVYVQDGHPCGQNQ
WLCISGICVDGIKQCFDIFGEGTSYAPAECFQRLNSMNDLSGNCGVTPTGFTPCTSENVR
CGKLLCTYDKREVISVENASVMYSNINGKICIGLHYEYGNEDEGMMWVKDGTVCGESKIC
QNKQCVDSSFLNYDCNPEKCNNQGVCNNKKHCHCNPSYLPPNCEHSAPGWEGGSIDSGNF
PPSEPPTGGPAFTDVGTTPLAESRYIENVYRSKPTRWPFFLFIPFFIILCVLIATLVKVY
FQRKKWRTEDYTSDEQLESESEPKD
Enzyme 33 Number of Residues 745
Enzyme 33 Molecular Weight 83149.8
Enzyme 33 Theoretical pI 5.11
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Involved in metalloendopeptidase activity
Enzyme 33 Specific Function Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein
Enzyme 33 Pathways Not Available
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • 1-16
Enzyme 33 Transmembrane Regions
  • 697-717
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 3661512 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID O77780 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name ADAM2_BOVIN Link Image
Enzyme 33 PDB ID Not Available
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence Not Available
Enzyme 33 GenBank Gene ID AF086808 Link Image
Enzyme 33 GeneCard ID ADAM2 Link Image
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Chromosome:8
Enzyme 33 Locus 8p11.2
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References
  1. [PubMed Link Image]
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 1044
Enzyme 34 Name Carbonic anhydrase 6
Enzyme 34 Synonyms
  1. Carbonic anhydrase VI
  2. CA-VI
  3. Carbonate dehydratase VI
  4. Secreted carbonic anhydrase
  5. Salivary carbonic anhydrase
Enzyme 34 Gene Name CA6
Enzyme 34 Protein Sequence >Carbonic anhydrase 6
MITLLFLLVVGAQAQHEWTYSEGVLDEKHWRLQYPDCGGTRQSPIDLKMKKVRYNPSLRA
LNLTGYGLRQGEFPMTNNGHTVQISLPSSMRMTTSDGSQYLAKQMHFHWGGDSSEISGSE
HTVDGMRYIIEIHVVHYHSKYGSYEEAQNEPDGLAVLAALVEVKDYAENTYYSNFISHLE
DIRYAGQSTVLRDLDIQDMLPGDLRYYYSYLGSLTTPSCTENVHWFVVADTVKLSKTQIE
KLENSLLNHQNETIQNNYRSTQPLNHRVVEANFVSHPHQEYTLGSKLHFYLNNIDQNLEY
LRRFIEQKITKRKKEKYWP
Enzyme 34 Number of Residues 319
Enzyme 34 Molecular Weight 37006.4
Enzyme 34 Theoretical pI 6.72
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Inorganic ion transport and metabolism
Enzyme 34 Specific Function Reversible hydration of carbon dioxide. Its role in saliva is unknown
Enzyme 34 Pathways Not Available
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • 1-14
Enzyme 34 Transmembrane Regions
  • None
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 1526572 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID P18915 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name CAH6_BOVIN Link Image
Enzyme 34 PDB ID Not Available
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >960 bp
ATGATCACCCTGCTATTCCTGCTCGTGGTGGGAGCCCAGGCCCAGCACGAGTGGACCTAC
TCAGAGGGGGTGCTGGATGAAAAACACTGGAGGCTGCAGTACCCGGACTGTGGGGGGACA
AGACAGTCGCCCATTGACCTGAAGATGAAGAAAGTTCGGTACAACCCTTCCCTGAGGGCT
CTGAACCTCACAGGCTACGGACTCCGGCAAGGGGAGTTCCCCATGACCAACAACGGCCAC
ACGGTACAGATCAGCCTGCCATCCAGCATGCGCATGACAACCTCCGATGGCTCGCAGTAC
TTAGCCAAGCAGATGCACTTCCACTGGGGCGGAGATTCCTCGGAGATCAGCGGCTCTGAG
CACACTGTGGATGGGATGCGATACATAATTGAGATTCACGTCGTCCACTACCATTCTAAA
TATGGCAGCTATGAGGAAGCCCAGAATGAGCCGGATGGTTTGGCTGTGCTGGCGGCCCTG
GTTGAGGTAAAGGATTATGCTGAAAATACTTACTACAGCAACTTCATTTCTCACCTGGAG
GACATCAGGTATGCAGGACAAAGCACAGTTCTGAGGGACCTTGACATTCAGGACATGCTA
CCTGGGGACCTCCGATACTACTACAGCTACTTGGGGTCACTCACCACTCCTTCCTGTACA
GAAAACGTCCACTGGTTTGTGGTAGCAGATACTGTCAAGCTCTCTAAGACACAGATTGAG
AAGCTAGAGAATTCCTTACTGAATCACCAGAACGAGACCATCCAAAATAATTACCGCAGC
ACTCAGCCCCTGAACCACAGAGTGGTAGAAGCCAACTTCGTGTCTCACCCTCATCAGGAA
TACACTTTAGGCTCCAAGCTCCACTTTTATCTAAACAACATTGACCAAAACCTTGAGTAC
CTGAGAAGATTTATTGAACAGAAGATAACAAAGAGGAAAAAAGAAAAGTATTGGCCTTGA
Enzyme 34 GenBank Gene ID X96503 Link Image
Enzyme 34 GeneCard ID CA6 Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Chromosome:1
Enzyme 34 Locus 1p36.2
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References
  1. [PubMed Link Image]
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 1045
Enzyme 35 Name Translocase of inner mitochondrial membrane 13
Enzyme 35 Synonyms
  1. SubName: Translocase of inner mitochondrial membrane 13 homolog (Yeast)
Enzyme 35 Gene Name TIMM13
Enzyme 35 Protein Sequence >Translocase of inner mitochondrial membrane 13
MEGGFGSDFGGSGGGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDN
SEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Enzyme 35 Number of Residues 95
Enzyme 35 Molecular Weight 10469.9
Enzyme 35 Theoretical pI 8.32
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Involved in zinc ion binding
Enzyme 35 Specific Function Not Available
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • None
Enzyme 35 Transmembrane Regions
  • None
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 119223977 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID A1A4M0 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name A1A4M0_BOVIN Link Image
Enzyme 35 PDB ID Not Available
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence >288 bp
ATGGAGGGCGGCTTCGGCTCCGATTTCGGGGGCTCCGGCGGAGGGAAGCTGGACCCAGGG
CTCATAATGGAGCAGGTGAAAGTGCAGATCGCCGTGGCCAACGCGCAGGAGCTGCTACAG
AGGATGACGGACAAGTGCTTCCGGAAGTGTATCGGGAAGCCGGGGGGTTCCCTGGACAAT
TCGGAGCAGAAGTGCATCGCCATGTGCATGGACCGCTACATGGACGCCTGGAACACCGTG
TCACGTGCCTACAACTCGCGGCTGCAGCGGGAACGAGCCAACATGTGA
Enzyme 35 GenBank Gene ID BC126713 Link Image
Enzyme 35 GeneCard ID TIMM13 Link Image
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Chromosome:1
Enzyme 35 Locus 19p13.3
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References
  1. [PubMed Link Image]
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 1046
Enzyme 36 Name Matrix metallopeptidase 2 (Gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Enzyme 36 Synonyms Not Available
Enzyme 36 Gene Name MMP2
Enzyme 36 Protein Sequence >Matrix metallopeptidase 2 (Gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
MTEARVSRGALAALLRALCVLGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG
CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW
DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG
DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFRF
NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG
TSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVLPFTFLGNK
HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA
LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS
QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE
YWVYSASTLERGYPKPLTSLGLPPGVQKVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMD
PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLG
C
Enzyme 36 Number of Residues 661
Enzyme 36 Molecular Weight 73833.5
Enzyme 36 Theoretical pI 5.44
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Involved in calcium ion binding
Enzyme 36 Specific Function Not Available
Enzyme 36 Pathways Not Available
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein 151556868 Link Image
Enzyme 36 UniProtKB/Swiss-Prot ID A6QPN5 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name A6QPN5_BOVIN Link Image
Enzyme 36 PDB ID 1GXD Link Image
Enzyme 36 PDB File Show
Enzyme 36 3D Structure
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence >1986 bp
ATGACCGAGGCGCGAGTGTCCCGGGGCGCGCTGGCCGCCCTTCTGCGGGCGCTCTGCGTC
CTGGGCTGCCTGTTGGGCCGTGCCGCCGCCGCGCCGTCGCCCATCATCAAATTTCCCGGC
GATGTCGCCCCCAAAACGGACAAAGAGTTGGCTGTGCAATACCTAAACACCTTCTACGGC
TGCCCCAAGGAGAGCTGTAACTTGTTTGTGCTGAAGGACACCCTGAAGAAGATGCAGAAG
TTCTTCGGGTTACCCCAGACAGGTGAACTGGACCAGAGCACCATTGAGACCATGCGGAAG
CCGCGCTGTGGCAACCCCGACGTGGCCAACTACAACTTCTTCCCCCGAAAGCCCAAGTGG
GACAAGAACCAGATCACATACAGGATCATTGGCTACACACCTGATCTGGACCCCCAGACA
GTGGATGATGCCTTCGCTCGTGCCTTCCAAGTCTGGAGCGATGTGACTCCGCTACGGTTT
TCTCGGATCCATGATGGAGAGGCTGACATCATGATCAACTTTGGCCGCTGGGAGCATGGA
GATGGGTACCCTTTTGATGGCAAAGACGGGCTCCTGGCTCATGCCTTCGCCCCGGGCCCT
GGAGTTGGGGGAGATTCCCACTTTGATGACGATGAGCTGTGGACCCTGGGAGAAGGACAA
GTGGTCCGTGTGAAGTACGGGAATGCTGACGGGGAATATTGCAAGTTCCCCTTCCGGTTC
AACGGCAAGGAGTACACCAGCTGCACAGACACAGGCCGCAGCGATGGCTTCCTCTGGTGT
TCCACCACATACAACTTTGACAAGGACGGCAAGTATGGCTTCTGCCCCCATGAAGCCCTG
TTCACCATGGGCGGCAATGCCGACGGACAGCCCTGCAAGTTCCCGTTCCGCTTCCAGGGC
ACGTCTTACGACAGCTGCACCACGGAGGGCCGCACGGACGGCTACCGCTGGTGTGGCACC
ACCGAGGACTACGACCGCGACAAGAAGTACGGCTTCTGCCCGGAGACCGCCATGTCCACT
GTGGGCGGGAACTCGGAAGGTGCCCCATGTGTCCTCCCCTTCACCTTCCTGGGCAACAAG
CACGAGAGCTGCACCAGCGCTGGCCGCAGTGATGGGAAGTTGTGGTGTGCGACCACCTCC
AACTACGATGATGACCGCAAGTGGGGCTTCTGCCCCGACCAAGGGTACAGCCTGTTCCTG
GTGGCAGCCCATGAGTTTGGCCATGCAATGGGGCTGGAGCACTCACAGGACCCTGGAGCC
CTGATGGCGCCCATTTATACCTATACTAAGAACTTCCGCCTGTCCCATGATGACATCCAG
GGCATCCAAGAACTCTATGGGGCCTCCCCTGACATTGATACTGGCACCGGCCCCACCCCA
ACCCTGGGCCCCGTCACTCCTGAGCTCTGCAAACAGGACATCGTCTTCGACGGCATCTCT
CAGATCCGTGGGGAGATCTTCTTCTTCAAGGACCGATTCATCTGGCGAACAGTGACACCA
CGTGACAAGCCCACAGGGCCCCTGCTGGTAGCCACATTCTGGCCTGAGCTGCCGGAAAAG
ATCGATGCTGTGTACGAAGACCCACAGGAGGAGAAGGCTGTGTTCTTTGCAGGGAACGAA
TACTGGGTCTATTCAGCCAGTACCCTGGAGCGAGGGTACCCCAAGCCACTGACCAGCCTG
GGGCTCCCCCCTGGTGTCCAGAAGGTGGATGCTGCCTTTAACTGGAGCAAGAACAAGAAG
ACGTACATCTTCGCCGGAGACAAATTCTGGAGATACAATGAGGTGAAGAAGAAAATGGAT
CCTGGCTTCCCCAAGCTCATCGCCGATGCCTGGAACGCCATCCCTGATAACCTGGATGCT
GTGGTGGACCTGCAGGGCGGGGGTCACAGCTACTTCTTCAAGGGCGCCTATTACCTGAAG
TTGGAGAACCAAAGTCTGAAGAGCGTGAAGTTCGGAAGCATCAAATCCGATTGGCTGGGC
TGCTGA
Enzyme 36 GenBank Gene ID BC149404 Link Image
Enzyme 36 GeneCard ID MMP2 Link Image
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Chromosome:1
Enzyme 36 Locus 16q13-q21
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References Not Available
Enzyme 36 Metabolite References Not Available
Enzyme 37 [top]
Enzyme 37 ID 1047
Enzyme 37 Name Pancreatic carboxypeptidase B
Enzyme 37 Synonyms Not Available
Enzyme 37 Gene Name pCPB
Enzyme 37 Protein Sequence >Pancreatic carboxypeptidase B
MLAFLILVTVTLASAHHSGEHFEGDKVFRVHVEDENHISLLHELASTRQMDFWKPDSVTQ
VKPHSTVDFRVKAEDTVAVEDFLGQNGLRYEVLISNLRSMLEAQFDSRVRTTGHSYEKYN
NWETIEAWTEQVASENPDLISRSAIGTTFLGNTIYLLKVGKPGSNKPAVFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIHMTEFLDKLDFYVLPVVNIDGYIYTWTTNRMWRKTRSTR
AGSSCTGTDLNRNFDAGWCSIGASNNPCSETYCGSAAESEKESKAVADFIRNHLSSIKAY
LTIHSYSQMMLYPYSYDYKLPKNNVELNTLAKGAVKKLASLHGTTYTYGPGASTIYPASG
GSDDWAYDQGIKYSFTFELRDKGRYGFVLPESQIQPTCEETMLAIKYVTSYVLEHLY
Enzyme 37 Number of Residues 417
Enzyme 37 Molecular Weight 47347.9
Enzyme 37 Theoretical pI 6.39
Enzyme 37 GO Classification
Function
Process
Component
Enzyme 37 General Function Amino acid transport and metabolism
Enzyme 37 Specific Function Not Available
Enzyme 37 Pathways Not Available
Enzyme 37 Reactions Not Available
Enzyme 37 Pfam Domain Function
Enzyme 37 Signals
  • None
Enzyme 37 Transmembrane Regions
  • None
Enzyme 37 Essentiality Not Available
Enzyme 37 GenBank ID Protein 169822889 Link Image
Enzyme 37 UniProtKB/Swiss-Prot ID B1PZ69 Link Image
Enzyme 37 UniProtKB/Swiss-Prot Entry Name B1PZ69_BOVIN Link Image
Enzyme 37 PDB ID Not Available
Enzyme 37 Cellular Location Not Available
Enzyme 37 Gene Sequence Not Available
Enzyme 37 GenBank Gene ID EU515132 Link Image
Enzyme 37 GeneCard ID pCPB Link Image
Enzyme 37 GenAtlas ID Not Available
Enzyme 37 HGNC ID Not Available
Enzyme 37 Chromosome Location Not Available
Enzyme 37 Locus Not Available
Enzyme 37 SNPs SNPJam Report Link Image
Enzyme 37 General References Not Available
Enzyme 37 Metabolite References Not Available
Enzyme 38 [top]
Enzyme 38 ID 1048
Enzyme 38 Name Ubiquitin carboxyl-terminal hydrolase
Enzyme 38 Synonyms Not Available
Enzyme 38 Gene Name USP20
Enzyme 38 Protein Sequence >Ubiquitin carboxyl-terminal hydrolase
MGDSRDLCPHLDSIGEVTKEDLLLKSKSTCQSCGVSGPNLWACLQVSCSYVGCGESFADH
STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLEPRLAAHPPGPAPKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATAAALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQG
RSGGGSQAEAELLMADEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALEQ
QPPETQPPSPRSTSPCRTPEPDNEAHMRSSRPCSPVHHHEGHAKLASSPHRASPVRMGPA
YVLKKAQVPGSRRRKEQSYRSVISDIFDGSVLSLVQCLTCDRVSTTVETFQDLSLPIPGK
EDLAKLHSAIYQNVPAKPGACGDSYVAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDC
LAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKISSH
VSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDDQ
YVTEVHETVVQNAEAYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKFNT
FAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYSRFGGGPAVNHLYVCSI
CQVEIEALAKRRRVEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNEPPGP
IDNSRIAQVKGSGHIQLKPGADYGQISEETWVYLNNLYGGGPEIAIRQSVAQLPDPESLH
GEQKIEAETRAL
Enzyme 38 Number of Residues 912
Enzyme 38 Molecular Weight 101814.0
Enzyme 38 Theoretical pI 6.06
Enzyme 38 GO Classification
Function
Process
Component
Enzyme 38 General Function Involved in cysteine-type peptidase activity
Enzyme 38 Specific Function Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol
Enzyme 38 Pathways Not Available
Enzyme 38 Reactions Not Available
Enzyme 38 Pfam Domain Function
Enzyme 38 Signals
  • None
Enzyme 38 Transmembrane Regions
  • None
Enzyme 38 Essentiality Not Available
Enzyme 38 GenBank ID Protein 157279133 Link Image
Enzyme 38 UniProtKB/Swiss-Prot ID A7Z056 Link Image
Enzyme 38 UniProtKB/Swiss-Prot Entry Name A7Z056_BOVIN Link Image
Enzyme 38 PDB ID Not Available
Enzyme 38 Cellular Location Not Available
Enzyme 38 Gene Sequence >2739 bp
ATGGGGGACTCCAGGGACCTTTGTCCTCATCTTGACTCGATAGGGGAGGTGACCAAAGAG
GACTTGCTGCTCAAATCCAAGAGCACCTGTCAGTCATGCGGGGTTTCTGGACCCAACCTG
TGGGCCTGTCTCCAGGTCTCCTGCTCCTACGTTGGCTGCGGAGAATCCTTCGCTGACCAC
AGCACCCTGCACGCACAGGCGAAAAAGCACAACCTGACGGTGAACCTGACCACGTTCCGG
GTGTGGTGCTACGCCTGTGAGAAGGAAGTGTTCCTGGAGCCGCGCCTGGCGGCCCACCCG
CCTGGCCCCGCGCCCAAGTTCTCAGAGCAGGACTCTCCGCCACCCTCCCACCCTCTGAAA
GCCGTCCCCATCGCTGTGGCGGACGAAGGAGAGTCCGAGTCGGAGGACGACGACCTGAAG
CCACGAGGCCTCACGGGCATGAAGAACCTCGGCAACTCCTGCTACATGAATGCGGCCTTG
CAGGCTCTGTCCAACTGCCCCCCGCTCACCCAGTTCTTCTTGGAGTGTGGAGGCCTGGTC
CGCACAGACAAGAAGCCAGCCCTGTGCAAAAGTTATCAGAAGCTGGTCTCTGAGGTCTGG
CACAGGAAACGCCCCAGCTATGTGGTTCCCACCAGCCTGTCCCATGGGATCAAGTTGGTC
AACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAGGAATTCTTGCGCTGCCTGATG
GACCAGCTGCACGAGGAACTCAAGGAGCCCGTGGTGGCCACAGCGGCGGCGCTGACCGAG
GCGCGGGACTCGGACTCGAGCGACACGGATGAGAAGCGGGAGGGTGACCGGAGCCCCTCA
GAGGACGAGTTCCTGTCCTGCGACTCCAGCAGCGACCGCGGCGAGGGCGACGGGCAGGGG
CGCAGCGGGGGAGGCTCCCAGGCCGAGGCGGAGCTGCTGATGGCGGACGAGGCGGGCCGC
GCCATCTCCGAGAAGGAGCGCATGAAGGACCGCAAGTTCTCGTGGGGCCAGCAGCGCACC
AACTCGGAGCAGGTGGACGAGGACGCCGACGTGGACACCGCCATGGCCGCCCTGGAGCAG
CAGCCCCCGGAGACGCAGCCCCCCTCCCCGCGGTCCACCAGTCCCTGCCGGACGCCAGAG
CCGGACAACGAGGCGCACATGCGCAGCTCCCGGCCCTGCAGCCCCGTCCACCACCACGAA
GGCCACGCCAAGCTGGCCAGCAGCCCTCATCGTGCGAGCCCTGTGAGGATGGGGCCGGCC
TATGTGCTCAAGAAAGCCCAGGTCCCCGGCAGCCGGCGGCGGAAGGAGCAGAGCTACCGC
AGCGTCATCTCGGACATCTTCGACGGCTCCGTCCTCAGCCTCGTGCAGTGTCTCACCTGT
GACCGGGTGTCCACCACTGTGGAGACATTCCAGGACCTGTCACTGCCCATTCCTGGCAAG
GAGGACCTGGCCAAACTCCACTCGGCCATCTACCAGAACGTGCCGGCCAAGCCGGGTGCC
TGCGGGGACAGCTATGTGGCCCAGGGCTGGCTTGCCTTTATTGTGGAGTATATCCGACGG
TTCGTGGTGTCCTGTACCCCTAGCTGGTTTTGGGGGCCAGTCGTCACCCTGGAAGACTGC
CTGGCTGCCTTCTTTGCTGCTGATGAGCTGAAGGGTGACAACATGTACAGCTGTGAACGG
TGTAAAAAGCTGCGCAACGGGGTGAAGTACTGTAAGGTCTTGCGGTTGCCGGAGATCCTG
TGCATTCACCTGAAGCGCTTTAGGCACGAGGTCATGTACTCTTTCAAGATCAGCAGCCAT
GTGTCCTTCCCCCTCGAGGGCCTTGACCTGCGCCCCTTCCTCGCCAAGGAGTGCACGTCC
CAGATCACCACCTATGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGCAGTGGC
CACTACATCGCCTACTGCCAGAACGTGATCAACGGGCAGTGGTATGAGTTCGACGACCAG
TACGTCACCGAGGTCCACGAGACGGTGGTGCAGAACGCGGAGGCCTACGTGCTCTTCTAC
AGGAAGAGCAGCGAGGAAGCTGTGCGGGAGCGACAGCAGGTGGTGTCCCTGGCCGCCATG
CGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGGGAATGGCTCAACAAGTTTAACACC
TTCGCGGAGCCAGGGCCCATCACCAACCACACGTTCCTCTGCTCCCACGGAGGGATCCCG
CCCAACAAATATCACTACATCGATGACCTGGTGGTGATCCTGCCGCAGAACGTGTGGGAG
CACCTCTACAGCAGGTTTGGGGGCGGCCCCGCTGTGAACCATCTGTACGTGTGCTCCATC
TGCCAGGTGGAGATCGAGGCTCTGGCCAAGCGCAGGCGGGTGGAGATCGACACCTTCATC
AAGCTGAACAAGGCGTTCCAGGCCGAGGAGTCGCCCAGCGTCATCTACTGTATCAGCATG
CAGTGGTTCCGAGAGTGGGAGGCCTTCGTCAAGGGCAAGGACAACGAGCCCCCGGGGCCC
ATTGACAACAGCAGGATCGCACAGGTCAAAGGAAGCGGCCACATCCAGCTGAAGCCGGGA
GCTGACTATGGGCAGATCTCCGAGGAGACCTGGGTGTACCTGAACAACCTCTATGGCGGC
GGCCCCGAGATTGCCATCCGCCAGAGCGTGGCTCAGCTCCCGGACCCGGAGAGCTTGCAC
GGTGAACAGAAGATTGAAGCCGAGACCCGGGCCTTGTGA
Enzyme 38 GenBank Gene ID BC153254 Link Image
Enzyme 38 GeneCard ID USP20 Link Image
Enzyme 38 GenAtlas ID Not Available
Enzyme 38 HGNC ID Not Available
Enzyme 38 Chromosome Location Chromosome:9
Enzyme 38 Locus 9q34.11
Enzyme 38 SNPs SNPJam Report Link Image
Enzyme 38 General References Not Available
Enzyme 38 Metabolite References Not Available
Enzyme 39 [top]
Enzyme 39 ID 1049
Enzyme 39 Name A disintegrin and metalloproteinase with thrombospondin motifs 2
Enzyme 39 Synonyms
  1. ADAMTS-2
  2. ADAM-TS 2
  3. ADAM-TS2
  4. Procollagen I/II amino propeptide-processing enzyme
  5. Procollagen I N-proteinase
  6. PC I-NP
  7. Procollagen N-endopeptidase
  8. pNPI
Enzyme 39 Gene Name ADAMTS2
Enzyme 39 Protein Sequence >A disintegrin and metalloproteinase with thrombospondin motifs 2
MDPPAGAAGRLLCPALLLLLLLPLPADARLAAAAADPPGGPQGHGAERILAVPVRTDAQG
RLVSHVVSAATAPAGVRTRRAAPAQIPGLSGGSEEDPGGRLFYNVTVFGRDLHLRLRPNA
RLVAPGATVEWQGESGATRVEPLLGTCLYVGDVAGLAESSSVALSNCDGLAGLIRMEEEE
FFIEPLEKGLAAKEAEQGRVHVVYHRPTTSRPPPLGGPQALDTGISADSLDSLSRALGVL
EERVNSSRRRMRRHAADDDYNIEVLLGVDDSVVQFHGTEHVQKYLLTLMNIVNEIYHDES
LGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTDHDEYHDHAIFL
TRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCG
DEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLRDDPFTHDWPALPQLPGLHY
SMNEQCRFDFGLGYMMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTMCAPGKHCF
KGHCIWLTPDILKRDGNWGAWSPFGSCSRTCGTGVKFRTRQCDNPHPANGGRTCSGLAYD
FQLCNSQDCPDALADFREEQCRQWDLYFEHGDAQHHWLPHEHRDAKERCHLYCESKETGE
VVSMKRMVHDGTRCSYKDAFSLCVRGDCRKVGCDGVIGSSKQEDKCGVCGGDNSHCKVVK
GTFSRSPKKLGYIKMFEIPAGARHLLIQEADTTSHHLAVKNLETGKFILNEENDVDPNSK
TFIAMGVEWEYRDEDGRETLQTMGPLHGTITVLVIPEGDARISLTYKYMIHEDSLNVDDN
NVLEDDSVGYEWALKKWSPCSKPCGGGSQFTKYGCRRRLDHKMVHRGFCDSVSKPKAIRR
TCNPQECSQPVWVTGEWEPCSRSCGRTGMQVRSVRCVQPLHNNTTRSVHTKHCNDARPEG
RRACNRELCPGRWRAGSWSQCSVTCGNGTQERPVLCRTADDSFGVCREERPETARICRLG
PCPRNTSDPSKKSYVVQWLSRPDPNSPVQETSSKGRCQGDKSVFCRMEVLSRYCSIPGYN
KLCCKSCNPHDNLTDVDDRAEPPSGKHNDIEELMPTLSVPTLVMEVQPPPGIPLEVPLNT
SSTNATEDHPETNAVDVPYKIPGLEDEVQPPNLIPRRPSPYEKTRNQRIQELIDEMRKKE
MLGKF
Enzyme 39 Number of Residues 1205
Enzyme 39 Molecular Weight 133887.2
Enzyme 39 Theoretical pI 6.80
Enzyme 39 GO Classification
Function
Process
Component
Enzyme 39 General Function Involved in metalloendopeptidase activity
Enzyme 39 Specific Function Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis
Enzyme 39 Pathways Not Available
Enzyme 39 Reactions Not Available
Enzyme 39 Pfam Domain Function
Enzyme 39 Signals
  • 1-28
Enzyme 39 Transmembrane Regions
  • None
Enzyme 39 Essentiality Not Available
Enzyme 39 GenBank ID Protein 1865716 Link Image
Enzyme 39 UniProtKB/Swiss-Prot ID P79331 Link Image
Enzyme 39 UniProtKB/Swiss-Prot Entry Name ATS2_BOVIN Link Image
Enzyme 39 PDB ID Not Available
Enzyme 39 Cellular Location Not Available
Enzyme 39 Gene Sequence >3618 bp
ATGGATCCGCCGGCGGGAGCCGCCGGCCGCCTGCTCTGCCCCGCGCTGTTGCTGCTCCTG
CTGCTGCCGCTGCCCGCGGACGCCCGGCTCGCCGCCGCTGCCGCCGACCCCCCAGGCGGG
CCCCAGGGGCACGGAGCCGAGCGCATCCTGGCGGTGCCGGTGCGCACTGACGCCCAGGGC
CGCTTGGTGTCCCACGTGGTGTCGGCGGCGACGGCCCCAGCTGGGGTGCGGACCCGCAGG
GCCGCCCCTGCCCAGATCCCGGGGCTCTCTGGAGGCAGCGAGGAGGACCCCGGTGGCCGC
CTCTTCTACAATGTTACGGTGTTTGGCCGAGACCTGCACCTGCGGCTGCGGCCCAACGCC
CGCCTCGTGGCGCCTGGGGCCACGGTGGAGTGGCAGGGAGAATCGGGTGCCACCCGCGTG
GAGCCCCTGCTTGGGACCTGCCTCTACGTCGGAGACGTCGCGGGCCTGGCTGAATCCTCT
TCCGTGGCGCTCAGCAACTGCGATGGGCTGGCTGGCCTGATCCGTATGGAAGAGGAGGAA
TTCTTTATTGAGCCCCTGGAGAAAGGTCTGGCGGCGAAGGAGGCCGAACAGGGCCGTGTA
CACGTGGTGTATCATCGACCGACCACCTCCAGACCCCCTCCTCTGGGGGGGCCACAGGCC
CTGGACACAGGGATCTCCGCAGACAGCCTGGACAGCCTCAGCCGTGCTCTGGGTGTTCTG
GAGGAGCGAGTCAACAGCTCCAGGCGGAGGATGCGCAGGCATGCTGCCGACGACGACTAC
AACATCGAGGTCCTGCTTGGGGTGGACGACTCTGTGGTCCAGTTCCACGGGACGGAGCAC
GTGCAGAAGTACCTGCTCACCCTCATGAACATTGTCAACGAAATCTATCACGATGAGTCC
TTGGGGGCCCACATCAATGTCGTCCTGGTGCGGATAATCCTGCTGAGCTACGGGAAGTCC
ATGAGTCTCATTGAGATTGGGAACCCCTCTCAAAGTCTGGAGAATGTTTGCCGCTGGGCC
TACCTCCAGCAGAAGCCAGACACTGATCACGACGAGTACCACGATCACGCCATATTCCTC
ACACGGCAGGACTTCGGGCCCTCGGGCATGCAAGGCTATGCTCCTGTCACTGGGATGTGC
CACCCCGTCCGCAGCTGCACGCTGAACCACGAGGACGGCTTCTCCTCTGCGTTCGTGGTG
GCCCACGAGACTGGCCATGTGCTGGGCATGGAGCATGATGGGCAGGGCAACCGCTGCGGT
GACGAGGTGCGGCTGGGCAGCATCATGGCGCCCCTGGTGCAGGCAGCCTTCCATCGCTTC
CACTGGTCCCGCTGCAGCCAGCAGGAGCTGAGCCGCTACCTGCACTCCTATGACTGCCTG
CGGGATGACCCCTTCACCCACGACTGGCCGGCGCTGCCCCAGCTCCCCGGGCTGCACTAC
TCCATGAACGAGCAGTGCCGTTTCGACTTTGGCCTTGGTTACATGATGTGTACCGCGTTC
CGGACCTTCGACCCGTGCAAACAGCTGTGGTGCAGCCACCCTGACAACCCCTACTTTTGC
AAGACAAAGAAGGGGCCACCCCTGGATGGGACCATGTGTGCGCCTGGCAAGCACTGCTTT
AAAGGACACTGCATCTGGCTGACACCTGACATTCTCAAACGAGATGGCAACTGGGGTGCC
TGGAGTCCCTTCGGCTCCTGCTCGCGTACCTGCGGCACAGGTGTGAAGTTCAGGACCCGT
CAGTGCGACAACCCACACCCAGCCAATGGGGGCCGCACATGCTCGGGCCTCGCCTACGAT
TTCCAGCTCTGCAACTCGCAGGACTGCCCTGACGCGCTGGCCGACTTCCGCGAGGAGCAG
TGCCGGCAGTGGGACCTGTACTTCGAGCATGGTGACGCTCAACACCACTGGCTGCCCCAC
GAGCACCGGGACGCCAAGGAGCGGTGTCATCTCTACTGTGAGTCCAAGGAGACCGGGGAG
GTGGTGTCCATGAAGCGTATGGTGCATGACGGGACACGCTGTTCCTACAAGGACGCCTTC
AGCCTCTGCGTGCGTGGGGACTGCAGGAAGGTGGGCTGTGACGGGGTGATCGGCTCCAGC
AAGCAGGAGGACAAGTGTGGTGTGTGCGGAGGGGACAACTCCCACTGCAAGGTGGTCAAG
GGCACGTTCTCGCGCTCGCCCAAGAAGCTTGGTTACATCAAGATGTTTGAGATCCCGGCA
GGAGCCAGACACCTGCTAATCCAGGAAGCAGACACCACCAGCCATCACCTGGCCGTCAAA
AACCTGGAGACAGGCAAGTTCATTTTAAATGAGGAGAATGACGTGGATCCCAACTCCAAG
ACCTTCATCGCCATGGGCGTGGAGTGGGAGTACCGGGATGAGGACGGCCGGGAGACGCTG
CAGACCATGGGCCCCCTCCACGGCACCATCACTGTGCTGGTCATCCCAGAGGGGGACGCC
CGCATCTCACTGACCTACAAGTACATGATCCATGAGGACTCGCTCAATGTGGATGACAAC
AACGTCCTGGAAGACGACTCTGTGGGCTATGAGTGGGCCCTGAAGAAGTGGTCGCCCTGC
TCCAAGCCCTGCGGTGGAGGGTCCCAATTCACCAAGTATGGCTGCCGCCGGAGGCTGGAC
CACAAGATGGTGCACCGAGGCTTCTGCGACTCCGTCTCAAAGCCCAAAGCCATCCGCCGG
ACCTGCAACCCACAGGAGTGCTCCCAGCCCGTGTGGGTCACGGGTGAGTGGGAGCCGTGC
AGCCGGAGCTGTGGGCGGACAGGCATGCAGGTTCGCTCTGTGCGCTGTGTTCAGCCTCTG
CACAACAACACCACCCGCTCCGTGCACACCAAGCACTGCAATGACGCTCGACCCGAGGGC
CGCCGGGCCTGCAACCGCGAGCTGTGCCCTGGCCGGTGGCGGGCTGGATCCTGGTCCCAG
TGCTCAGTAACCTGTGGAAACGGCACCCAGGAACGGCCAGTGCTCTGCCGAACTGCGGAC
GACAGTTTCGGGGTGTGCCGGGAGGAGCGGCCTGAGACGGCAAGGATCTGCAGGCTTGGC
CCCTGTCCCCGAAACACCTCTGACCCCTCCAAGAAGAGCTACGTGGTCCAGTGGCTATCC
CGACCGGACCCCAACTCGCCAGTCCAGGAGACCTCGTCAAAGGGCCGCTGCCAAGGTGAC
AAGTCAGTGTTCTGTAGGATGGAAGTCTTGTCTCGTTATTGCTCCATCCCAGGCTACAAT
AAGCTGTGCTGCAAGTCCTGTAACCCGCACGACAACCTCACTGATGTGGACGACAGGGCA
GAGCCACCCTCTGGGAAGCACAATGACATTGAAGAGCTCATGCCCACCCTTTCAGTGCCC
ACTCTAGTCATGGAGGTGCAGCCTCCGCCAGGCATACCCCTGGAGGTGCCTCTCAATACT
TCCAGCACCAATGCCACCGAGGACCATCCAGAAACCAATGCTGTGGATGTGCCCTACAAA
ATCCCTGGCCTGGAAGATGAAGTCCAGCCACCCAACCTGATCCCTCGACGACCGAGCCCA
TATGAAAAGACCAGAAACCAAAGAATCCAAGAGCTCATTGATGAGATGAGGAAGAAAGAG
ATGCTCGGAAAGTTCTAA
Enzyme 39 GenBank Gene ID X96389 Link Image
Enzyme 39 GeneCard ID ADAMTS2 Link Image
Enzyme 39 GenAtlas ID Not Available
Enzyme 39 HGNC ID Not Available
Enzyme 39 Chromosome Location Chromosome:5
Enzyme 39 Locus 5qter
Enzyme 39 SNPs SNPJam Report Link Image
Enzyme 39 General References
  1. [PubMed Link Image]
Enzyme 39 Metabolite References Not Available
Enzyme 40 [top]
Enzyme 40 ID 1050
Enzyme 40 Name AFG3-like protein 2
Enzyme 40 Synonyms Not Available
Enzyme 40 Gene Name AFG3L2
Enzyme 40 Protein Sequence >AFG3-like protein 2
MAHRCLLLWGRGACRPRGMPPMLLPGGRTGSTERLYLRMLYRYATTQAKTSRNSLLTDVI
AAYQRLCSRPPKGFEKYFPNGKNGKKTSEPKEVMGEKKEPKPAAAPRPSGGGVGGGGKRG
GKKDDSHWWSRFQKGDIPWDDKEFKMYFLWTALFWGGFLFYFLFKSSGREITWKDFANNY
LSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGEN
RVPVVYIAESDGSFLLSMLPTVLIIAFLLYTIRRGPAGIGRTGRGMGGLFSVGETTAKVL
KDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAK
ATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRG
NFGGQSEQENTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALMRPGRFDRQIFIGPPD
IKGRASIFKVHLRPLKLDSTLEKEKLARKLASLTPGFSGADVANVCNEAALIAARHLSDS
INQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPR
GKGLGYAQYLPREQYLYTREQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYA
QIVQFGMNEKVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEK
KADVEKVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEFVEGTGSLDEDTSLPEGLKDW
NREREGSEEPSGEKVTSPVQGAGPA
Enzyme 40 Number of Residues 805
Enzyme 40 Molecular Weight 89386.9
Enzyme 40 Theoretical pI 9.05
Enzyme 40 GO Classification
Function
Process
Component
Enzyme 40 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 40 Specific Function Putative ATP-dependent protease
Enzyme 40 Pathways Not Available
Enzyme 40 Reactions Not Available
Enzyme 40 Pfam Domain Function
Enzyme 40 Signals
  • None
Enzyme 40 Transmembrane Regions
  • 144-164 252-272
Enzyme 40 Essentiality Not Available
Enzyme 40 GenBank ID Protein 86820707 Link Image
Enzyme 40 UniProtKB/Swiss-Prot ID Q2KJI7 Link Image
Enzyme 40 UniProtKB/Swiss-Prot Entry Name AFG32_BOVIN Link Image
Enzyme 40 PDB ID Not Available
Enzyme 40 Cellular Location Not Available
Enzyme 40 Gene Sequence >2418 bp
ATGGCGCACCGCTGCTTGCTGCTATGGGGCCGGGGCGCCTGCCGGCCCCGCGGGATGCCC
CCGATGCTCTTGCCTGGCGGCCGCACGGGCTCCACCGAACGGCTCTACCTGCGGATGCTT
TATCGATATGCCACGACTCAGGCGAAAACCAGCAGGAATTCCCTTCTGACAGATGTGATT
GCTGCTTATCAGAGACTCTGTTCTCGGCCTCCAAAAGGATTTGAAAAATACTTTCCCAAT
GGAAAAAATGGAAAAAAAACTAGTGAACCTAAAGAAGTTATGGGAGAAAAAAAAGAACCC
AAGCCAGCTGCTGCCCCGCGTCCTTCTGGAGGAGGAGTTGGTGGCGGTGGAAAACGAGGC
GGCAAGAAAGATGACTCTCACTGGTGGTCCAGGTTCCAGAAGGGTGACATCCCATGGGAT
GATAAGGAATTCAAGATGTACTTTCTCTGGACCGCCCTGTTTTGGGGAGGATTCCTGTTT
TACTTCCTGTTCAAGAGCTCCGGGAGAGAAATCACGTGGAAGGACTTTGCTAACAACTAT
CTTTCCAAGGGAGTTGTAGACAGACTGGAAGTTGTCAACAAGCGATTTGTTCGAGTGACT
TTTACACCAGGAAAAACTCCTGTTGATGGACAGTACGTCTGGTTCAATATTGGCAGTGTG
GACACCTTTGAGCGGAACCTGGAGACGCTGCAGCAGGAACTAGGCATAGAAGGAGAGAAC
CGGGTCCCTGTGGTCTACATCGCCGAGAGTGACGGCTCCTTCCTCCTGAGCATGCTGCCC
ACCGTGCTCATCATCGCCTTCCTGCTCTACACCATCCGGAGGGGCCCAGCCGGCATCGGC
CGCACAGGCCGGGGCATGGGCGGACTCTTCAGTGTTGGAGAGACCACCGCCAAGGTCCTC
AAGGATGAGATTGACGTGAAGTTCAAAGACGTGGCCGGCTGTGAGGAGGCCAAGCTGGAG
ATCATGGAATTTGTGAATTTCCTAAAAAATCCAAAGCAGTATCAAGACCTGGGAGCAAAA
ATCCCAAAGGGTGCCATTCTCACTGGTCCTCCAGGCACTGGGAAGACACTGCTGGCTAAG
GCCACGGCTGGAGAAGCCAATGTCCCTTTCATCACCGTTAGCGGGTCTGAGTTCTTGGAG
ATGTTTGTTGGTGTAGGCCCAGCTAGAGTCCGTGACTTATTCGCTCTTGCTCGGAAGAAC
GCCCCTTGCATCCTCTTCATCGATGAAATAGATGCGGTGGGAAGGAAGAGAGGCAGGGGC
AACTTCGGCGGGCAGAGTGAGCAGGAGAACACGCTCAACCAGCTGCTTGTGGAGATGGAC
GGATTTAACACAACAACCAATGTGGTCATCTTGGCGGGCACCAACCGACCGGATATCCTA
GACCCAGCTCTGATGAGGCCAGGCCGCTTCGACAGGCAGATCTTCATTGGACCGCCGGAC
ATTAAGGGAAGAGCCTCTATTTTCAAAGTTCATCTCCGACCCCTGAAGCTGGATAGCACC
CTGGAAAAGGAGAAGCTGGCGAGGAAGCTCGCATCCTTGACCCCGGGGTTTTCAGGAGCC
GATGTTGCCAACGTGTGCAACGAAGCTGCTTTGATCGCTGCGAGACACCTTTCAGATTCC
ATAAACCAGAAACACTTTGAACAAGCAATTGAACGAGTGATTGGCGGCTTAGAGAAGAAA
ACGCAGGTCCTACAGCCTGAGGAGAAGAAGACAGTGGCATACCATGAGGCAGGCCACGCA
GTTGCCGGTTGGTACCTGGAGCACGCAGACCCCCTCTTGAAGGTGTCCATCATCCCACGA
GGCAAAGGGCTGGGCTACGCTCAGTACCTGCCCCGGGAGCAGTACCTCTACACCCGGGAG
CAGCTCCTGGACCGCATGTGCATGACCTTGGGCGGCCGCGTGTCCGAGGAGATCTTCTTT
GGCAGGATCACTACCGGTGCCCAGGACGACTTGCGCAAAGTGACCCAGAGTGCCTACGCC
CAGATTGTTCAGTTTGGCATGAACGAGAAGGTCGGGCAGATCTCCTTTGACCTCCCACGT
CAGGGGGACATGGTGTTGGAGAAGCCGTACAGCGAGGCCACCGCCAGACTCATAGATGAC
GAAGTACGAATCCTTATCAACGATGCTTACAAGAGGACAGTGGCCCTCCTCACAGAGAAG
AAAGCTGACGTGGAGAAGGTTGCTCTGCTGTTGTTAGAAAAAGAAGTGTTAGACAAGAAC
GACATGGTGGAACTTCTGGGCCCCAGGCCATTTGCGGAGAAGTCTACGTACGAGGAGTTT
GTGGAAGGCACTGGTAGCCTAGACGAGGACACCTCACTCCCCGAGGGCCTGAAGGACTGG
AACAGGGAGCGTGAGGGCTCAGAGGAGCCCTCGGGCGAGAAGGTGACCAGCCCGGTCCAG
GGTGCCGGCCCTGCGTAG
Enzyme 40 GenBank Gene ID BC105322 Link Image
Enzyme 40 GeneCard ID AFG3L2 Link Image
Enzyme 40 GenAtlas ID Not Available
Enzyme 40 HGNC ID Not Available
Enzyme 40 Chromosome Location Chromosome:1
Enzyme 40 Locus 18p11
Enzyme 40 SNPs SNPJam Report Link Image
Enzyme 40 General References Not Available
Enzyme 40 Metabolite References Not Available
Enzyme 41 [top]
Enzyme 41 ID 1051
Enzyme 41 Name DNA topoisomerase
Enzyme 41 Synonyms Not Available
Enzyme 41 Gene Name TOP3A
Enzyme 41 Protein Sequence >DNA topoisomerase
MIFPAAHRALRGLPRPGTRALTRAAMEVALRGVRKILCVAEKNDAAKGIADLLSGGRMRR
REGLSRFNKIYEFDYHLCGQNVTMVMTSVSGHLLAHDFRMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLEREAQQCQALVIWTDCDREGENIGFEVIHVCKAVKPSLQVLRARFSE
ITTRAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQKIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEVFHKIRVTHDHRDGVVEFSWKRHRLFNHTACLVLY
QMCMEDPRAMVVEVRSKAKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPKDLDLAALVEQQTPDPRWGAFARNILERGGPTPRNGNKSDQAHPPIHPT
KYTDSLQGDEQRLYELIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDV
YPYDRWSDKTLPVYEQGTCFQPSTVEMVDGETSPPQLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICEGKK
DKLVVLHQQVQKYKQVFIEAVAKARKLDEALSQYFGAATEVAPQDALPAVPEPIRKCPQC
SRDMVLKTRKSGGFYLGCTGFPECRSAVWFPDSVLEASRDVSVCPVCQPHPVYRLKFKFK
RGSLPPTMPLEFVGCIGGCDETLREILALRFSQGAARVSQPASQTSGYLQASQSLNRMDS
GQQGQPRPPVTRPSKALTRTLPPPAVESESNSVTCNCGQEALLLTVRKEGPNQGRQFYKC
GSGGCSFFLWADSGHPGAGPPSSASRPPGGPLEHPPGSGTLLGGSSRPGSGGSGGASCLC
GQPAVTRTVQKEGPNQGRQFHTCAQPREHQCGFFQWVDENVAPGTFGGPLWPGSRRGTQG
LEARSKRPRAGSSDTGSATKKPRKCSLCHQPGHTRPFCPQNR
Enzyme 41 Number of Residues 1002
Enzyme 41 Molecular Weight 111511.6
Enzyme 41 Theoretical pI 8.59
Enzyme 41 GO Classification
Function
Process
Component
Enzyme 41 General Function Replication, recombination and repair
Enzyme 41 Specific Function ATP-independent breakage of single-stranded DNA, followed by passage and rejoining
Enzyme 41 Pathways Not Available
Enzyme 41 Reactions Not Available
Enzyme 41 Pfam Domain Function
Enzyme 41 Signals
  • None
Enzyme 41 Transmembrane Regions
  • None
Enzyme 41 Essentiality Not Available
Enzyme 41 GenBank ID Protein 117306502 Link Image
Enzyme 41 UniProtKB/Swiss-Prot ID A0JN73 Link Image
Enzyme 41 UniProtKB/Swiss-Prot Entry Name A0JN73_BOVIN Link Image
Enzyme 41 PDB ID Not Available
Enzyme 41 Cellular Location Not Available
Enzyme 41 Gene Sequence >3009 bp
ATGATATTTCCGGCCGCCCACCGCGCTCTCCGGGGGCTGCCGCGGCCCGGTACTCGGGCC
CTGACTCGCGCCGCCATGGAGGTGGCCCTGCGAGGCGTGCGGAAAATCCTTTGCGTGGCC
GAGAAGAACGACGCGGCCAAGGGCATAGCCGACTTGCTGTCTGGCGGCCGCATGCGGCGG
AGGGAAGGACTTTCAAGATTCAACAAGATCTATGAGTTTGATTATCATCTGTGTGGCCAG
AATGTCACCATGGTAATGACCTCAGTCTCAGGACACTTGCTGGCCCATGATTTCCGGATG
CAGTTTCGCAAATGGCAGAGCTGCAATCCTCTTGTCCTGTTTGAAGCAGAAATTGAAAAG
TACTGCCCAGAGAATTTTGTAGACATCAAGAAAACTCTGGAGCGAGAGGCCCAGCAATGC
CAGGCCCTGGTGATTTGGACCGACTGCGACAGAGAGGGTGAAAACATTGGGTTTGAGGTC
ATCCACGTGTGCAAGGCCGTGAAGCCCAGCCTGCAGGTGCTGCGAGCCCGTTTCTCCGAG
ATCACCACCCGCGCTGTCCGGACGGCATGTGAAAACCTTACGGAGCCCGACCAGAGAGTG
AGCGATGCCGTGGATGTGAGGCAGGAGTTGGACCTGCGGATCGGGGCGGCCTTCACCAGG
TTCCAGACGCTGCGGCTGCAGAAGATCTTCCCCGAGGTGCTGGCAGAGCAGCTTATCAGC
TACGGCAGCTGCCAGTTCCCCACCCTGGGGTTCGTGGTGGAGAGGTTCAAAGCCATTCAG
GCATTTGTGCCAGAAGTCTTCCACAAGATCCGAGTGACTCATGACCACAGGGACGGCGTG
GTAGAGTTCAGCTGGAAAAGGCATCGTCTCTTCAATCACACGGCATGTCTCGTCCTCTAC
CAGATGTGCATGGAGGATCCCAGGGCGATGGTGGTAGAGGTCAGGTCAAAAGCCAAGAGC
AAGTGGAGGCCTCAGGCTCTGGACACTGTGGAGCTGGAGAAGCTGGCATCTCGGAAGTTG
AGGATAAATGCTAAAGAAACCATGAGGATTGCAGAAAAGCTCTACACCCAAGGGTACATC
AGCTATCCTCGAACTGAAACGAACATTTTCCCCAAAGACCTAGACCTGGCGGCACTGGTG
GAGCAACAGACCCCGGATCCACGCTGGGGGGCCTTTGCTCGAAACATTCTAGAGCGCGGT
GGCCCCACCCCACGCAATGGGAATAAGTCTGACCAAGCGCACCCTCCCATCCACCCCACC
AAATACACTGACAGCCTGCAGGGGGATGAGCAGCGACTGTACGAGCTCATCGTCCGCCAC
TTCCTGGCCTGCTGCTCGCAGGATGCCCAGGGCCAGGAGACCACTGTGGAGATCGACATC
GCGCAGGAGCGCTTCGTGGCCCACGGCCTCATGATCCTGGCCCGGAACTATCTGGACGTG
TACCCGTATGATCGCTGGAGTGACAAGACCCTCCCTGTCTATGAGCAAGGCACCTGCTTT
CAGCCCAGCACTGTGGAGATGGTGGACGGGGAGACCAGTCCCCCCCAGCTGCTCACCGAG
GCTGACCTCATTGCCCTCATGGAGAAGCACGGCATTGGTACGGACGCCACGCACGCTGAG
CACATCGAGACCATCAAGGCCCGGATGTACGTCGGGCTCACGCCAGATAAGCGCTTTCTC
CCTGGGCACCTGGGCATGGGGCTCGTGGAAGGCTATGACTCCATGGGCTACGAGATGTCC
AAGCCTGATCTGCGGGCCGAGCTGGAGGCTGACCTGAAGCTCATCTGCGAGGGGAAGAAG
GACAAGCTGGTGGTCCTGCATCAGCAGGTGCAGAAGTACAAGCAGGTGTTCATCGAAGCC
GTGGCCAAAGCCAGGAAGTTGGACGAGGCCTTGTCCCAGTACTTCGGGGCGGCTACAGAG
GTAGCCCCACAGGACGCCCTCCCGGCTGTGCCCGAGCCCATCAGGAAGTGTCCTCAGTGC
AGCCGGGACATGGTTCTTAAGACCAGAAAGAGTGGCGGGTTTTACCTCGGTTGCACGGGC
TTCCCTGAGTGTCGGTCGGCTGTCTGGTTCCCGGACAGCGTGCTGGAGGCCAGCAGGGAT
GTGAGCGTGTGCCCAGTGTGCCAGCCGCACCCAGTTTACAGGTTGAAGTTCAAGTTTAAA
CGAGGCAGCCTGCCCCCAACCATGCCCCTAGAATTTGTCGGCTGCATCGGCGGGTGTGAT
GAGACCCTGAGGGAGATCCTGGCCCTCAGGTTCTCCCAGGGCGCTGCCCGAGTCAGCCAG
CCTGCCAGCCAGACCTCCGGCTACCTGCAGGCTAGCCAGTCCCTGAACAGAATGGACAGT
GGCCAGCAGGGCCAGCCCCGGCCCCCCGTCACCAGGCCCTCGAAGGCTTTGACCAGGACT
CTTCCTCCACCCGCCGTTGAGAGTGAGAGCAACTCGGTGACCTGCAACTGTGGCCAGGAG
GCCCTGCTGCTCACCGTCCGGAAGGAGGGCCCCAACCAGGGCCGCCAGTTCTACAAGTGT
GGCAGTGGTGGCTGCAGCTTCTTTCTATGGGCTGACAGCGGCCACCCAGGAGCCGGGCCT
CCCTCCTCAGCGTCCAGACCCCCAGGCGGCCCCCTGGAACACCCCCCGGGCTCAGGGACT
CTCTTGGGCGGGTCCAGCAGGCCTGGCAGTGGTGGCAGCGGTGGCGCATCCTGCCTGTGT
GGCCAGCCGGCTGTCACGCGCACCGTGCAGAAGGAGGGGCCCAACCAGGGCCGCCAGTTC
CACACGTGTGCCCAGCCCCGTGAGCACCAGTGCGGCTTCTTCCAGTGGGTGGACGAGAAC
GTGGCCCCAGGGACCTTCGGAGGCCCCCTCTGGCCAGGAAGCAGGAGAGGAACCCAGGGG
CTGGAGGCCAGAAGCAAGAGGCCTCGGGCCGGCTCCTCAGACACAGGGTCTGCAACCAAG
AAACCCCGGAAGTGCAGCCTTTGCCACCAGCCTGGACATACCCGTCCCTTCTGTCCTCAG
AACAGATGA
Enzyme 41 GenBank Gene ID BC126547 Link Image
Enzyme 41 GeneCard ID TOP3A Link Image
Enzyme 41 GenAtlas ID Not Available
Enzyme 41 HGNC ID Not Available
Enzyme 41 Chromosome Location Chromosome:1
Enzyme 41 Locus 17p12-p11.2
Enzyme 41 SNPs SNPJam Report Link Image
Enzyme 41 General References Not Available
Enzyme 41 Metabolite References Not Available
Enzyme 42 [top]
Enzyme 42 ID 1052
Enzyme 42 Name Ubiquitin isopeptidase T
Enzyme 42 Synonyms Not Available
Enzyme 42 Gene Name USP5
Enzyme 42 Protein Sequence >Ubiquitin isopeptidase T
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVER
HFNKTGQRVYLHLRRTRRPKEEDATSGTGDPPRKKPTRLAIGVEGGFDLNEEKFEYDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHFRET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESAVPLKPLSGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVTEQKEVQDGIAPRMFKAL
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKEELLEYEEKKRQAEEEKLPLPELVRAQVPFSSCLEAYGAPE
QVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDIS
QLRGTGLQPGEEELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTGNS
GAEAAMNWVMSHMDDPDFANPLALLPQSLPHPVSPCPSLENAKIQDVNKSYVA
Enzyme 42 Number of Residues 713
Enzyme 42 Molecular Weight 80065.1
Enzyme 42 Theoretical pI 4.64
Enzyme 42 GO Classification
Function
Process
Component
Enzyme 42 General Function Involved in ubiquitin thiolesterase activity
Enzyme 42 Specific Function Not Available
Enzyme 42 Pathways Not Available
Enzyme 42 Reactions Not Available
Enzyme 42 Pfam Domain Function
Enzyme 42 Signals
  • None
Enzyme 42 Transmembrane Regions
  • None
Enzyme 42 Essentiality Not Available
Enzyme 42 GenBank ID Protein 119936248 Link Image
Enzyme 42 UniProtKB/Swiss-Prot ID A1L548 Link Image
Enzyme 42 UniProtKB/Swiss-Prot Entry Name A1L548_BOVIN Link Image
Enzyme 42 PDB ID Not Available
Enzyme 42 Cellular Location Not Available
Enzyme 42 Gene Sequence Not Available
Enzyme 42 GenBank Gene ID BT029835 Link Image
Enzyme 42 GeneCard ID USP5 Link Image
Enzyme 42 GenAtlas ID Not Available
Enzyme 42 HGNC ID Not Available
Enzyme 42 Chromosome Location Chromosome:1
Enzyme 42 Locus 12p13
Enzyme 42 SNPs SNPJam Report Link Image
Enzyme 42 General References
  1. [PubMed Link Image]
Enzyme 42 Metabolite References Not Available
Enzyme 43 [top]
Enzyme 43 ID 1053
Enzyme 43 Name Cytochrome c oxidase subunit 5B, mitochondrial
Enzyme 43 Synonyms
  1. Cytochrome c oxidase polypeptide Vb
  2. Cytochrome c oxidase polypeptide VIa
Enzyme 43 Gene Name COX5B
Enzyme 43 Protein Sequence >Cytochrome c oxidase subunit 5B, mitochondrial
MASRLLRGVGALASQALRARGPNGVSVVRSMASGGGVPTDEEQATGLEREVMLAARKGQD
PYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHY
KLVPHQLAH
Enzyme 43 Number of Residues 129
Enzyme 43 Molecular Weight 13833.7
Enzyme 43 Theoretical pI 8.66
Enzyme 43 GO Classification
Function
Process
Component
Enzyme 43 General Function Involved in cytochrome-c oxidase activity
Enzyme 43 Specific Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
Enzyme 43 Pathways Not Available
Enzyme 43 Reactions Not Available
Enzyme 43 Pfam Domain Function
Enzyme 43 Signals
  • None
Enzyme 43 Transmembrane Regions
  • None
Enzyme 43 Essentiality Not Available
Enzyme 43 GenBank ID Protein 74268063 Link Image
Enzyme 43 UniProtKB/Swiss-Prot ID P00428 Link Image
Enzyme 43 UniProtKB/Swiss-Prot Entry Name COX5B_BOVIN Link Image
Enzyme 43 PDB ID 1V55 Link Image
Enzyme 43 PDB File Show
Enzyme 43 3D Structure
Enzyme 43 Cellular Location Not Available
Enzyme 43 Gene Sequence >390 bp
ATGGCGTCAAGGTTACTCCGTGGAGTTGGAGCTTTGGCCTCCCAGGCCCTGAGGGCCCGG
GGTCCAAATGGAGTCTCCGTGGTGCGCTCTATGGCGTCTGGAGGTGGTGTTCCTACTGAT
GAAGAGCAGGCGACTGGGCTAGAGAGGGAGGTCATGCTGGCTGCTCGCAAGGGACAGGAC
CCATACAATATACTTGCCCCAAAGGCAACCTCAGGTACCAAGGAGGACCCTAATTTAGTC
CCCTCCATCACCAACAAGCGGATAGTGGGCTGCATCTGTGAAGAAGACAACAGTACTGTC
ATCTGGTTCTGGCTGCACAAAGGCGAGGCCCAGCGATGCCCCAGCTGTGGAACCCATTAC
AAGCTGGTGCCACACCAGCTGGCCCACTGA
Enzyme 43 GenBank Gene ID BC102579 Link Image
Enzyme 43 GeneCard ID COX5B Link Image
Enzyme 43 GenAtlas ID Not Available
Enzyme 43 HGNC ID Not Available
Enzyme 43 Chromosome Location Chromosome:2
Enzyme 43 Locus 2cen-q13
Enzyme 43 SNPs SNPJam Report Link Image
Enzyme 43 General References
  1. [PubMed Link Image]
Enzyme 43 Metabolite References Not Available
Enzyme 44 [top]
Enzyme 44 ID 1054
Enzyme 44 Name Cleavage and polyadenylation specificity factor subunit 3
Enzyme 44 Synonyms
  1. Cleavage and polyadenylation specificity factor 73 kDa subunit
  2. CPSF 73 kDa subunit
  3. mRNA 3'-end-processing endonuclease CPSF-73
Enzyme 44 Gene Name CPSF3
Enzyme 44 Protein Sequence >Cleavage and polyadenylation specificity factor subunit 3
MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLID
PAEIDLLLISHFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADD
MLYTETDLEESMDKIETINFHEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDF
SRQEDRHLMAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIPV
FALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMAVYQTYVNAMNDKIRKQININ
NPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRNGVIIAGYCVE
GTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQR
VSGILVKRNFNYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLYYQLQKLTGDVEEL
EIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
VSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDGSILSVTVDGKTANINLETRTVECEEGSE
DDESLREMVELAAQRLYEALTPVH
Enzyme 44 Number of Residues 684
Enzyme 44 Molecular Weight 77487.4
Enzyme 44 Theoretical pI 5.41
Enzyme 44 GO Classification
Function
Process
Component
Enzyme 44 General Function Translation, ribosomal structure and biogenesis
Enzyme 44 Specific Function Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. Has endonuclease activity, and functions as mRNA 3'-end-processing endonuclease
Enzyme 44 Pathways Not Available
Enzyme 44 Reactions Not Available
Enzyme 44 Pfam Domain Function
Enzyme 44 Signals
  • None
Enzyme 44 Transmembrane Regions
  • None
Enzyme 44 Essentiality Not Available
Enzyme 44 GenBank ID Protein 1707412 Link Image
Enzyme 44 UniProtKB/Swiss-Prot ID P79101 Link Image
Enzyme 44 UniProtKB/Swiss-Prot Entry Name CPSF3_BOVIN Link Image
Enzyme 44 PDB ID Not Available
Enzyme 44 Cellular Location Not Available
Enzyme 44 Gene Sequence >2055 bp
ATGTCCGCGATTCCTGCAGAGGAGAGTGACCAGCTGCTGATCCGACCCCTTGGAGCTGGG
CAGGAAGTGGGAAGATCATGTATTATTCTGGAGTTCAAGGGGAGGAAGATAATGCTGGAC
TGTGGGATCCATCCTGGCCTAGAAGGAATGGATGCTCTTCCTTATATTGATTTGATTGAC
CCAGCTGAGATTGATCTCCTACTAATTAGTCATTTCCATTTGGATCACTGTGGAGCTTTG
CCCTGGTTTCTACAGAAGACAAGTTTCAAAGGAAGAACATTTATGACTCATGCTACAAAA
GCTATTTATAGATGGCTTCTTTCAGATTATGTCAAAGTTAGTAACATATCAGCAGACGAC
ATGCTGTATACTGAGACAGATTTGGAAGAAAGCATGGACAAAATTGAAACCATCAATTTT
CATGAAGTGAAGGAAGTTGCAGGAATCAAGTTTTGGTGTTATCACGCCGGCCATGTCCTG
GGAGCTGCCATGTTCATGATCGAGATCGCAGGCGTGAAGCTTTTATACACAGGTGATTTC
TCAAGACAAGAAGACAGACACTTAATGGCAGCTGAAATTCCTAACATTAAACCTGATATT
CTTATCATTGAATCTACTTATGGGACCCATATCCACGAGAAGCGAGAGGAGCGAGAGGCA
AGGTTCTGTAATACCGTCCATGATATTGTGAACAGAGGGGGCCGAGGCCTCATTCCYGTC
TTTGCYCTCGGACGGGCCCAGGAACTCCTCTTGATTTTAGATGAGTACTGGCAGAAYCAC
CCAGAACTCCATGATATTCCAATATACTATGCATCATCTTTGGCCAAGAAGTGTATGGCA
GTGTACCAGACATATGTGAAYGCCATGAATGACAAAATCCGCAAACAGATCAACATCAAT
AATCCATTTGTTTTCAAACACATTAGTAATCTGAAGAGCATGGATCATTTTGATGACATT
GGTCCCAGCGTGGTCATGGCCTCCCCAGGCATGATGCAAAGTGGTTTATCCAGAGAGCTC
TTTGAAAGCTGGTGTACTGATAAGAGGAATGGCGTCATCATAGCCGGCTACTGTGTAGAA
GGCACGCTTGCCAAGCATATCATGTCTGAACCGGAAGAAATCACTACCATGTCCGGGCAG
AAGTTACCTCTGAAAATGTCTGTTGATTACATCTCTTTCTCTGCGCACACGGATTACCAG
CAAACCAGTGAATTTATACGTGCTTTGAAGCCGCCTCAYGTGATYTTAGTCCATGGAGAA
CAGAATGAAATGGCCAGATTGAAAGCAGCCCTGATTCGAGAATATGAAGATAATGATGAR
GTTCACATAGAGGTTCATAATCCTCGGAATACAGAGGCAGTGACCTTGAACTTCAGGGGA
GAAAAACTAGCCAAGGTCATGGGATTTTTAGCAGACAAAAAACCAGAACAGGGCCAGCGG
GTCTCAGGAATACTTGTTAAAAGAAACTTTAATTATCACATACTTTCTCCTTGTGACCTC
TCCAATTATACTGACTTGGCCATGAGCACTGTAAAACAGACCCAAGCCATTCCATATACT
GGTCCTTTTAATTTGCTCTATTACCAGCTACAGAAATTGACAGGTGATGTGGAAGAATTA
GAAATTCAAGAAAAGCCTGCTTTGAAAGTGTTTAAAAATATTACTGTAATACAGGAACCA
GGAATGGTGGTATTAGAATGGTTGGCAAATCCTTCCAATGATATGTATGCAGATACAGTC
ACAACCGTGATACTAGAAGTTCAGTCAAACCCAAAAATAAGGAAAGGTGCAGTACAGAAG
GTTTCTAAAAAATTAGAAATGCACGTTTACAGCAAGAGGCTGGAGATCATGCTCCAGGAC
ATATTTGGAGAAGACTGTGTTAGTGTAAAAGATGGTTCTATTCTTAGTGTCACAGTGGAT
GGAAAAACTGCTAACATAAATTTGGAGACACGGACTGTAGAATGTGAAGAAGGCAGTGAA
GATGACGAGTCCCTCCGAGAAATGGTGGAACTGGCGGCCCAGAGACTGTACGAGGCCCTC
ACACCCGTCCACTGA
Enzyme 44 GenBank Gene ID X95906 Link Image
Enzyme 44 GeneCard ID CPSF3 Link Image
Enzyme 44 GenAtlas ID Not Available
Enzyme 44 HGNC ID Not Available
Enzyme 44 Chromosome Location Chromosome:2
Enzyme 44 Locus 2p25.1
Enzyme 44 SNPs SNPJam Report Link Image
Enzyme 44 General References
  1. [PubMed Link Image]
Enzyme 44 Metabolite References Not Available
Enzyme 45 [top]
Enzyme 45 ID 1055
Enzyme 45 Name Carboxypeptidase B2
Enzyme 45 Synonyms Not Available
Enzyme 45 Gene Name CPB2
Enzyme 45 Protein Sequence >Carboxypeptidase B2
MKLYSLGVLVATVLFCGEHAFAFQRGQVLSALPRTSRQVQILQNVTTTYKIVLWQPVAAE
YIVKGYEVHFFVNASDVSNVKAHLNASRIPFRVLVENVEDLIRQQTSNDTISPRASSSYY
EQYHSLNEIYSWIEVMTERYPDMVEKIHIGSSYEKYPLYVLKVSKKEQRAKNAMWIDCGI
HAREWISPAFCLWFVGSVTYYYGKEKMHTNLLKHMDFYIMPVVNVDGYDYTWKKDRMWRK
NRSLHEKNACVGTDLNRNFASKHWCGEGASSSSCSEIYCGTYPESEPEVKAVADFLRRNI
KHIKAYISMHSYSQKIVFPYSYSRSRSKDHEELSLVAREAVFAMENIHRNIRYTHGSGSE
SLYLAPGGSDDWIYDLGIKYSFTFELRDKGKYGFLLPESYIRPTCSEALVAVAKIASHVV
KNV
Enzyme 45 Number of Residues 423
Enzyme 45 Molecular Weight 48821.3
Enzyme 45 Theoretical pI 8.73
Enzyme 45 GO Classification
Function
Process
Component
Enzyme 45 General Function Amino acid transport and metabolism
Enzyme 45 Specific Function Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities
Enzyme 45 Pathways Not Available
Enzyme 45 Reactions Not Available
Enzyme 45 Pfam Domain Function
Enzyme 45 Signals
  • 1-22
Enzyme 45 Transmembrane Regions
  • None
Enzyme 45 Essentiality Not Available
Enzyme 45 GenBank ID Protein 86826319 Link Image
Enzyme 45 UniProtKB/Swiss-Prot ID Q2KIG3 Link Image
Enzyme 45 UniProtKB/Swiss-Prot Entry Name CBPB2_BOVIN Link Image
Enzyme 45 PDB ID Not Available
Enzyme 45 Cellular Location Not Available
Enzyme 45 Gene Sequence >1272 bp
ATGAAGCTTTATAGCTTGGGAGTCCTTGTCGCCACCGTCCTGTTCTGTGGGGAGCATGCC
TTCGCCTTTCAGAGGGGCCAGGTTTTATCTGCTCTTCCTAGAACCTCCAGGCAAGTTCAA
ATTCTGCAGAATGTTACTACAACATACAAGATTGTTCTCTGGCAGCCAGTAGCAGCTGAA
TATATTGTGAAGGGATACGAAGTCCATTTTTTTGTGAATGCATCTGATGTAAGCAATGTG
AAAGCCCATTTAAATGCGAGCAGAATTCCATTCAGGGTCCTGGTGGAAAATGTGGAAGAT
CTTATCCGGCAGCAGACTTCCAATGACACCATCAGCCCCCGGGCATCCTCCTCCTACTAT
GAACAGTATCACTCACTAAATGAGATCTATTCTTGGATAGAAGTTATGACTGAGCGGTAT
CCTGATATGGTTGAAAAAATCCACATTGGATCCTCATACGAGAAGTACCCACTTTATGTT
TTAAAGGTTTCTAAAAAAGAACAAAGGGCCAAAAATGCCATGTGGATTGACTGTGGAATC
CACGCCAGAGAGTGGATCTCTCCTGCTTTCTGCTTGTGGTTCGTGGGCTCTGTAACTTAT
TACTACGGGAAAGAAAAGATGCATACCAATCTTCTGAAGCACATGGATTTCTATATTATG
CCAGTGGTTAATGTGGATGGTTATGACTACACATGGAAAAAGGATCGAATGTGGAGAAAG
AATCGTTCTTTACATGAAAAAAATGCTTGTGTCGGAACAGACCTGAACAGGAACTTTGCC
TCCAAACACTGGTGTGGAGAGGGTGCCTCAAGTTCCTCGTGCTCAGAAATCTACTGTGGA
ACTTACCCTGAGTCGGAACCAGAAGTGAAGGCGGTGGCTGATTTCTTGAGAAGAAATATC
AAGCACATTAAAGCTTACATCAGCATGCATTCCTACTCCCAGAAGATAGTGTTTCCATAT
TCCTACAGCCGAAGCAGAAGCAAAGACCACGAGGAGCTGTCTCTAGTGGCCAGAGAAGCA
GTCTTCGCTATGGAGAATATTCATAGAAATATCAGATACACACATGGCAGTGGTTCAGAA
AGTTTATATTTAGCTCCTGGAGGTTCAGACGACTGGATCTATGACTTGGGCATCAAATAT
TCGTTTACATTTGAACTTCGAGATAAAGGCAAATATGGATTCTTGCTGCCAGAGAGTTAC
ATCAGACCCACGTGTTCAGAAGCTCTAGTTGCTGTCGCTAAAATAGCTTCGCATGTCGTC
AAGAATGTTTAA
Enzyme 45 GenBank Gene ID BC112649 Link Image
Enzyme 45 GeneCard ID CPB2 Link Image
Enzyme 45 GenAtlas ID Not Available
Enzyme 45 HGNC ID Not Available
Enzyme 45 Chromosome Location Chromosome:1
Enzyme 45 Locus 13q14.11
Enzyme 45 SNPs SNPJam Report Link Image
Enzyme 45 General References Not Available
Enzyme 45 Metabolite References Not Available
Enzyme 46 [top]
Enzyme 46 ID 1056
Enzyme 46 Name Probable C->U-editing enzyme APOBEC-2
Enzyme 46 Synonyms Not Available
Enzyme 46 Gene Name APOBEC2
Enzyme 46 Protein Sequence >U-editing enzyme APOBEC-2
MAQKEEAAAAAEPASQNGEEVENLEDPEKLKELIELPPFEIVTGERLPAHYFKFQFRNVE
YSSGRNKTFLCYVVEAQSKGGQVQASRGYLEDEHATNHAEEAFFNSIMPTFDPALRYMVT
WYVSSSPCAACADRIVKTLNKTKNLRLLILVGRLFMWEEPEIQAALRKLKEAGCRLRIMK
PQDFEYIWQNFVEQEEGESKAFEPWEDIQENFLYYEEKLADILK
Enzyme 46 Number of Residues 224
Enzyme 46 Molecular Weight 25962.2
Enzyme 46 Theoretical pI 4.53
Enzyme 46 GO Classification
Function
Process
Component
Enzyme 46 General Function Involved in hydrolase activity, acting on carbon-nitrog
Enzyme 46 Specific Function Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity
Enzyme 46 Pathways Not Available
Enzyme 46 Reactions Not Available
Enzyme 46 Pfam Domain Function
Enzyme 46 Signals
  • None
Enzyme 46 Transmembrane Regions
  • None
Enzyme 46 Essentiality Not Available
Enzyme 46 GenBank ID Protein 82754697 Link Image
Enzyme 46 UniProtKB/Swiss-Prot ID Q3SYR3 Link Image
Enzyme 46 UniProtKB/Swiss-Prot Entry Name ABEC2_BOVIN Link Image
Enzyme 46 PDB ID Not Available
Enzyme 46 Cellular Location Not Available
Enzyme 46 Gene Sequence >675 bp
ATGGCTCAGAAAGAAGAGGCCGCGGCGGCGGCGGAGCCCGCCTCCCAGAATGGCGAGGAG
GTGGAGAACCTAGAGGACCCCGAAAAGCTGAAGGAGCTGATTGAGCTGCCGCCCTTTGAG
ATCGTCACTGGGGAGCGACTGCCTGCCCACTACTTTAAGTTTCAGTTCCGGAATGTGGAG
TACAGCTCCGGCAGGAACAAGACCTTCCTCTGCTATGTGGTGGAAGCGCAGAGCAAGGGA
GGCCAAGTGCAGGCCTCTCGGGGGTACCTGGAGGATGAGCACGCCACTAACCACGCGGAG
GAAGCCTTCTTCAACAGCATCATGCCGACCTTCGACCCCGCCCTGCGCTACATGGTCACC
TGGTACGTGTCCTCCAGTCCCTGCGCGGCCTGCGCGGACCGCATCGTCAAGACCCTCAAT
AAGACCAAGAACCTGCGCCTGCTCATCCTGGTGGGGCGGCTGTTCATGTGGGAAGAGCCT
GAGATACAGGCCGCTCTCAGGAAGCTGAAGGAAGCCGGCTGCAGACTTCGCATCATGAAG
CCCCAGGACTTCGAGTACATCTGGCAGAATTTCGTGGAGCAAGAAGAGGGTGAATCCAAG
GCCTTTGAGCCCTGGGAGGACATTCAGGAGAACTTCCTGTACTATGAGGAGAAGTTGGCG
GACATCCTGAAGTAG
Enzyme 46 GenBank Gene ID DQ280381 Link Image
Enzyme 46 GeneCard ID APOBEC2 Link Image
Enzyme 46 GenAtlas ID Not Available
Enzyme 46 HGNC ID Not Available
Enzyme 46 Chromosome Location Chromosome:6
Enzyme 46 Locus 6p21
Enzyme 46 SNPs SNPJam Report Link Image
Enzyme 46 General References Not Available
Enzyme 46 Metabolite References Not Available
Enzyme 47 [top]
Enzyme 47 ID 1057
Enzyme 47 Name Betaine--homocysteine S-methyltransferase 1
Enzyme 47 Synonyms Not Available
Enzyme 47 Gene Name BHMT
Enzyme 47 Protein Sequence >Betaine--homocysteine S-methyltransferase 1
MAPAGGKNVKKGILERLNSGEVIIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFQQQLEVFVKKNVDFLIAEYFEHVEEAVWAVEALKASGKP
VAATMCIGPEGDLHSVTPGECAVRLVKAGASIVGVNCHFDPTISLQTVKLMKEGLEAAGL
KAHLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPLASEKHGSWGSGLDMHTKPWIRARARKEYWENLQIASG
RPYNPSMSKPDAWGVTKGTAELMQQKEATTEQQLRELFEKQKFKSAQ
Enzyme 47 Number of Residues 407
Enzyme 47 Molecular Weight 44877.9
Enzyme 47 Theoretical pI 6.84
Enzyme 47 GO Classification
Function
Process
Component
Enzyme 47 General Function Amino acid transport and metabolism
Enzyme 47 Specific Function Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline
Enzyme 47 Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via de novo pathway
  • L-methionine from L-homocysteine (BhmT route):step 1/1
Enzyme 47 Reactions Not Available
Enzyme 47 Pfam Domain Function
Enzyme 47 Signals
  • None
Enzyme 47 Transmembrane Regions
  • None
Enzyme 47 Essentiality Not Available
Enzyme 47 GenBank ID Protein 57222553 Link Image
Enzyme 47 UniProtKB/Swiss-Prot ID Q5I597 Link Image
Enzyme 47 UniProtKB/Swiss-Prot Entry Name BHMT1_BOVIN Link Image
Enzyme 47 PDB ID 1UMY Link Image
Enzyme 47 PDB File Show
Enzyme 47 3D Structure
Enzyme 47 Cellular Location Not Available
Enzyme 47 Gene Sequence >1224 bp
ATGGCACCGGCTGGGGGCAAAAATGTCAAGAAGGGCATCCTAGAACGGCTAAACTCTGGA
GAGGTCATCATCGGAGACGGAGGGTTTGTCTTTGCGCTGGAGAAGAGGGGCTACGTGAAG
GCAGGGCCCTGGACCCCAGAAGCTGCTGTGGAACACCCAGAAGCAGTTCGCCAACTTCAT
CGAGAGTTCCTCAGAGCTGGCTCGAATGTCATGCAGACCTTCACCTTCTATGCCAGTGAA
GACAAGCTGGAGAACAGGGGGAACTATGTTGCAGAGAAAATATCCGGGCAGAAAGTCAAT
GAAGCCGCTTGTGACATTGCCCGGCAAGTGGCTGATGAAGGAGATGCTTTGGTAGCAGGG
GGTGTGAGCCAGACACCTTCGTACCTTAGCTGCAAGAGCGAAACTGAAGTCAAAAAAGTC
TTTCAGCAACAGTTAGAGGTCTTCGTAAAGAAGAACGTGGACTTCTTGATCGCAGAGTAT
TTTGAACATGTTGAAGAGGCTGTATGGGCAGTTGAAGCCTTGAAAGCATCAGGGAAACCA
GTGGCGGCAACTATGTGCATCGGCCCAGAGGGAGACTTGCACAGCGTGACCCCTGGCGAG
TGTGCAGTGCGCCTGGTTAAAGCAGGAGCTTCCATCGTGGGGGTAAACTGCCATTTTGAC
CCCACAATTAGCTTACAGACAGTGAAGCTCATGAAAGAAGGCTTGGAGGCTGCCGGACTG
AAAGCCCACCTCATGAGCCAGCCCTTGGCCTACCACACTCCTGACTGCGGCAAGCAGGGG
TTTATTGACCTGCCAGAATTCCCCTTTGGACTGGAACCCAGAGTTGCAACCAGATGGGAT
ATTCAAAAGTATGCCAGAGAGGCCTACAACCTGGGGGTCAGGTACATAGGTGGGTGCTGT
GGATTTGAACCCTACCACATCAGGGCAATTGCAGAGGAGCTGGCTCCGGAGAGGGGATTT
TTGCCACTGGCTTCAGAAAAACATGGCAGCTGGGGAAGTGGTTTGGATATGCACACCAAA
CCCTGGATTAGAGCCAGGGCCAGGAAGGAATACTGGGAGAATCTTCAGATAGCCTCGGGC
AGGCCGTACAACCCTTCCATGTCAAAGCCGGACGCCTGGGGAGTGACCAAAGGAACAGCC
GAGCTTATGCAGCAGAAGGAAGCCACAACGGAGCAGCAGCTGAGAGAGCTCTTCGAAAAA
CAGAAGTTCAAGTCTGCACAGTAG
Enzyme 47 GenBank Gene ID AY854632 Link Image
Enzyme 47 GeneCard ID BHMT Link Image
Enzyme 47 GenAtlas ID Not Available
Enzyme 47 HGNC ID Not Available
Enzyme 47 Chromosome Location Chromosome:5
Enzyme 47 Locus 5q13.1-q15
Enzyme 47 SNPs SNPJam Report Link Image
Enzyme 47 General References Not Available
Enzyme 47 Metabolite References Not Available
Enzyme 48 [top]
Enzyme 48 ID 1058
Enzyme 48 Name Aminopeptidase N
Enzyme 48 Synonyms
  1. bAPN
  2. Alanyl aminopeptidase
  3. Microsomal aminopeptidase
  4. Aminopeptidase M
  5. CD13 antigen
Enzyme 48 Gene Name ANPEP
Enzyme 48 Protein Sequence >Aminopeptidase N
MAKGFYISKALGILAILLGVAAVATIIALSVVYAQEKNKNAERGTAAPTSPTGPTTTSAT
TLDQSKPWNRYRLPTTLLPDSYRVTLRPYLTPNNNGLYIFTGSSTVRFTCKEPTDVIIIH
SKKLNYTQHSGHLAALKGVGDTQAPEIDRTELVLLTEYLVVHLKSSLEAGKTYEMETTFQ
GELADDLAGFYRSEYMDGNVKKVLATTQMQSTDARKSFPCFDEPAMKATFNITLIHPKDL
TALSNMPPKGPSVPFDGDSNWSVTEFETTPVMSTYLLAYIVSEFTSVESVAPNDVQIRIW
ARPKATADNHGLYALNVTGPILNFFANHYNTAYPLPKSDQIALPDFNAGAMENWGLVTYR
ENALLYDPQSSSSSNKERVVTVIAHELAHQWFGNLVTLAWWNDLWLNEGFASYVEYLGAD
YAEPTWNLKDLMVPNDVYSVMAVDALVTSHPLTTPANEVNTPAQISEMFDTISYSKGASV
IRMLSNFLTEDLFKKGLASYLQTFAYQNTTYLNLWEHLQMAVENQLSIRLPDTVSAIMDR
WTLQMGFPVITVDTNTGTISQKHFLLDPNSTVTRPSQFNYLWIVPISSIRNGQPQEHYWL
RGEERNQNELFKAAADDWVLLNINVTGYYQVNYDENNWKKIQNQLMSRRENIPVINRAQV
IYDSFNLASAHMVPVTLALNNTLFLKNEMEYMPWQAAVSSLNYFKLMFDRTEVYGPMQNY
LKNQVEPIFLYFENLTKNWTEIPENLMDQYSEINAISTACSNGLPKCEELAKTLFNQWMN
NPNVNPIDPNLRSTIYCNAIAQGGQEEWDFAWNQLQQAELVNEADKLRSALACTNHVWLL
NRYLSYTLNPDLIRKQDATSTITSIASNVIGQSLAWDFIRSNWKKLFEDYGGGSFSFSNL
IQGVTRRFSTEFELQQLEEFKENNMDVGFGSGTRALEQALEKTKANINWVKENKEVVLNW
FKDHS
Enzyme 48 Number of Residues 965
Enzyme 48 Molecular Weight 109275.6
Enzyme 48 Theoretical pI 4.97
Enzyme 48 GO Classification
Function
Process
Component
Enzyme 48 General Function Amino acid transport and metabolism
Enzyme 48 Specific Function Broad specificity aminopeptidase. Plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May be involved in the metabolism of regulatory peptides of diverse cell types and in the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis. May serve as a receptor for bovine coronavirus (BCV) in a species-specific manner
Enzyme 48 Pathways Not Available
Enzyme 48 Reactions Not Available
Enzyme 48 Pfam Domain Function
Enzyme 48 Signals
  • None
Enzyme 48 Transmembrane Regions
  • 9-32
Enzyme 48 Essentiality Not Available
Enzyme 48 GenBank ID Protein 75947603 Link Image
Enzyme 48 UniProtKB/Swiss-Prot ID P79098 Link Image
Enzyme 48 UniProtKB/Swiss-Prot Entry Name AMPN_BOVIN Link Image
Enzyme 48 PDB ID Not Available
Enzyme 48 Cellular Location Not Available
Enzyme 48 Gene Sequence >2898 bp
ATGGCCAAAGGATTCTACATTTCCAAGGCCCTGGGCATCCTGGCCATTCTCCTGGGCGTG
GCGGCCGTGGCCACCATCATCGCTCTGTCTGTGGTGTACGCCCAGGAGAAGAACAAGAAT
GCCGAGCGTGGCACCGCGGCCCCCACGAGCCCCACAGGCCCGACAACCACCTCGGCCACC
ACCTTGGACCAGAGCAAGCCGTGGAACCGATACCGCCTCCCCACGACCCTCTTGCCCGAC
TCCTATAGGGTGACGCTGAGGCCCTACCTCACTCCCAACAATAACGGCCTGTATATCTTC
ACGGGCTCAAGCACTGTCCGCTTCACCTGCAAGGAGCCCACGGACGTCATCATCATCCAC
AGCAAGAAGCTCAACTACACCCAGCACAGTGGGCACTTGGCGGCCCTGAAGGGTGTGGGG
GACACCCAGGCCCCCGAAATCGACAGGACCGAGCTGGTGTTGCTCACAGAGTACCTGGTG
GTGCACCTCAAGAGCTCCCTGGAAGCAGGCAAGACATACGAGATGGAGACCACCTTTCAG
GGGGAGCTGGCCGATGACCTGGCGGGCTTCTACCGCAGCGAGTACATGGACGGCAACGTC
AAAAAGGTCCTGGCCACCACACAGATGCAGTCAACAGATGCCCGGAAGTCCTTCCCCTGC
TTTGACGAGCCCGCCATGAAGGCCACATTTAACATCACCCTCATCCACCCCAAGGATCTC
ACAGCCCTGTCCAACATGCCACCCAAAGGTCCCAGTGTCCCGTTTGACGGAGATTCCAAC
TGGAGCGTCACTGAGTTTGAAACCACGCCGGTAATGTCCACGTACCTCCTGGCCTACATC
GTGAGCGAGTTCACGAGTGTGGAGTCAGTGGCTCCCAATGATGTCCAGATCCGGATCTGG
GCTCGGCCAAAAGCAACTGCAGACAACCATGGCCTTTACGCCCTGAATGTGACAGGTCCC
ATCCTGAACTTCTTTGCCAATCATTACAATACAGCCTACCCACTCCCCAAATCTGACCAG
ATTGCCCTGCCCGACTTCAACGCCGGTGCCATGGAGAACTGGGGGCTGGTGACCTACCGG
GAGAACGCGCTGCTCTATGACCCTCAGTCTTCCTCCAGCAGCAACAAAGAGCGAGTAGTC
ACTGTGATTGCTCATGAGCTGGCCCACCAGTGGTTTGGGAACCTGGTGACCCTGGCCTGG
TGGAATGACCTGTGGCTGAACGAGGGCTTTGCCTCCTATGTGGAGTACCTGGGAGCTGAC
TATGCAGAGCCCACCTGGAATCTGAAAGACCTCATGGTGCCGAATGACGTGTACAGTGTG
ATGGCCGTGGACGCGCTGGTCACCTCTCACCCACTGACCACCCCTGCCAACGAGGTCAAC
ACCCCTGCCCAGATCAGCGAGATGTTCGATACCATCTCCTACAGCAAGGGAGCCTCGGTC
ATCCGGATGCTCTCGAATTTCCTGACTGAGGACCTGTTCAAGAAGGGCCTGGCGTCCTAC
TTGCAGACCTTTGCCTATCAGAACACCACCTACCTGAACCTGTGGGAGCACCTGCAGATG
GCTGTGGAAAATCAGTTGTCCATCAGGCTGCCAGACACCGTGAGTGCCATCATGGACCGC
TGGACCCTACAGATGGGCTTCCCTGTCATCACCGTGGATACTAACACAGGGACCATCTCC
CAGAAGCACTTCCTCCTTGATCCCAACTCCACCGTCACCCGCCCCTCACAGTTCAACTAT
CTGTGGATTGTTCCCATCTCATCCATCAGAAATGGCCAGCCGCAAGAACACTACTGGCTT
CGGGGCGAAGAGAGAAACCAGAATGAACTCTTCAAAGCCGCAGCAGACGACTGGGTCCTG
CTGAACATCAACGTGACGGGCTATTACCAGGTGAACTACGACGAGAACAACTGGAAGAAG
ATTCAGAATCAGCTGATGTCAAGGCGGGAGAACATCCCTGTCATCAACCGGGCACAGGTC
ATCTACGACAGCTTCAACCTGGCCAGTGCCCACATGGTCCCTGTCACCCTGGCGCTGAAC
AACACCCTCTTCCTGAAAAATGAGATGGAGTACATGCCCTGGCAGGCCGCCGTGAGCAGC
CTGAACTACTTCAAGCTCATGTTCGACCGCACAGAGGTCTATGGCCCCATGCAGAATTAC
CTCAAGAACCAGGTTGAACCCATCTTCCTATATTTTGAAAATCTCACCAAAAACTGGACT
GAGATCCCGGAAAACCTGATGGACCAATACAGCGAGATTAACGCCATCAGCACTGCCTGC
TCCAATGGGTTGCCTAAGTGTGAGGAGCTGGCCAAAACACTTTTCAACCAGTGGATGAAT
AACCCTAACGTTAACCCGATCGACCCCAACCTGCGGTCCACCATCTACTGCAACGCCATC
GCCCAGGGTGGCCAGGAAGAGTGGGACTTTGCTTGGAATCAGTTACAACAAGCAGAGCTG
GTTAATGAAGCTGACAAACTCCGCTCAGCGCTGGCCTGCACCAACCACGTCTGGCTCCTG
AACAGGTACCTGAGTTACACCCTGAACCCCGACCTCATCCGGAAGCAGGACGCCACCTCC
ACCATTACCAGCATTGCCAGCAATGTCATCGGGCAGTCTCTGGCCTGGGACTTCATCCGG
AGCAACTGGAAGAAACTCTTTGAGGATTATGGTGGTGGTTCCTTTTCCTTCTCCAACCTC
ATCCAGGGTGTGACCCGAAGATTCTCCACTGAGTTTGAGCTCCAGCAGCTGGAGGAGTTC
AAGGAGAACAACATGGACGTCGGCTTCGGCTCAGGAACACGGGCTCTGGAGCAAGCCCTG
GAGAAGACTAAAGCCAACATCAACTGGGTGAAGGAGAACAAGGAGGTGGTGCTAAACTGG
TTCAAAGACCACAGCTAA
Enzyme 48 GenBank Gene ID BC105142 Link Image
Enzyme 48 GeneCard ID ANPEP Link Image
Enzyme 48 GenAtlas ID Not Available
Enzyme 48 HGNC ID Not Available
Enzyme 48 Chromosome Location Chromosome:1
Enzyme 48 Locus 15q25-q26
Enzyme 48 SNPs SNPJam Report Link Image
Enzyme 48 General References
  1. [PubMed Link Image]
Enzyme 48 Metabolite References Not Available
Enzyme 49 [top]
Enzyme 49 ID 1059
Enzyme 49 Name Aprataxin
Enzyme 49 Synonyms
  1. Forkhead-associated domain histidine triad-like protein
  2. FHA-HIT
Enzyme 49 Gene Name APTX
Enzyme 49 Protein Sequence >Aprataxin
MSNVSLSASAVSRVMMRVCWLVRQDNRHQRIKLPHLETVMVGRSPETKIADKKCSRQQVQ
LKAECNKGYVKVKQVGVNPTSIDSVIIGKDQEVKLQPGQVLYLVNELYPYIIEFEEETKS
PGLESHRKRKRSGSSDPTERGADPEAEPSTGLEPGSNPHQCSVPPKKEKDASIKKESLGH
WSQGLKISMEDPKMQVYKDEQVVVIKDKYPKARFHWLVLPWASISSLKAVTREHLELLRH
MHAVGEKVIADFAGSSKFRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEY
FLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWSK
Enzyme 49 Number of Residues 356
Enzyme 49 Molecular Weight 40658.7
Enzyme 49 Theoretical pI 9.67
Enzyme 49 GO Classification
Function
Process
Component
Enzyme 49 General Function Nucleotide transport and metabolism
Enzyme 49 Specific Function DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non- ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined. Also able to hydrolyze adenosine 5'- monophosphoramidate (AMP-NH2) and diadenosine tetraphosphate (AppppA), but with lower catalytic activity
Enzyme 49 Pathways Not Available
Enzyme 49 Reactions Not Available
Enzyme 49 Pfam Domain Function
Enzyme 49 Signals
  • None
Enzyme 49 Transmembrane Regions
  • None
Enzyme 49 Essentiality Not Available
Enzyme 49 GenBank ID Protein 32394380 Link Image
Enzyme 49 UniProtKB/Swiss-Prot ID Q7YRZ2 Link Image
Enzyme 49 UniProtKB/Swiss-Prot Entry Name APTX_BOVIN Link Image
Enzyme 49 PDB ID Not Available
Enzyme 49 Cellular Location Not Available
Enzyme 49 Gene Sequence >1071 bp
ATGAGTAACGTGAGCTTGTCGGCCTCAGCCGTCTCGAGAGTAATGATGCGGGTGTGCTGG
TTGGTGAGACAGGACAACCGGCACCAGCGAATCAAACTTCCACATTTGGAAACAGTCATG
GTTGGGCGCAGCCCAGAGACCAAGATCGCCGACAAGAAGTGTTCTCGACAGCAAGTACAG
TTGAAAGCAGAGTGTAACAAAGGATATGTCAAGGTAAAGCAGGTAGGGGTCAATCCCACC
AGCATTGACTCAGTCATAATTGGGAAGGACCAGGAGGTGAAGCTGCAGCCTGGCCAGGTC
CTCTACCTGGTGAATGAACTTTATCCGTATATTATAGAGTTTGAGGAAGAGACAAAGAGC
CCTGGCCTGGAGTCACACAGGAAGAGAAAGAGGTCAGGCAGTAGCGATCCTACAGAAAGG
GGTGCTGACCCGGAAGCTGAGCCCAGCACAGGACTGGAACCTGGGAGCAACCCTCACCAG
TGCTCTGTGCCTCCAAAGAAGGAGAAGGATGCATCCATCAAAAAGGAATCCTTGGGCCAC
TGGAGTCAAGGCTTGAAGATTTCTATGGAGGACCCCAAAATGCAGGTTTACAAAGATGAG
CAGGTGGTGGTGATAAAGGATAAATACCCCAAGGCTCGTTTCCACTGGCTGGTCTTACCT
TGGGCCTCCATTTCCAGTCTGAAGGCTGTGACCAGAGAACATCTTGAGCTCCTCAGACAC
ATGCACGCTGTTGGAGAGAAAGTGATTGCTGACTTCGCTGGGTCCAGCAAATTCCGCTTC
CGATTGGGCTACCATGCCATTCCCAGCATGAGCCATGTACACCTCCATGTGATCAGCCAG
GATTTTGATTCTCCTTGCCTTAAAAACAAAAAACACTGGAATTCTTTCAATACTGAGTAC
TTCCTTGAATCACAAGCTGTGATTGAGATGGTGCAAGAGGCTGGCAGGGTGACCGTCCGA
GACGGGATGCCCGAGCTCCTGAAGCTGCCCCTCCGTTGTCACGAGTGCCAGCAGCTGCTG
CCTTCCATCCCTCAGCTGAAGGAGCACCTCAGGAAGCACTGGTCCAAGTGA
Enzyme 49 GenBank Gene ID AY040778 Link Image
Enzyme 49 GeneCard ID APTX Link Image
Enzyme 49 GenAtlas ID Not Available
Enzyme 49 HGNC ID Not Available
Enzyme 49 Chromosome Location Chromosome:9
Enzyme 49 Locus 9p13.3
Enzyme 49 SNPs SNPJam Report Link Image
Enzyme 49 General References Not Available
Enzyme 49 Metabolite References Not Available
Enzyme 50 [top]
Enzyme 50 ID 1060
Enzyme 50 Name Carbonic anhydrase 2
Enzyme 50 Synonyms
  1. Carbonic anhydrase II
  2. CA-II
  3. Carbonate dehydratase II
Enzyme 50 Gene Name CA2
Enzyme 50 Protein Sequence >Carbonic anhydrase 2
MSHHWGYGKHNGPEHWHKDFPIANGERQSPVDIDTKAVVQDPALKPLALVYGEATSRRMV
NNGHSFNVEYDDSQDKAVLKDGPLTGTYRLVQFHFHWGSSDDQGSEHTVDRKKYAAELHL
VHWNTKYGDFGTAAQQPDGLAVVGVFLKVGDANPALQKVLDALDSIKTKGKSTDFPNFDP
GSLLPNVLDYWTYPGSLTTPPLLESVTWIVLKEPISVSSQQMLKFRTLNFNAEGEPELLM
LANWRPAQPLKNRQVRGFPK
Enzyme 50 Number of Residues 260
Enzyme 50 Molecular Weight 29113.6
Enzyme 50 Theoretical pI 6.93
Enzyme 50 GO Classification
Function
Process
Component
Enzyme 50 General Function Inorganic ion transport and metabolism
Enzyme 50 Specific Function Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide
Enzyme 50 Pathways Not Available
Enzyme 50 Reactions Not Available
Enzyme 50 Pfam Domain Function
Enzyme 50 Signals
  • None
Enzyme 50 Transmembrane Regions
  • None
Enzyme 50 Essentiality Not Available
Enzyme 50 GenBank ID Protein 29570106 Link Image
Enzyme 50 UniProtKB/Swiss-Prot ID P00921 Link Image
Enzyme 50 UniProtKB/Swiss-Prot Entry Name CAH2_BOVIN Link Image
Enzyme 50 PDB ID 1V9E Link Image
Enzyme 50 PDB File Show
Enzyme 50 3D Structure
Enzyme 50 Cellular Location Not Available
Enzyme 50 Gene Sequence >783 bp
ATGTCCCATCACTGGGGATACGGCAAGCACAACGGCCCCGAACACTGGCATAAGGACTTT
CCCATTGCCAACGGAGAGCGCCAGTCACCCGTTGACATCGACACCAAGGCCGTCGTTCAG
GATCCTGCTTTGAAGCCTCTGGCCCTTGTCTATGGGGAAGCAACTTCGCGGAGAATGGTC
AACAATGGTCACTCTTTTAACGTGGAGTATGACGACTCCCAGGACAAAGCAGTGCTGAAA
GATGGACCTCTTACTGGCACTTACAGATTGGTTCAGTTTCACTTTCACTGGGGCTCATCT
GATGACCAAGGTTCTGAGCATACTGTGGATAGGAAGAAATATGCTGCCGAGCTACACCTG
GTTCACTGGAACACCAAGTACGGGGACTTTGGAACAGCAGCACAGCAGCCTGATGGACTG
GCTGTTGTGGGTGTTTTTTTGAAGGTTGGTGATGCTAACCCAGCCCTCCAGAAAGTCCTT
GACGCGCTGGATTCTATTAAAACAAAGGGTAAGAGCACCGACTTCCCCAACTTCGATCCG
GGCAGCCTCCTTCCTAACGTCTTGGACTACTGGACCTACCCTGGCTCACTGACCACCCCT
CCTCTCCTCGAAAGCGTGACCTGGATCGTGCTCAAAGAACCCATCTCTGTTAGCAGTCAG
CAGATGTTGAAATTCCGTACTCTTAACTTCAACGCGGAGGGCGAGCCTGAACTCCTGATG
TTGGCCAACTGGCGTCCGGCTCAGCCGCTGAAAAACAGACAAGTCAGAGGTTTCCCCAAA
TAA
Enzyme 50 GenBank Gene ID AY240020 Link Image
Enzyme 50 GeneCard ID CA2 Link Image
Enzyme 50 GenAtlas ID Not Available
Enzyme 50 HGNC ID Not Available
Enzyme 50 Chromosome Location Chromosome:8
Enzyme 50 Locus 8q22
Enzyme 50 SNPs SNPJam Report Link Image
Enzyme 50 General References
  1. [PubMed Link Image]
Enzyme 50 Metabolite References Not Available
Enzyme 51 [top]
Enzyme 51 ID 1061
Enzyme 51 Name tRNA-specific adenosine deaminase 2
Enzyme 51 Synonyms
  1. tRNA-specific adenosine-34 deaminase subunit ADAT2
  2. Deaminase domain-containing protein 1
Enzyme 51 Gene Name DEADC1
Enzyme 51 Protein Sequence >tRNA-specific adenosine deaminase 2
MEAKAGPTAATDGAYSVSAEETEKWMEQAMQMAKDALDNTEVPVGCLMVYNNEVVGKGRN
EVNQTKNATRHAEMVAIDQALDWCRRRGRSPSEVFEHTVLYVTVEPCIMCAAALRLMRIP
LVVYGCQNERFGGCGSVLDIASADLPSTGKPFQCTPGYRAEEAVEMLKTFYKQENPNAPK
SKVRKKECHKS
Enzyme 51 Number of Residues 191
Enzyme 51 Molecular Weight 21127.0
Enzyme 51 Theoretical pI 6.74
Enzyme 51 GO Classification
Function
Process
Component
Enzyme 51 General Function Nucleotide transport and metabolism
Enzyme 51 Specific Function Probably participates in deamination of adenosine-34 to inosine in many tRNAs
Enzyme 51 Pathways Not Available
Enzyme 51 Reactions Not Available
Enzyme 51 Pfam Domain Function
Enzyme 51 Signals
  • None
Enzyme 51 Transmembrane Regions
  • None
Enzyme 51 Essentiality Not Available
Enzyme 51 GenBank ID Protein 59858211 Link Image
Enzyme 51 UniProtKB/Swiss-Prot ID Q5E9J7 Link Image
Enzyme 51 UniProtKB/Swiss-Prot Entry Name ADAT2_BOVIN Link Image
Enzyme 51 PDB ID Not Available
Enzyme 51 Cellular Location Not Available
Enzyme 51 Gene Sequence >576 bp
ATGGAGGCGAAGGCAGGGCCCACCGCGGCTACCGATGGCGCATACTCGGTGTCTGCGGAG
GAGACCGAAAAGTGGATGGAGCAGGCGATGCAAATGGCCAAAGACGCCCTAGACAATACT
GAAGTTCCTGTTGGCTGCCTTATGGTCTACAACAATGAAGTTGTGGGCAAGGGGAGAAAT
GAAGTTAATCAAACCAAAAATGCTACTCGACATGCAGAAATGGTGGCCATTGACCAGGCC
CTAGACTGGTGCCGTCGCCGCGGCAGGAGTCCTTCTGAAGTGTTTGAACACACTGTGCTG
TACGTCACCGTGGAGCCCTGTATCATGTGTGCAGCTGCTCTCCGCCTGATGAGAATCCCA
CTGGTTGTCTATGGCTGCCAGAATGAAAGATTTGGTGGTTGTGGCTCTGTTCTGGATATT
GCCTCTGCTGATCTACCGAGTACTGGGAAACCATTTCAGTGCACCCCTGGATATCGGGCT
GAGGAGGCAGTGGAGATGTTAAAGACCTTCTACAAACAAGAAAATCCAAATGCACCAAAA
TCAAAGGTTCGAAAAAAGGAATGTCACAAATCCTGA
Enzyme 51 GenBank Gene ID BT020923 Link Image
Enzyme 51 GeneCard ID DEADC1 Link Image
Enzyme 51 GenAtlas ID Not Available
Enzyme 51 HGNC ID Not Available
Enzyme 51 Chromosome Location Chromosome:6
Enzyme 51 Locus 6q24.2
Enzyme 51 SNPs SNPJam Report Link Image
Enzyme 51 General References
  1. [PubMed Link Image]
Enzyme 51 Metabolite References Not Available
Enzyme 52 [top]
Enzyme 52 ID 1062
Enzyme 52 Name Carbonic anhydrase 3
Enzyme 52 Synonyms
  1. Carbonic anhydrase III
  2. CA-III
  3. Carbonate dehydratase III
Enzyme 52 Gene Name CA3
Enzyme 52 Protein Sequence >Carbonic anhydrase 3
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Enzyme 52 Number of Residues 260
Enzyme 52 Molecular Weight 29370.0
Enzyme 52 Theoretical pI 7.96
Enzyme 52 GO Classification
Function
Process
Component
Enzyme 52 General Function Inorganic ion transport and metabolism
Enzyme 52 Specific Function Reversible hydration of carbon dioxide
Enzyme 52 Pathways Not Available
Enzyme 52 Reactions Not Available
Enzyme 52 Pfam Domain Function
Enzyme 52 Signals
  • None
Enzyme 52 Transmembrane Regions
  • None
Enzyme 52 Essentiality Not Available
Enzyme 52 GenBank ID Protein 74268078 Link Image
Enzyme 52 UniProtKB/Swiss-Prot ID Q3SZX4 Link Image
Enzyme 52 UniProtKB/Swiss-Prot Entry Name CAH3_BOVIN Link Image
Enzyme 52 PDB ID 1FLJ Link Image
Enzyme 52 PDB File Show
Enzyme 52 3D Structure
Enzyme 52 Cellular Location Not Available
Enzyme 52 Gene Sequence >783 bp
ATGGCCAAGGAGTGGGGCTACGCCGACCACAACGGTCCTGACCATTGGCATGAACTTTTC
CCGAATGCCAAGGGAGAGAACCAGTCGCCCATTGAACTGAACACTAAAGAGATCAGCCAC
GACCCTTCCCTGAAGCCATGGACAGCATCCTATGACCCAGGCTCTGCCAAGACCATCCTA
AATAATGGGAAGACCTGCAGGGTTGTGTTTGATGATACTTATGACAGGTCAATGCTGAGA
GGTGGTCCCCTCGCCGCGCCATACCGGCTCCGCCAGTTCCACCTCCACTGGGGCTCCTCG
GACGATCACGGCTCGGAGCACAGCGTGGATGGAGTCAAGTACGCAGCAGAGCTCCATTTG
GTTCACTGGAATTCAAAGTATAACAGTTATGCAACTGCTCTGAAGCATGCCGATGGTATA
GCTGTGGTTGGGGTTTTTCTGAAGATAGGACGTGAGAAAGGCGAGTTCCAGCTTCTCCTT
GATGCACTGGACAAAATTAAGACGAAGGGCAAGGAGGCGCCCTTCAACAACTTCAACCCG
TCCTGCCTGTTCCCCGCCTGCCGGGACTACTGGACCTACCACGGCTCCTTTACCACGCCG
CCCTGCGAGGAGTGCATCGTGTGGCTGCTGCTGAAGGAGCCCATCACGGTCAGCTCCGAC
CAGATAGCCAAGCTGCGCACTCTGTACTCCAGCGCGGAGAACGAGCCCCCGGTGCCCCTG
GTGAGGAACTGGCGCCCTCCGCAGCCCATCAAGGGCAGGATCGTGAAGGCCTCCTTCAAG
TGA
Enzyme 52 GenBank Gene ID BC102666 Link Image
Enzyme 52 GeneCard ID CA3 Link Image
Enzyme 52 GenAtlas ID Not Available
Enzyme 52 HGNC ID Not Available
Enzyme 52 Chromosome Location Chromosome:8
Enzyme 52 Locus 8q13-q22
Enzyme 52 SNPs SNPJam Report Link Image
Enzyme 52 General References Not Available
Enzyme 52 Metabolite References Not Available
Enzyme 53 [top]
Enzyme 53 ID 1063
Enzyme 53 Name Protein kinase C, delta
Enzyme 53 Synonyms Not Available
Enzyme 53 Gene Name PRKCD
Enzyme 53 Protein Sequence >Protein kinase C, delta
MAPFLRISFNSYELGSLKAADEASQPFCAVKMKEALSTDRGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEGPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRGEDEAKFPTMNRRGAIKQAKIHYIRHHEFIATFFGQPTFCSVCREFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQMKVANLCGINQKLLAEALNQVSQRSVK
KETETQDTVGIYQNFEKKPGVSGDDLAGKETGTYGKIWESSTKCNIDNFTFIKVLGKGSF
GKVLLAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAGDHPFLTHLFCTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELSRATFYAAEIVCGLQFLHQKGIIYRDLKLDNVL
LDHSGHIKIADFGMCKENMSGDRQASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRLDSPYYPRWITKESKDILEKLLERDVSKRLGVTGNIKIH
PFFKTINWVLLEKRAVEPPFKPKVKSPGDFSNFDQEFLNEKPRLSYSDKNLIESMDQTAF
AGFSFVNPKFERLLEN
Enzyme 53 Number of Residues 676
Enzyme 53 Molecular Weight 77225.5
Enzyme 53 Theoretical pI 8.09
Enzyme 53 GO Classification
Function
Process
Component
Enzyme 53 General Function Involved in ATP binding
Enzyme 53 Specific Function ATP + a protein = ADP + a phosphoprotein
Enzyme 53 Pathways Not Available
Enzyme 53 Reactions Not Available
Enzyme 53 Pfam Domain Function
Enzyme 53 Signals
  • None
Enzyme 53 Transmembrane Regions
  • None
Enzyme 53 Essentiality Not Available
Enzyme 53 GenBank ID Protein 117306505 Link Image
Enzyme 53 UniProtKB/Swiss-Prot ID A0JN97 Link Image
Enzyme 53 UniProtKB/Swiss-Prot Entry Name A0JN97_BOVIN Link Image
Enzyme 53 PDB ID Not Available
Enzyme 53 Cellular Location Not Available
Enzyme 53 Gene Sequence >2031 bp
ATGGCACCGTTCCTGCGCATCTCCTTCAACTCCTACGAGCTGGGCTCCCTGAAGGCCGCG
GACGAGGCAAGCCAGCCCTTCTGTGCTGTGAAGATGAAGGAGGCTCTCAGCACAGATCGC
GGGAAGACGCTGGTGCAGAAGAAGCCCACCATGTACCCTGAGTGGAAGTCCACATTCGAT
GCTCACATCTACGAGGGCCGCGTTATCCAGATAGTGCTGATGCGAGCCGCCGAAGGGCCA
ATGTCGGAGGTGACGGTGGGTGTGTCAGTGCTAGCCGAGCGCTGCAAGAAGAACAATGGC
AAGGCCGAGTTCTGGCTGGACTTGCAACCCCAGGCCAAGGTGCTGATGTCGGTGCAGTAT
TTCCTGGAAGACGTAGATTGCAAGCAGTCTATGCGGGGTGAAGACGAGGCCAAGTTCCCA
ACAATGAACCGCCGTGGAGCTATCAAACAGGCCAAAATTCACTACATCAGGCACCACGAG
TTCATCGCCACCTTCTTTGGGCAGCCCACATTCTGCTCCGTGTGCAGAGAGTTTGTTTGG
GGTCTCAACAAGCAAGGCTACAAGTGCAGGCAATGTAATGCTGCCATCCACAAGAAATGC
ATCGACAAGATCATCGGCCGGTGTACAGGCACTGCGGCCAACAGTCGGGACACCATATTC
CAGAAAGAACGTTTCAACATTGACATGCCGCACCGGTTCAAGGTTTATAACTACATGAGC
CCCACCTTCTGTGACCACTGTGGCAGCCTGCTCTGGGGGCTGGTGAAGCAGGGATTAAAG
TGTGAAGACTGTGGCATGAACGTGCATCACAAGTGCCAGATGAAAGTGGCCAACCTCTGT
GGCATCAACCAGAAGCTCTTGGCCGAGGCCTTGAACCAAGTTAGCCAGAGATCTGTAAAG
AAGGAAACAGAGACCCAAGACACTGTTGGGATCTACCAGAATTTTGAGAAGAAGCCAGGA
GTCTCTGGAGATGATCTCGCAGGTAAAGAAACTGGGACCTACGGCAAGATCTGGGAGAGC
AGCACCAAGTGCAACATTGACAACTTCACCTTCATCAAGGTCCTGGGCAAAGGCAGCTTC
GGGAAGGTGCTGCTCGCAGAGCTGAAGGGCAAAAAGGAATTCTTCGCCATCAAGGCTCTC
AAGAAAGACGTGGTCTTGATCGATGACGACGTGGAGTGCACCATGGTGGAGAAGCGGGTG
CTGGCCCTCGCCGGGGATCATCCGTTTCTCACCCACCTCTTCTGCACCTTCCAGACCAAG
GACCACCTGTTCTTTGTGATGGAGTTCCTCAATGGGGGCGACCTGATGTACCACATCCAG
GACAAAGGCCGCTTCGAGCTCTCCCGTGCCACGTTTTACGCAGCTGAGATAGTCTGTGGA
CTACAGTTTCTGCACCAGAAAGGGATCATTTACAGGGACCTCAAGCTGGACAACGTGTTG
CTGGACCACAGTGGCCACATCAAGATTGCCGACTTCGGCATGTGCAAGGAGAACATGTCC
GGGGACAGACAGGCCAGCACCTTCTGCGGCACCCCTGACTACATCGCCCCCGAGATCCTG
CAGGGCCTGAAATACTCGTTCTCCGTGGACTGGTGGTCCTTCGGAGTCCTTCTCTATGAG
ATGCTCATTGGTCAGTCCCCCTTCCATGGTGATGATGAGGACGAACTCTTCGAGTCCATC
CGTTTAGACTCACCATACTATCCTCGCTGGATCACCAAGGAGTCCAAGGACATCCTGGAG
AAGCTGCTTGAACGGGATGTAAGCAAGAGGCTGGGAGTGACAGGGAACATCAAAATCCAC
CCCTTCTTCAAGACCATCAACTGGGTTCTGCTGGAGAAACGTGCAGTGGAGCCACCCTTC
AAGCCCAAAGTGAAGTCGCCTGGAGACTTCAGCAACTTCGACCAGGAGTTCCTGAATGAG
AAGCCGCGCCTCTCCTACAGCGACAAGAACCTCATCGAGTCCATGGACCAAACAGCATTT
GCTGGCTTCTCCTTCGTGAACCCCAAATTTGAGAGGCTCCTGGAAAACTGA
Enzyme 53 GenBank Gene ID BC126577 Link Image
Enzyme 53 GeneCard ID PRKCD Link Image
Enzyme 53 GenAtlas ID Not Available
Enzyme 53 HGNC ID Not Available
Enzyme 53 Chromosome Location Chromosome:3
Enzyme 53 Locus 3p21.31
Enzyme 53 SNPs SNPJam Report Link Image
Enzyme 53 General References Not Available
Enzyme 53 Metabolite References Not Available
Enzyme 54 [top]
Enzyme 54 ID 1064
Enzyme 54 Name Diacylglycerol kinase alpha
Enzyme 54 Synonyms
  1. DAG kinase alpha
  2. Diglyceride kinase alpha
  3. DGK-alpha
Enzyme 54 Gene Name DGKA
Enzyme 54 Protein Sequence >Diacylglycerol kinase alpha
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAEYLQGDAIGYEGFQQFLKIY
LEVDNVPDHLSQALFQSFQTGYYIEDTVREDVVCLSDVSCYFSLLEGGRPEDKLEFTFKL
YDTDRNGILDSSEVDRIIIQMMRMAEYLDWDVSELRPILQEMMKEIDYDGSGSVSLAEWL
RAGATTVPLLVLLGLEMTLKDNGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYI
VHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLVGLHCV
WCHLEIHDDCLPAMGHECDCGLLRDHILPPSSIYPSVLASGQERKTSKISQKTMDDLSLS
TSEALRIDPVSNTHPLLVFVNPKSGGKQGERVLWKFQYLLNPRQVFNLLKDGPEPGLRFF
RDVPDYRILVCGGDGTVGWILESIDKANLPFVPPVAVLPLGTGNDLARCLRWGGGYEGQN
LGKILKDLETSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMR
EKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLN
IPSTHGGSNLWGDTKRPHGDIHGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEG
AIEIGQIYTKLKNAGHRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHRNQMPMLV
GPPPRSSNFFGFLC
Enzyme 54 Number of Residues 734
Enzyme 54 Molecular Weight 82671.3
Enzyme 54 Theoretical pI 6.27
Enzyme 54 GO Classification
Function
Process
Component
Enzyme 54 General Function Involved in calcium ion binding
Enzyme 54 Specific Function Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity
Enzyme 54 Pathways Not Available
Enzyme 54 Reactions Not Available
Enzyme 54 Pfam Domain Function
Enzyme 54 Signals
  • None
Enzyme 54 Transmembrane Regions
  • None
Enzyme 54 Essentiality Not Available
Enzyme 54 GenBank ID Protein 117306586 Link Image
Enzyme 54 UniProtKB/Swiss-Prot ID A0JN54 Link Image
Enzyme 54 UniProtKB/Swiss-Prot Entry Name DGKA_BOVIN Link Image
Enzyme 54 PDB ID Not Available
Enzyme 54 Cellular Location Not Available
Enzyme 54 Gene Sequence >2205 bp
ATGGCCAAGGAGAGGGGCCTAATAAGCCCCAGTGATTTTGCCCAGCTGCAAAAATACATG
GAATACTCCACCAAAAAGGTCAGTGATGTTCTGAAGCTCTTTGAGGATGGTGAAATGGCT
GAATATCTCCAAGGAGATGCCATTGGATACGAGGGGTTCCAGCAATTCCTGAAAATCTAC
CTGGAGGTGGATAATGTTCCAGATCACCTAAGCCAGGCACTGTTTCAGTCCTTCCAGACT
GGCTACTACATAGAAGACACTGTAAGAGAAGATGTGGTGTGTCTCAGTGATGTCTCCTGC
TACTTTTCTCTTCTGGAGGGTGGCCGGCCAGAAGACAAGCTAGAATTCACCTTCAAGCTG
TACGACACGGACAGAAATGGGATCCTGGACAGCTCAGAAGTGGACAGGATCATCATACAG
ATGATGCGAATGGCTGAATACCTGGATTGGGATGTGTCTGAGCTGAGGCCGATTCTTCAA
GAGATGATGAAAGAGATTGACTATGATGGCAGTGGCTCTGTGTCCCTGGCTGAGTGGCTC
CGGGCTGGGGCCACCACCGTGCCACTGCTCGTGCTGCTGGGCCTGGAGATGACCCTGAAG
GACAATGGGCAGCACATGTGGAGACCCAAGAGATTCCCCCGACCAGTCTACTGCAACCTG
TGCGAGTCGAGCATTGGTCTTGGCAAACAGGGGCTGAGCTGTAACCTCTGTAAATACATC
GTTCACGACCAATGTGCCATGAAGGCCCTGCCCTGTGAAGTCAGCACCTATGCCAAGTCT
CGGAAGGACATTGGTGTCCAATCACACGTGTGGGTGCGAGGAGGCTGTGAATCTGGACGG
TGTGACCGCTGTCAGAAAAAGATCCGGATCTACCACAGTCTGGTTGGGCTGCATTGTGTG
TGGTGCCACCTAGAGATCCATGATGACTGCCTTCCAGCCATGGGCCATGAGTGTGACTGT
GGGCTGCTCCGAGATCACATCCTGCCTCCGTCTTCCATCTATCCCAGCGTCCTGGCCTCT
GGACAGGAGCGTAAAACTAGCAAAATAAGCCAGAAGACCATGGATGATTTAAGTTTGAGC
ACTTCTGAGGCTCTGCGGATTGATCCTGTTTCTAACACCCACCCACTTCTGGTCTTTGTG
AACCCCAAGAGTGGCGGGAAGCAAGGCGAGAGGGTGCTTTGGAAATTCCAGTATCTGCTG
AACCCTCGACAGGTGTTCAACCTCCTAAAGGATGGTCCTGAGCCAGGACTCAGATTCTTC
AGAGATGTTCCTGATTACAGGATTTTGGTGTGCGGCGGAGATGGCACAGTAGGCTGGATT
CTAGAGTCCATTGACAAAGCCAACTTGCCTTTTGTGCCTCCTGTCGCTGTGTTGCCCCTG
GGCACTGGAAATGATCTGGCTCGTTGCCTAAGATGGGGAGGAGGGTATGAGGGACAGAAT
CTGGGGAAGATCCTCAAGGATTTAGAGACAAGTAAGGTGGTACATATGGATCGATGGTCT
GTGGAGGTGATACCCCAACAAACTGAAGAAAAGAGTGACCCAGTCCCCTTTCAAATCATC
AATAACTACTTCTCCATCGGTGTGGATGCCTCTATTGCTCACCGATTCCACATTATGCGA
GAGAAATATCCTGAGAAGTTCAACAGCAGAATGAAGAACAAGCTATGGTACTTCGAATTT
GCCACTTCTGAATCCATCTTCTCAACGTGCAAAAAGCTGGAGGAATCTTTGACAGTTGAG
ATCTGTGGGAAACCACTGGATCTGAGCAACCTGTCCCTAGAAGGCATTGCAGTGCTGAAC
ATCCCAAGCACACATGGTGGCTCCAATCTCTGGGGTGACACCAAGAGACCACATGGCGAT
ATCCATGGGATCAACCAGGCCTTAGGTGCTACTGCCAAAGTCATCACCGACCCTGATATC
CTGAAGACCTGTGTACCAGACCTAAGTGACAAGCGGCTGGAAGTAGTGGGGCTGGAGGGT
GCAATTGAGATAGGCCAGATCTATACCAAGCTCAAGAATGCTGGACATCGGCTGGCCAAG
TGCTCTGAGATCACCTTCCACACCACAAAAACCCTCCCCATGCAAATTGACGGAGAACCC
TGGATGCAGACACCTTGTACAATCAAGATCACCCACAGGAACCAGATGCCTATGCTCGTG
GGCCCACCCCCTCGCTCCTCCAATTTTTTTGGCTTCTTGTGCTAA
Enzyme 54 GenBank Gene ID BC126521 Link Image
Enzyme 54 GeneCard ID DGKA Link Image
Enzyme 54 GenAtlas ID Not Available
Enzyme 54 HGNC ID Not Available
Enzyme 54 Chromosome Location Chromosome:1
Enzyme 54 Locus 12q13.3
Enzyme 54 SNPs SNPJam Report Link Image
Enzyme 54 General References Not Available
Enzyme 54 Metabolite References Not Available
Enzyme 55 [top]
Enzyme 55 ID 1065
Enzyme 55 Name Ubiquitin carboxyl-terminal hydrolase
Enzyme 55 Synonyms Not Available
Enzyme 55 Gene Name USP33
Enzyme 55 Protein Sequence >Ubiquitin carboxyl-terminal hydrolase
MSSFRSHCPHLDSVGEITKEDLIQKSHGSCQDCKVRGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVKPLHQIQENGVQDFK
IPSNTTLKTPLVAVFDDLDIEVEEEDELKARGLTGLKNIGNTCYMNAALQALSNCPPLTQ
FFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQD
AQEFLRCLMDLLHEELKEQVMEVEEDPQTIMTEETMEEDKSQSDVDFQSCESCSSSDKAE
NENGSRSFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVHSEGELDKDRDSVSET
ADLNNQETVKVQIHSRASEYITDVHLNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLP
PTHKKVQSALSPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQDLSLPIP
GKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWGPVVTLQ
DCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFRHELMFSTKIS
THVSFPLEGLDLQPFLAKDSPVQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFD
DQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKF
KTFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYIC
HTCQIEAEKIEKRRKTELEIFIRLNRAFQEEDSPATFYCISMQWFREWESFVKGKDGDPP
GPIDNTKIAVTKCGNVILRQGADSGQISEETWNFLQSIYGGGPEVILRPPVVHVDPDAVQ
AEEKIEVETRSL
Enzyme 55 Number of Residues 912
Enzyme 55 Molecular Weight 103322.2
Enzyme 55 Theoretical pI 5.76
Enzyme 55 GO Classification
Function
Process
Component
Enzyme 55 General Function Involved in cysteine-type peptidase activity
Enzyme 55 Specific Function Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol
Enzyme 55 Pathways Not Available
Enzyme 55 Reactions Not Available
Enzyme 55 Pfam Domain Function
Enzyme 55 Signals
  • None
Enzyme 55 Transmembrane Regions
  • None
Enzyme 55 Essentiality Not Available
Enzyme 55 GenBank ID Protein 151556801 Link Image
Enzyme 55 UniProtKB/Swiss-Prot ID A6QNM7 Link Image
Enzyme 55 UniProtKB/Swiss-Prot Entry Name A6QNM7_BOVIN Link Image
Enzyme 55 PDB ID Not Available
Enzyme 55 Cellular Location Not Available
Enzyme 55 Gene Sequence >2739 bp
ATGTCATCTTTTCGAAGTCATTGTCCACATTTGGATTCAGTTGGTGAAATAACTAAAGAA
GATTTAATACAAAAATCTCATGGTTCTTGTCAGGATTGTAAAGTCAGAGGACCAAACCTT
TGGGCATGCCTGGAGAATAGGTGTTCATATGTTGGCTGTGGTGAATCACAAGTGGATCAT
AGCACCATACATTCTCAGGAGACAAAGCATTATCTAACTGTGAACCTTACCACCCTTCGA
GTTTGGTGTTATGCTTGCAGCAAAGAAGTATTTTTGGATAGGAAATTAGGAACTCAGCCT
TCATTACCTCATGTAAAACCACTTCACCAAATACAAGAAAATGGCGTACAGGATTTTAAA
ATACCCAGTAACACAACATTAAAAACTCCTCTGGTTGCTGTGTTTGATGATCTGGATATA
GAAGTAGAAGAAGAAGATGAACTTAAGGCAAGAGGTCTTACAGGTTTGAAAAATATTGGA
AATACTTGTTATATGAATGCAGCTTTGCAGGCTCTTTCTAACTGCCCGCCTTTGACGCAG
TTTTTTCTTGATTGTGGAGGACTGGCTCGAACAGATAAGAAACCAGCTATTTGTAAAAGT
TATCTCAAACTGATGACAGAGCTCTGGCATAAAAGCAGGCCAGGATCAGTTGTGCCTACT
ACTCTGTTTCAAGGAATTAAAACTGTAAATCCAACATTTCGGGGGTATTCTCAGCAGGAT
GCTCAAGAATTCCTTCGATGTTTAATGGATCTGCTTCATGAAGAATTGAAAGAACAAGTC
ATGGAAGTAGAAGAGGATCCTCAAACTATAATGACTGAAGAGACCATGGAGGAAGACAAG
AGCCAGTCAGATGTAGATTTTCAGTCCTGCGAATCTTGTAGCAGCAGTGATAAAGCTGAA
AATGAAAATGGCTCTAGAAGCTTTTCTGAAGATAATAATGAGACAACAATGTTAATTCAG
GATGATGAGAACAATTCAGAAATGTCAAAAGATTGGCAAAAAGAGAAGATGTGCAACAAG
ATTAATAAAGTACATTCTGAAGGAGAATTAGATAAAGATAGAGACTCTGTATCTGAAACA
GCTGATTTGAACAACCAGGAAACTGTCAAAGTGCAAATACACAGCAGAGCTTCAGAATAT
ATTACTGATGTCCATTTGAATGACCTGTCTACACCACAGATCCTCCCATCAAATGAAGGT
GTTAATCCAAGATTATCAGCAAGCCCTCCTAAATCAGGCAATTTGTGGCCAGGATTGCCA
CCCACACACAAAAAAGTTCAATCTGCATTATCTCCAAAGAGAAAAAAACAGCACAAGAAA
TACCGAAGTGTTATTTCAGACATATTTGATGGAACAATCATTAGTTCAGTTCAGTGTCTG
ACTTGTGACAGGGTGTCTGTAACCCTCGAGACCTTTCAAGATCTGTCCTTGCCAATTCCT
GGCAAGGAAGACCTTGCTAAACTGCATTCGTCAAGTCATCCAACATCTATAGTCAAAGCA
GGATCATGTGGCGAAGCATATGCTCCACAAGGGTGGATAGCTTTTTTCATGGAGTATGTG
AAGAGGTTTGTTGTCTCATGTGTCCCTAGCTGGTTTTGGGGTCCAGTAGTAACCTTGCAA
GATTGTCTTGCTGCCTTCTTTGCCAGAGATGAACTAAAAGGTGACAATATGTACAGTTGT
GAAAAATGCAAAAAGTTGAGAAATGGAGTAAAGTTTTGTAAAGTACAAAAGTTTCCTGAG
ATTTTGTGCATCCATCTTAAAAGATTCAGACATGAACTGATGTTTTCCACCAAAATCAGT
ACCCATGTTTCATTTCCACTGGAAGGCCTGGATCTTCAACCATTTCTTGCTAAAGATAGT
CCGGTGCAAATTGTTACCTATGATCTTCTGTCAGTCATTTGTCACCATGGAACTGCAAGT
AGTGGACACTATATTGCCTACTGCCGAAACAATTTAAATAATCTCTGGTATGAATTTGAC
GACCAGAGTGTCACTGAAGTTTCAGAGTCTACTGTACAAAATGCAGAAGCTTATGTTCTC
TTCTACAGGAAGAGCAGTGAAGAAGCACAAAAAGAGAGGCGAAGAATATCAAATTTGTTG
AACATAATGGAACCAAGTCTCCTTCAGTTTTATATTTCTCGACAGTGGCTAAATAAATTT
AAGACCTTTGCTGAACCTGGCCCTATTTCAAATAATGATTTTCTCTGTATTCATGGAGGT
GTTCCTCCACGAAAAGCTGGTTATATTGAAGACCTGGTTTTGATGCTGCCTCAGAACATT
TGGGATAACCTATATAGCAGGTATGGAGGAGGACCAGCCGTCAACCATCTGTACATTTGT
CACACTTGCCAGATTGAAGCGGAGAAAATTGAAAAAAGAAGAAAAACTGAATTGGAAATT
TTTATTCGGCTCAACAGAGCATTCCAAGAGGAAGACTCTCCAGCTACTTTTTATTGCATC
AGTATGCAATGGTTTAGAGAATGGGAAAGTTTTGTGAAGGGTAAAGATGGAGATCCTCCA
GGTCCTATTGATAACACTAAAATTGCAGTCACCAAATGTGGCAATGTGATACTCAGGCAA
GGAGCAGATTCTGGTCAGATTTCTGAAGAAACATGGAATTTTCTACAGTCTATATATGGT
GGAGGGCCCGAAGTTATCTTGCGGCCTCCAGTTGTTCATGTTGATCCTGATGCAGTACAA
GCAGAAGAAAAAATTGAAGTAGAAACTCGGTCTTTGTAA
Enzyme 55 GenBank Gene ID BC148905 Link Image
Enzyme 55 GeneCard ID USP33 Link Image
Enzyme 55 GenAtlas ID Not Available
Enzyme 55 HGNC ID Not Available
Enzyme 55 Chromosome Location Chromosome:1
Enzyme 55 Locus 1p31.1
Enzyme 55 SNPs SNPJam Report Link Image
Enzyme 55 General References Not Available
Enzyme 55 Metabolite References Not Available
Enzyme 56 [top]
Enzyme 56 ID 1066
Enzyme 56 Name Carbonic anhydrase 4
Enzyme 56 Synonyms
  1. Carbonic anhydrase IV
  2. CA-IV
  3. Carbonate dehydratase IV
Enzyme 56 Gene Name CA4
Enzyme 56 Protein Sequence >Carbonic anhydrase 4
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Enzyme 56 Number of Residues 312
Enzyme 56 Molecular Weight 35150.9
Enzyme 56 Theoretical pI 6.85
Enzyme 56 GO Classification
Function
Process
Component
Enzyme 56 General Function Inorganic ion transport and metabolism
Enzyme 56 Specific Function Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4
Enzyme 56 Pathways Not Available
Enzyme 56 Reactions Not Available
Enzyme 56 Pfam Domain Function
Enzyme 56 Signals
  • 1-18
Enzyme 56 Transmembrane Regions
  • None
Enzyme 56 Essentiality Not Available
Enzyme 56 GenBank ID Protein 1575298 Link Image
Enzyme 56 UniProtKB/Swiss-Prot ID Q95323 Link Image
Enzyme 56 UniProtKB/Swiss-Prot Entry Name CAH4_BOVIN Link Image
Enzyme 56 PDB ID Not Available
Enzyme 56 Cellular Location Not Available
Enzyme 56 Gene Sequence >939 bp
ATGCGGCTGCTGCTGGCGCTCCTGGTCCTCGCCGCCGCCCCGCCCCAGGCCCGTGCAGCG
TCACACTGGTGCTACCAGATTCAAGTCAAGCCTTCCAACTACACCTGCTTGGAGCCAGAC
GAGTGGGAAGGCAGCTGCCAGAACAACCGCCAGTCCCCCGTCAACATCGTCACAGCCAAG
ACTCAGCTGGACCCAAACCTGGGGCGCTTTTCCTTTTCTGGCTACAACATGAAGCACCAG
TGGGTCGTGCAAAACAACGGGCATACAGTGATGGTGTTGCTGGAGAATAAGCCCTCGATC
GCTGGAGGAGGACTGAGCACCCGGTACCAAGCCACGCAGCTGCACCTGCACTGGTCCAGG
GCGATGGATCGGGGCTCAGAGCACAGCTTCGACGGGGAGCGCTTTGCCATGGAGATGCAC
ATAGTGCACGAGAAAGAGAAGGGGCTATCCGGGAATGCGAGCCAGAACCAGTTCGCCGAA
GATGAGATCGCGGTGCTGGCCTTCATGGTGGAGGACGGATCCAAGAATGTGAACTTCCAG
CCCCTGGTGGAGGCGCTGTCTGACATCCCCAGACCCAATATGAACACCACAATGAAAGAA
GGCGTCAGCCTCTTCGACCTGCTCCCCGAGGAGGAGAGTCTGAGGCACTACTTCCGCTAC
CTGGGCTCGCTCACCACACCGACCTGCGACGAGAAGGTGGTCTGGACCGTGTTCCAGAAG
CCAATACAGCTCCACAGGGACCAGATCTTGGCCTTCTCCCAGAAGCTGTTCTATGACGAC
CAGCAGAAAGTGAATATGACGGACAACGTCAGGCCCGTGCAGAGCCTGGGCCAGCGCCAG
GTTTTCAGGTCCGGGGCCCCGGGACTGCTGCTGGCCCAGCCGCTGCCCACCCTGTTGGCC
CCCGTGCTCGCCTGCTTGACAGTGGGCTTCCTCCGGTGA
Enzyme 56 GenBank Gene ID U58870 Link Image
Enzyme 56 GeneCard ID CA4 Link Image
Enzyme 56 GenAtlas ID Not Available
Enzyme 56 HGNC ID Not Available
Enzyme 56 Chromosome Location Chromosome:1
Enzyme 56 Locus 17q23
Enzyme 56 SNPs SNPJam Report Link Image
Enzyme 56 General References Not Available
Enzyme 56 Metabolite References Not Available
Enzyme 57 [top]
Enzyme 57 ID 1067
Enzyme 57 Name Ester hydrolase C11orf54 homolog
Enzyme 57 Synonyms Not Available
Enzyme 57 Gene Name Not Available
Enzyme 57 Protein Sequence >Ester hydrolase C11orf54 homolog
MACAEYSFHVPSLEELVGVLQKGLTDNFAEVQVSVVDCPDLTKEPFTFPIKGICGKTRIA
EVGGVPYLLPLVNEKKVYDLNKIAKDIQLPGAFVLGAGAGPFQTLGFNSEFMLLVQTESE
HRPPVNGSYFARVNPADGGCLLEKYSEKYHDFGCALLANLFASEGQPGKVIEVKVKRRTG
KLNFVTCMRQTLEKHYGDKPVGMGGAFIIQKGKVKTHIMPAEFSSCPLNSDEDVNKWLHF
YEMKAPLVCLPVFVSRDPGFDLRLEHTHCFSHHGEGGHYHYDTTPDIVEYLGYFLPAEFL
YRIDQPKETHSFGRD
Enzyme 57 Number of Residues 315
Enzyme 57 Molecular Weight 35155.1
Enzyme 57 Theoretical pI 6.44
Enzyme 57 GO Classification
Function
Process
Component
Enzyme 57 General Function Involved in hydrolase activity, acting on ester bonds
Enzyme 57 Specific Function Exhibits ester hydrolase activity on the substrate p- nitrophenyl acetate
Enzyme 57 Pathways Not Available
Enzyme 57 Reactions Not Available
Enzyme 57 Pfam Domain Function
Enzyme 57 Signals
  • None
Enzyme 57 Transmembrane Regions
  • None
Enzyme 57 Essentiality Not Available
Enzyme 57 GenBank ID Protein 88682878 Link Image
Enzyme 57 UniProtKB/Swiss-Prot ID Q2HJH3 Link Image
Enzyme 57 UniProtKB/Swiss-Prot Entry Name CK054_BOVIN Link Image
Enzyme 57 PDB ID Not Available
Enzyme 57 Cellular Location Not Available
Enzyme 57 Gene Sequence >948 bp
ATGGCTTGTGCTGAATATTCTTTTCATGTGCCAAGTCTAGAGGAGCTTGTTGGAGTCTTG
CAGAAGGGGCTAACGGATAACTTTGCTGAAGTCCAGGTCTCTGTAGTTGATTGCCCTGAT
TTAACTAAGGAGCCATTTACCTTTCCTATAAAAGGCATCTGTGGAAAAACTAGAATTGCA
GAAGTAGGAGGTGTGCCTTACTTACTGCCTCTTGTAAATGAAAAAAAAGTTTATGATTTA
AATAAGATTGCAAAAGACATCCAGCTTCCTGGAGCTTTTGTTCTTGGAGCAGGAGCAGGC
CCATTTCAGACTCTTGGATTCAATTCTGAGTTTATGCTACTTGTTCAAACAGAAAGTGAA
CACAGACCTCCTGTGAATGGAAGTTACTTTGCTCGGGTTAACCCTGCAGATGGAGGGTGT
CTACTAGAGAAATACAGTGAGAAATATCATGATTTTGGGTGTGCATTACTGGCTAATCTT
TTTGCCAGTGAAGGCCAACCTGGGAAGGTCATTGAGGTGAAAGTCAAAAGAAGAACTGGA
AAACTTAACTTTGTGACATGTATGAGGCAGACTCTTGAAAAACATTATGGAGATAAGCCT
GTAGGAATGGGAGGTGCTTTCATAATTCAGAAGGGAAAAGTGAAGACTCATATTATGCCT
GCAGAATTTTCTTCCTGTCCATTGAACTCTGACGAAGACGTGAATAAATGGTTGCATTTT
TATGAGATGAAGGCTCCTTTGGTTTGTCTGCCAGTTTTTGTCTCCAGAGACCCCGGGTTT
GATTTGCGGTTGGAGCACACTCATTGTTTCAGTCATCATGGAGAAGGTGGACACTACCAT
TATGACACCACCCCAGATATAGTGGAGTACCTCGGATACTTCTTACCTGCCGAGTTTCTC
TATCGCATTGATCAACCAAAAGAGACCCATTCATTTGGGCGAGATTAA
Enzyme 57 GenBank Gene ID BC105390 Link Image
Enzyme 57 GeneCard ID Not Available
Enzyme 57 GenAtlas ID Not Available
Enzyme 57 HGNC ID Not Available
Enzyme 57 Chromosome Location Not Available
Enzyme 57 Locus Not Available
Enzyme 57 SNPs SNPJam Report Link Image
Enzyme 57 General References Not Available
Enzyme 57 Metabolite References Not Available
Enzyme 58 [top]
Enzyme 58 ID 1068
Enzyme 58 Name Carboxypeptidase A1
Enzyme 58 Synonyms Not Available
Enzyme 58 Gene Name CPA1
Enzyme 58 Protein Sequence >Carboxypeptidase A1
MQGLLILSVLLGAALGKEDFVGHQVLRITAADEAEVQTVKELEDLEHLQLDFWRGPGQPG
SPIDVRVPFPSLQAVKVFLEAHGIRYRIMIEDVQSLLDEEQEQMFASQSRARSTNTFNYA
TYHTLDEIYDFMDLLVAEHPQLVSKLQIGRSYEGRPIYVLKFSTGGSNRPAIWIDLGIHS
REWITQATGVWFAKKFTEDYGQDPSFTAILDSMDIFLEIVTNPDGFAFTHSQNRLWRKTR
SVTSSSLCVGVDANRNWDAGFGKAGASSSPCSETYHGKYANSEVEVKSIVDFVKDHGNFK
AFLSIHSYSQLLLYPYGYTTQSIPDKTELNQVAKSAVEALKSLYGTSYKYGSIITTIYQA
SGGSIDWSYNQGIKYSFTFELRDTGRYGFLLPASQIIPTAQETWLGVLTIMEHTLNNLY
Enzyme 58 Number of Residues 419
Enzyme 58 Molecular Weight 47081.7
Enzyme 58 Theoretical pI 5.26
Enzyme 58 GO Classification
Function
Process
Component
Enzyme 58 General Function Amino acid transport and metabolism
Enzyme 58 Specific Function Release of a C-terminal amino acid, but little or no action with -Asp, -Glu, -Arg, -Lys or -Pro
Enzyme 58 Pathways Not Available
Enzyme 58 Reactions Not Available
Enzyme 58 Pfam Domain Function
Enzyme 58 Signals
  • 1-16
Enzyme 58 Transmembrane Regions
  • None
Enzyme 58 Essentiality Not Available
Enzyme 58 GenBank ID Protein 162789 Link Image
Enzyme 58 UniProtKB/Swiss-Prot ID P00730 Link Image
Enzyme 58 UniProtKB/Swiss-Prot Entry Name CBPA1_BOVIN Link Image
Enzyme 58 PDB ID Not Available
Enzyme 58 Cellular Location Not Available
Enzyme 58 Gene Sequence >1260 bp
ATGCAGGGGCTGCTGATTTTGAGTGTGCTGCTGGGGGCTGCCCTTGGCAAAGAGGACTTT
GTGGGCCACCAGGTGCTCCGAATCACTGCCGCCGATGAGGCCGAGGTGCAGACGGTGAAG
GAGCTGGAGGACCTGGAGCACCTGCAGTTGGACTTCTGGAGGGGCCCTGGCCAGCCAGGC
TCCCCCATCGACGTCCGAGTGCCCTTCCCCAGCCTCCAGGCTGTTAAAGTCTTCCTGGAA
GCCCATGGCATCAGATACAGGATCATGATCGAGGACGTGCAGTCCCTGCTAGACGAGGAG
CAGGAGCAGATGTTCGCCTCCCAGAGCCGGGCCCGCAGCACCAACACATTTAACTACGCC
ACCTACCACACCCTGGATGAGATCTATGACTTCATGGACCTGCTGGTGGCCGAGCACCCA
CAGCTTGTCAGCAAACTCCAGATTGGCAGAAGCTATGAAGGCCGTCCCATCTACGTGCTG
AAGTTCAGCACTGGGGGAAGCAACCGTCCAGCCATCTGGATCGACTTAGGCATCCATTCC
AGGGAGTGGATCACCCAGGCCACTGGGGTCTGGTTTGCAAAGAAGTTCACAGAAGACTAT
GGCCAGGACCCGAGTTTCACCGCCATTCTTGACAGCATGGACATATTCTTGGAGATTGTC
ACCAACCCTGATGGTTTTGCCTTCACCCACAGCCAGAATCGATTGTGGCGCAAGACTCGA
TCTGTCACGTCAAGCTCCCTCTGTGTTGGGGTGGACGCCAACCGGAACTGGGATGCCGGC
TTTGGGAAGGCAGGAGCCAGCAGCAGCCCCTGCTCGGAGACTTATCATGGCAAGTATGCC
AATTCTGAAGTGGAGGTCAAGTCCATCGTGGACTTTGTGAAAGACCATGGGAACTTCAAG
GCCTTCCTCTCCATCCACAGCTACTCCCAGCTCCTCCTCTATCCCTATGGCTACACAACA
CAATCAATCCCTGACAAGACTGAGCTGAATCAGGTGGCTAAGTCCGCTGTTGAGGCCCTG
AAGTCTCTGTATGGGACCAGCTACAAGTATGGCAGCATCATCACAACAATTTACCAAGCC
AGTGGAGGCAGCATTGACTGGTCCTACAACCAAGGCATCAAGTACTCCTTCACCTTTGAA
CTCCGGGACACGGGGCGCTATGGCTTCCTGCTGCCAGCCTCCCAGATCATCCCCACAGCC
CAGGAGACGTGGCTGGGGGTTCTGACCATCATGGAGCACACGTTGAATAACCTCTACTGA
Enzyme 58 GenBank Gene ID M61851 Link Image
Enzyme 58 GeneCard ID CPA1 Link Image
Enzyme 58 GenAtlas ID Not Available
Enzyme 58 HGNC ID Not Available
Enzyme 58 Chromosome Location Chromosome:7
Enzyme 58 Locus 7q32
Enzyme 58 SNPs SNPJam Report Link Image
Enzyme 58 General References
  1. [PubMed Link Image]
Enzyme 58 Metabolite References Not Available
Enzyme 59 [top]
Enzyme 59 ID 1069
Enzyme 59 Name Carboxypeptidase A5
Enzyme 59 Synonyms Not Available
Enzyme 59 Gene Name CPA5
Enzyme 59 Protein Sequence >Carboxypeptidase A5
MQSSPEGGVIRRLYPVGRRTLLVCSFILAAALGQMNFTGDQVLRILAKNEKQLSLLRDLE
GLKPQKVDFWRGPARPSLPVDMRVPFSELKDIKAYLESHGLAYNIMIKDIQVLLDEEREA
MAKSRRLERSTSSFSYSSYHTLEEIYTWIDTFVTEHSDVVSKLQIGHSFENRSILVLKFS
TGGSRRPAIWIDSGIHSREWITHATSVWIAKKIVSEYSKDRIVTDVLNAMDIFLEIVSNP
DGFAYTHSMNRLWRKNKSTRPGIFCIGVDLNRNWKSGFGGNGSNNNPCSETYHGPSPQSE
PEVAAVVDFIMSHGNVKALISIHSYSQMLMYPYGHSLEPVSNQEELMWPAGSQLTGPMTV
ASSTPSASSSGTRGATASCCQPRRSSPRPRRHGWPFGPSWSTHCIIPTDRTAEGRARGVV
FFSEAWAPPETQVMDPFPIPALTP
Enzyme 59 Number of Residues 444
Enzyme 59 Molecular Weight 49620.0
Enzyme 59 Theoretical pI 8.75
Enzyme 59 GO Classification
Function
Process
Component
Enzyme 59 General Function Amino acid transport and metabolism
Enzyme 59 Specific Function Not Available
Enzyme 59 Pathways Not Available
Enzyme 59 Reactions Not Available
Enzyme 59 Pfam Domain Function
Enzyme 59 Signals
  • None
Enzyme 59 Transmembrane Regions
  • None
Enzyme 59 Essentiality Not Available
Enzyme 59 GenBank ID Protein 117306374 Link Image
Enzyme 59 UniProtKB/Swiss-Prot ID A0JNG8 Link Image
Enzyme 59 UniProtKB/Swiss-Prot Entry Name A0JNG8_BOVIN Link Image
Enzyme 59 PDB ID Not Available
Enzyme 59 Cellular Location Not Available
Enzyme 59 Gene Sequence >1335 bp
ATGCAGAGTTCCCCTGAAGGAGGCGTGATTCGCAGGTTGTACCCTGTGGGCAGGCGGACA
CTCCTCGTCTGCAGCTTTATCCTGGCAGCAGCTTTGGGCCAGATGAATTTCACAGGTGAC
CAGGTTCTTCGAATCCTGGCTAAAAATGAGAAGCAGCTTTCACTTCTCAGGGATCTGGAG
GGCCTGAAGCCCCAGAAGGTGGACTTCTGGCGCGGCCCAGCCAGGCCCAGCCTCCCTGTG
GACATGAGGGTTCCCTTCTCTGAATTGAAAGACATCAAAGCTTACCTGGAGTCTCACGGC
CTTGCTTACAACATCATGATAAAGGACATCCAGGTGCTGCTGGACGAGGAGAGAGAAGCC
ATGGCGAAGTCCCGCCGGTTGGAGCGAAGCACCAGTAGCTTCAGTTACTCCTCTTACCAC
ACCCTGGAGGAGATCTATACCTGGATTGACACCTTTGTAACTGAGCATTCAGATGTTGTC
TCAAAACTTCAGATTGGCCACAGCTTTGAAAATCGGTCCATCCTTGTTCTGAAGTTCAGC
ACTGGAGGTTCTCGGCGCCCGGCCATCTGGATTGATTCTGGAATCCATTCCCGGGAGTGG
ATCACCCATGCCACTAGCGTCTGGATTGCCAAGAAGATTGTCAGTGAATACAGCAAAGAC
CGCATCGTAACAGATGTACTGAATGCCATGGACATCTTCCTGGAGATTGTCTCTAATCCC
GATGGGTTTGCTTATACCCACAGTATGAACCGCTTGTGGCGGAAGAACAAGTCCACCAGA
CCAGGAATCTTCTGCATTGGTGTGGATCTTAACAGAAACTGGAAGTCAGGCTTTGGAGGA
AACGGTTCTAACAACAACCCCTGCTCAGAGACTTACCATGGGCCCTCCCCTCAGTCAGAG
CCAGAAGTGGCTGCCGTCGTGGACTTTATCATGTCCCATGGGAACGTCAAGGCTCTGATC
TCCATCCACAGCTACTCTCAGATGCTCATGTACCCCTATGGCCACTCTCTGGAGCCTGTT
TCAAACCAGGAGGAGTTGATGTGGCCAGCGGGATCACAGTTGACTGGGCCTATGACAGTG
GCATCAAGTACTCCTTCAGCTTCGAGCTCCGGGACACGGGGCGCTACGGCTTCCTGCTGC
CAGCCACGCAGATCATCCCCACGGCCCAGGAGACATGGATGGCCATTCGGACCATCATGG
AGCACACACTGCATCATCCCTACTGACAGAACTGCTGAGGGGAGAGCCAGAGGAGTGGTT
TTCTTTTCCGAGGCCTGGGCTCCTCCTGAAACCCAAGTTATGGATCCCTTCCCCATCCCT
GCCCTGACTCCTTAG
Enzyme 59 GenBank Gene ID BC126678 Link Image
Enzyme 59 GeneCard ID CPA5 Link Image
Enzyme 59 GenAtlas ID Not Available
Enzyme 59 HGNC ID Not Available
Enzyme 59 Chromosome Location Chromosome:7
Enzyme 59 Locus 7q32
Enzyme 59 SNPs SNPJam Report Link Image
Enzyme 59 General References Not Available
Enzyme 59 Metabolite References Not Available
Enzyme 60 [top]
Enzyme 60 ID 1070
Enzyme 60 Name Carboxypeptidase O
Enzyme 60 Synonyms
  1. CPO
Enzyme 60 Gene Name CPO
Enzyme 60 Protein Sequence >Carboxypeptidase O
MKPLLGTFYLLGMLVPGWLGYDRSLTQQRQEVVDKVVSPWSILETYSYNRYHPMGEIYQW
MSEIREKYTEVVTQHFLGMTYESRPMYYLKISQPSSNPKKIIWMDCGIHAREWIAPAFCQ
WFVKEILQNYEDNSRIRRLLKNLDFYVLPVLNIDGYIYTWTTDRLWRKSRSSHNNGTCFG
TDLNRNFDASWCSIGASHNCESLTFCGTGPMSEPETKAVSSFIESKKENIACFLTMHSYG
QLILVPYGYTKNKSNNHEELIQVGQKAANALKAKHGTNYRVGSSADILYATSGSSRDWAR
DIGIPFSYTFELRDNGTYGFVLPETQIQATCEETMEAVLSVLDDVYEKYWYTNSARKAKS
TALVLGLLMSFMSLL
Enzyme 60 Number of Residues 375
Enzyme 60 Molecular Weight 43174.8
Enzyme 60 Theoretical pI 7.46
Enzyme 60 GO Classification
Function
Process
Component
Enzyme 60 General Function Amino acid transport and metabolism
Enzyme 60 Specific Function Probable carboxypeptidase which may cleave proteins with C-terminal acidic residues
Enzyme 60 Pathways Not Available
Enzyme 60 Reactions Not Available
Enzyme 60 Pfam Domain Function
Enzyme 60 Signals
  • 1-20
Enzyme 60 Transmembrane Regions
  • None
Enzyme 60 Essentiality Not Available
Enzyme 60 GenBank ID Protein 113911902 Link Image
Enzyme 60 UniProtKB/Swiss-Prot ID Q0II73 Link Image
Enzyme 60 UniProtKB/Swiss-Prot Entry Name CBPO_BOVIN Link Image
Enzyme 60 PDB ID Not Available
Enzyme 60 Cellular Location Not Available
Enzyme 60 Gene Sequence >1128 bp
ATGAAACCTCTGCTTGGAACCTTTTATCTGTTGGGTATGCTGGTTCCTGGTTGGTTGGGA
TATGATAGATCCCTCACACAACAGAGACAAGAAGTTGTGGATAAAGTAGTGAGTCCATGG
AGCATCCTGGAGACATATTCTTATAACAGATATCACCCCATGGGGGAGATCTACCAGTGG
ATGAGTGAGATAAGGGAGAAGTACACGGAAGTGGTGACACAGCATTTCCTAGGAATGACC
TATGAGAGCCGGCCCATGTATTATTTGAAGATCAGCCAACCATCCAGTAACCCCAAGAAG
ATTATCTGGATGGACTGTGGAATTCATGCCAGGGAATGGATTGCCCCTGCTTTCTGCCAG
TGGTTTGTGAAAGAAATTCTACAGAACTATGAAGACAACTCAAGGATAAGAAGGCTCCTT
AAAAACCTGGACTTCTACGTGCTTCCGGTTCTTAACATAGATGGTTACATCTACACTTGG
ACGACTGATCGGCTTTGGAGGAAGTCTCGTTCATCCCATAATAATGGCACATGTTTTGGA
ACAGATCTCAATCGAAACTTTGATGCATCCTGGTGTAGTATCGGTGCATCTCACAACTGT
GAAAGTTTAACGTTTTGTGGAACAGGACCCATGTCTGAACCAGAGACGAAAGCTGTTTCC
AGCTTTATCGAGAGCAAGAAGGAGAACATTGCCTGCTTCCTGACCATGCACTCTTATGGA
CAGCTCATTCTCGTGCCTTATGGCTACACCAAAAATAAATCAAATAACCATGAGGAATTG
ATCCAAGTTGGACAGAAGGCAGCAAATGCATTGAAAGCAAAGCATGGAACCAATTATAGA
GTTGGATCGAGTGCAGATATTTTATATGCTACATCAGGATCCTCAAGAGACTGGGCTCGG
GACATTGGGATCCCCTTTTCATACACATTTGAACTGAGGGACAATGGTACCTATGGATTT
GTCCTGCCAGAAACTCAGATTCAGGCCACTTGTGAGGAAACCATGGAGGCTGTGCTTTCA
GTCCTAGATGATGTATATGAGAAGTACTGGTACACAAACAGTGCCAGAAAGGCAAAATCT
ACTGCTCTGGTGCTGGGCTTGCTGATGTCCTTCATGTCTCTTCTCTAA
Enzyme 60 GenBank Gene ID BC122774 Link Image
Enzyme 60 GeneCard ID CPO Link Image
Enzyme 60 GenAtlas ID Not Available
Enzyme 60 HGNC ID Not Available
Enzyme 60 Chromosome Location Chromosome:2
Enzyme 60 Locus 2q33.3
Enzyme 60 SNPs SNPJam Report Link Image
Enzyme 60 General References Not Available
Enzyme 60 Metabolite References Not Available
Enzyme 61 [top]
Enzyme 61 ID 1071
Enzyme 61 Name E3 ubiquitin-protein ligase BRE1A
Enzyme 61 Synonyms
  1. BRE1-A
  2. RING finger protein 20
Enzyme 61 Gene Name RNF20
Enzyme 61 Protein Sequence >E3 ubiquitin-protein ligase BRE1A
MSGIGSKRAAGEPGTSVPPEKKTAVEDSGTTVETIKLGGVSSTEELDIRTLQTKNRKLAE
MLDQRQAIEDELREHIEKLERRQATDDASLLIVNRYWSQFDENIRIILKRYDLEQGLGDL
LTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFSFLATLASSSSEEMESQLQERVES
SRRAVSQIVTVYDKLQEKVELLSRKLNSGDSLMVEEAVQELNSFLAQENTRLQELTDLLQ
EKHCTMSQEFSKLQSKVETAESRVSVLESMIDDLQWDIDKIRKREQRLNRHLAEVLERVN
SKGYKVYGAGSSLYGGTITINARKFEEMNAELEENKELAQNRHCELEKLRQDFEEVTSQN
EKLKVELRSAVEEVVKETPEYRCMQSQFSVLYNESLQLKAHLDEARTLLHGTRGTHQRQV
ELIERDEVSLHKKLRTEVIQLEDTLAQVRKEYEMLRIEFEQTLAANEQAGPINREMRHLI
SSLQNHNHQLKGEVLRYKRKLREAQSDLNKTRLRSGSALLQSQSSTEDPKDEPAELKQDS
EDLATQSAASKASQEEVNEIKSKRDEEERERERREKEREREREREKEKEREREKQKLKES
EKERESAKDKEKGKHDDGRKKEAEIIKQLKIELKKAQESQKEMKLLLDMYRSAPKEQRDK
VQLMAAEKKSKAELEDLRQRLKDLEDKEKKENKKMADEDALRKIRAVEEQIEYLQKKLAM
AKQEEEALLSEMDVTGQAFEDMQEQNIRLMQQLREKDDANFKLMSERIKSNQIHKLLKEE
KEELADQVLTLKTQVDAQLQVVRKLEEKEHLLQSNIGTGEKELGLRTQALEMNKRKAMEA
AQLADDLKAQLEMAQKKLHDFQDEIVENSVTKEKDMFNFKRAQEDISRLRRKLETTKKPD
NVPKCDEILMEEIKDYKARLTCPCCNMRKKDAVLTKCFHVFCFECVKTRYDTRQRKCPKC
NAAFGANDFHRIYIG
Enzyme 61 Number of Residues 975
Enzyme 61 Molecular Weight 113657.5
Enzyme 61 Theoretical pI 5.64
Enzyme 61 GO Classification
Function
Process
Component
Enzyme 61 General Function Replication, recombination and repair
Enzyme 61 Specific Function E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-120' of histone H2B. H2B 'Lys-120' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBE2E1/UBCH6. It thereby plays a central role in histone code and gene regulation. Required for transcriptional activation of Hox genes. Recruited to the MDM2 promoter, probably by being recruited by p53/TP53, and thereby acts as a transcriptional coactivator
Enzyme 61 Pathways
  • Protein modification
  • protein ubiquitination
Enzyme 61 Reactions Not Available
Enzyme 61 Pfam Domain Function
Enzyme 61 Signals
  • None
Enzyme 61 Transmembrane Regions
  • None
Enzyme 61 Essentiality Not Available
Enzyme 61 GenBank ID Protein 124829114 Link Image
Enzyme 61 UniProtKB/Swiss-Prot ID A2VDP1 Link Image
Enzyme 61 UniProtKB/Swiss-Prot Entry Name BRE1A_BOVIN Link Image
Enzyme 61 PDB ID Not Available
Enzyme 61 Cellular Location Not Available
Enzyme 61 Gene Sequence >2928 bp
ATGTCAGGAATTGGAAGTAAAAGAGCAGCTGGAGAGCCTGGCACATCTGTGCCTCCAGAG
AAGAAGACAGCTGTTGAAGATTCAGGGACCACAGTGGAAACAATTAAACTTGGGGGTGTC
TCTTCAACGGAGGAGTTAGACATTCGAACACTGCAAACCAAAAATCGCAAACTGGCAGAA
ATGCTGGATCAACGGCAAGCCATCGAAGATGAACTCCGTGAACACATTGAAAAACTGGAA
CGAAGACAGGCCACTGATGATGCCTCACTGTTGATTGTCAACCGATACTGGAGTCAGTTT
GATGAAAACATCCGTATCATCCTTAAGCGTTATGATCTGGAGCAAGGTTTGGGAGACCTA
CTCACAGAGAGAAAAGCCCTTGTTGTGCCCGAGCCAGAACCAGACTCTGATAGCAATCAA
GAACGGAAAGATGACCGAGAGAGAGGGGAAGGGCAAGAGCCAGCTTTCTCTTTCCTTGCT
ACTTTGGCCAGCAGTTCCAGTGAAGAGATGGAATCTCAGCTGCAGGAGCGCGTGGAGTCC
TCCCGCCGAGCGGTGTCCCAGATTGTGACCGTCTATGATAAACTGCAAGAAAAGGTGGAG
CTCTTATCACGGAAGCTGAACAGTGGAGACAGTCTGATGGTAGAGGAAGCAGTGCAGGAG
CTGAATTCCTTCCTTGCACAAGAGAACACAAGGCTGCAAGAACTGACAGACCTCCTTCAG
GAGAAGCATTGCACCATGTCTCAGGAGTTTTCCAAGTTGCAGAGTAAAGTGGAGACAGCT
GAGTCACGAGTGTCTGTCCTGGAGTCCATGATCGATGACCTGCAGTGGGATATTGACAAA
ATTCGAAAGCGGGAACAGCGACTTAACCGACACTTAGCAGAAGTCTTAGAACGGGTAAAT
TCAAAAGGTTATAAAGTGTACGGTGCAGGGAGCAGCCTCTATGGTGGTACAATCACCATC
AACGCCCGGAAGTTTGAGGAAATGAATGCGGAGCTTGAAGAGAACAAAGAGTTGGCTCAG
AACCGTCACTGTGAGCTGGAGAAACTTCGGCAAGACTTCGAGGAGGTCACTTCACAAAAT
GAAAAACTGAAGGTGGAATTACGGAGCGCAGTGGAGGAAGTGGTCAAGGAGACTCCAGAA
TATCGCTGCATGCAGTCACAGTTCTCCGTGCTGTACAACGAGAGTCTGCAGTTGAAAGCA
CACTTGGATGAGGCTCGGACCCTGCTTCATGGCACTAGGGGAACCCACCAACGTCAGGTG
GAGCTCATTGAGCGAGATGAGGTTAGTCTTCATAAGAAGCTGAGGACGGAAGTAATCCAG
CTGGAAGATACACTGGCCCAGGTCCGCAAGGAGTATGAGATGCTGAGGATAGAATTCGAG
CAGACCCTTGCTGCCAATGAACAAGCAGGCCCCATAAACCGGGAGATGCGCCACCTCATC
AGTAGCCTCCAGAATCACAACCACCAGCTGAAAGGGGAGGTCCTAAGGTATAAGCGGAAA
CTGAGAGAAGCCCAGTCTGACCTGAACAAGACTCGGCTGCGCAGTGGCAGTGCCCTCCTG
CAGTCTCAGTCCAGTACTGAGGACCCTAAGGACGAGCCTGCAGAGCTAAAACAGGATTCT
GAGGACTTAGCCACCCAGTCTGCTGCATCGAAGGCATCTCAGGAGGAGGTCAACGAAATT
AAGTCCAAACGCGATGAGGAAGAGCGAGAACGAGAAAGGAGGGAGAAAGAGAGGGAGCGA
GAAAGAGAGCGGGAGAAGGAGAAGGAGCGAGAACGAGAGAAGCAGAAACTAAAAGAGTCA
GAAAAAGAGAGAGAGTCTGCTAAGGATAAAGAGAAAGGGAAACATGATGATGGAAGGAAA
AAGGAAGCGGAAATTATCAAACAATTGAAGATTGAACTCAAGAAAGCACAGGAGAGCCAA
AAGGAGATGAAACTGTTGCTGGATATGTACCGCTCTGCCCCAAAGGAGCAGAGAGACAAG
GTTCAGCTGATGGCAGCAGAGAAGAAGTCTAAGGCAGAGTTGGAAGATTTAAGACAAAGA
CTCAAGGATCTGGAGGATAAGGAGAAAAAAGAGAATAAGAAAATGGCTGATGAAGATGCC
TTAAGAAAGATCCGGGCAGTAGAGGAGCAGATAGAATACCTCCAGAAGAAGCTGGCCATG
GCCAAGCAGGAAGAAGAAGCTCTCCTCTCTGAGATGGACGTCACAGGCCAGGCCTTTGAA
GATATGCAGGAGCAAAATATCCGTTTGATGCAGCAGCTGAGGGAGAAGGATGATGCAAAC
TTCAAGCTCATGTCAGAGCGTATCAAATCCAATCAGATCCATAAGCTGCTGAAAGAAGAG
AAGGAGGAGCTGGCAGACCAAGTTTTGACTCTGAAGACTCAGGTTGATGCCCAGTTACAG
GTAGTGAGGAAACTGGAAGAGAAGGAGCACCTGTTGCAGAGCAACATCGGCACAGGGGAG
AAGGAGCTGGGTCTTAGGACCCAGGCCTTGGAGATGAATAAACGCAAGGCAATGGAGGCA
GCCCAGCTTGCAGATGACCTCAAAGCACAGTTGGAGATGGCTCAGAAGAAGCTACATGAT
TTTCAGGATGAGATTGTAGAGAACAGTGTCACCAAAGAAAAAGATATGTTCAATTTCAAA
CGGGCCCAGGAGGACATCTCTAGACTTCGAAGGAAGCTGGAGACCACGAAGAAACCAGAC
AATGTACCCAAATGTGATGAGATTCTGATGGAGGAGATTAAGGACTACAAGGCACGCCTG
ACCTGTCCGTGTTGCAACATGCGTAAAAAGGATGCTGTGCTTACCAAGTGTTTTCATGTT
TTCTGCTTTGAGTGTGTTAAGACCCGCTATGATACCCGCCAGCGCAAATGTCCCAAGTGT
AATGCTGCCTTTGGTGCCAACGATTTCCATCGCATCTACATAGGTTGA
Enzyme 61 GenBank Gene ID BC133334 Link Image
Enzyme 61 GeneCard ID RNF20 Link Image
Enzyme 61 GenAtlas ID Not Available
Enzyme 61 HGNC ID Not Available
Enzyme 61 Chromosome Location Chromosome:9
Enzyme 61 Locus 9q22
Enzyme 61 SNPs SNPJam Report Link Image
Enzyme 61 General References Not Available
Enzyme 61 Metabolite References Not Available