We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Manganese (RMDB01333)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-08-16 14:22:34
Update Date 2009-01-27 15:47:04
Accession Number RMDB01333
Common Name Manganese
Description Manganese is an essential trace nutrient in all forms of life. Physiologically, it exists as an ion in the body. It is concentrated in cell mitochondria, mostly in the pituitary gland, liver, pancreas, kidney, and bone, influences the synthesis of mucopolysaccharides, stimulates hepatic synthesis of cholesterol and fatty acids, and is a cofactor in many enzymes, including arginase and alkaline phosphatase in the liver.
Synonyms
  1. manganese
Chemical IUPAC Name manganese
Chemical Formula [Mn]2+
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Metals
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Essential minerals; Enzyme co-factor
Application
Source
  • Exogenous
Average Molecular Weight 54.938
Monoisotopic Molecular Weight 54.938049
Isomeric SMILES [Mn++]
Canonical SMILES [Mn++]
KEGG Compound ID C00034 Link Image
BioCyc ID MN%2b3 Link Image
BiGG ID Not Available
Wikipedia Link Manganese Link Image
METLIN ID Not Available
PubChem Compound 23930 Link Image
PubChem Substance 3336 Link Image
ChEBI ID 18291 Link Image
CAS Registry Number 7439-96-5
InChI Identifier InChI=1/Mn/q+2
Synthesis Reference Not Available
Melting Point (Experimental) 1244 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 87.2 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 0.23 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Not Available
Not Available
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location Not Available
Biofluid Location
  • Cow_Milk
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 2.292 +/- 0.7 uM
Age N/A
Sex Female
Condition Normal
Breed Not Available
Experimental Condition Not Available
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Proto-oncogene tyrosine-protein kinase Fyn
  2. Activin receptor type-2A
  3. Activin receptor type-2B
  4. Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
  5. Acetyl-CoA carboxylase 1
  6. Activin receptor type-1
  7. Polypeptide N-acetylgalactosaminyltransferase 6
  8. Polypeptide N-acetylgalactosaminyltransferase 1
  9. Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
  10. Cholinephosphotransferase 1
  11. Ethanolaminephosphotransferase 1
  12. U8 snoRNA-decapping enzyme
  13. Diphosphoinositol polyphosphate phosphohydrolase 3-beta
  14. Isocitrate dehydrogenase [NADP], mitochondrial
  15. Endonuclease G, mitochondrial
  16. Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
  17. Polyribonucleotide 5'-hydroxyl-kinase Clp1
  18. Protein phosphatase 1B
  19. Integrin-linked kinase-associated serine/threonine phosphatase 2C
  20. Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
  21. Bis(5'-adenosyl)-triphosphatase
  22. Endoribonuclease Dicer
  23. Nucleoside diphosphate-linked moiety X motif 17
  24. Protein phosphatase 1K, mitochondrial
  25. Cytosol aminopeptidase
  26. TGF-beta receptor type-1
  27. Protein phosphatase 1G
  28. Protein phosphatase 1L
  29. Peroxisomal NADH pyrophosphatase NUDT12
  30. Isocitrate dehydrogenase [NADP] cytoplasmic
  31. Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
  32. Protein phosphatase 1A
  33. Arginase-1
  34. Arginase-2, mitochondrial
  35. Superoxide dismutase [Mn], mitochondrial
  36. Trifunctional purine biosynthetic protein adenosine-3
  37. Beta-1,4-galactosyltransferase 1
  38. Pyruvate carboxylase, mitochondrial
  39. Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  40. Beta-1,4-galactosyltransferase 3
  41. Xaa-Pro aminopeptidase 1
  42. Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  43. Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
  44. UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
  45. UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)
  46. Serine/threonine-protein phosphatase PP1-beta catalytic subunit
  47. Serine/threonine-protein phosphatase 4 catalytic subunit
  48. Oligoribonuclease, mitochondrial
  49. Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
  50. Cytosolic non-specific dipeptidase
  51. Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
  52. Protein prune homolog
  53. N-acetyllactosaminide alpha-1,3-galactosyltransferase
  54. Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
Enzyme 1 [top]
Enzyme 1 ID 141
Enzyme 1 Name Proto-oncogene tyrosine-protein kinase Fyn
Enzyme 1 Synonyms
  1. p59-Fyn
Enzyme 1 Gene Name FYN
Enzyme 1 Protein Sequence >Proto-oncogene tyrosine-protein kinase Fyn
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHGAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
Enzyme 1 Number of Residues 537
Enzyme 1 Molecular Weight 60717.4
Enzyme 1 Theoretical pI 6.65
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in ATP binding
Enzyme 1 Specific Function Implicated in the control of cell growth. Plays a role in the regulation of intracellular calcium levels. Required in brain development and mature brain function with important roles in the regulation of axon growth, axon guidance, and neurite extension. Blocks axon outgrowth and attraction induced by NTN1 by phosphorylating its receptor DDC. May phosphorylate and regulate CLIC5
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 117306509 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A0JNB0 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name FYN_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1614 bp
ATGGGCTGTGTGCAATGTAAGGACAAAGAAGCAACAAAACTGACGGAGGAGAGGGATGGC
AGTCTGAACCAGAGCTCCGGGTACCGCTATGGTACAGACCCCACTCCTCAGCACTACCCC
AGCTTCGGTGTGACCTCCATCCCGAACTACAACAACTTCCACGGGGCCGGGGGCCAAGGA
CTCACCGTCTTTGGGGGTGTGAACTCTTCGTCTCATACTGGGACCTTGCGAACAAGAGGA
GGAACAGGAGTGACCCTGTTTGTGGCCCTTTATGACTATGAAGCACGGACGGAAGATGAC
CTGAGTTTTCACAAAGGAGAAAAATTTCAAATATTGAACAGCTCGGAAGGAGATTGGTGG
GAAGCACGCTCCTTGACAACTGGAGAGACGGGTTACATTCCCAGCAATTATGTGGCTCCA
GTTGACTCCATCCAGGCAGAAGAGTGGTACTTTGGAAAACTCGGCCGGAAAGATGCTGAG
CGACAGCTTTTGTCCTTTGGAAACCCACGGGGTACCTTTCTTATCCGTGAGAGTGAAACC
ACCAAAGGTGCCTATTCACTTTCTATCCGAGACTGGGATGATATGAAAGGAGACCATGTC
AAACATTATAAAATTCGCAAACTTGACAACGGTGGATACTATATTACCACCCGGGCCCAA
TTTGAAACCCTTCAGCAGCTTGTACAACATTACTCAGAGAGAGCTGCAGGCCTCTGCTGC
CGCCTAGTAGTTCCCTGTCACAAAGGGATGCCACGGCTTACCGATCTGTCTGTCAAAACC
AAAGATGTCTGGGAAATCCCTCGAGAATCCCTGCAGTTGATCAAGAGACTGGGAAATGGG
CAGTTTGGGGAAGTATGGATGGGTACCTGGAATGGAAACACAAAAGTAGCCATAAAGACT
CTTAAACCAGGCACAATGTCCCCTGAATCATTCCTTGAGGAGGCGCAGATCATGAAGAAG
TTGAAGCACGACAAACTGGTCCAGCTATATGCCGTGGTGTCCGAGGAGCCCATCTACATC
GTCACCGAGTATATGAATAAAGGAAGTTTACTCGATTTCTTGAAAGATGGGGAAGGAAGG
GCTCTGAAATTACCAAATCTCGTGGACATGGCAGCACAGGTTGCCGCGGGAATGGCGTAC
ATCGAGCGCATGAATTACATCCACAGAGACCTGCGGTCAGCAAACATTCTCGTGGGGAAT
GGACTAATTTGCAAGATCGCCGACTTCGGATTGGCCAGGTTGATCGAGGACAATGAGTAC
ACAGCAAGACAAGGCGCCAAGTTCCCCATCAAGTGGACGGCCCCCGAAGCAGCCCTGTAC
GGGAGGTTCACAATCAAGTCTGACGTGTGGTCTTTTGGAATCTTACTCACAGAGCTGGTC
ACCAAAGGAAGAGTTCCGTACCCAGGCATGAACAACCGGGAGGTGCTGGAGCAGGTGGAG
CGCGGTTACAGGATGCCCTGTCCACAGGACTGCCCCATCTCCCTCCACGAGCTCATGATA
CACTGCTGGAAAAAGGACCCCGAAGAGCGGCCCACTTTCGAGTACCTGCAGGGCTTCCTG
GAAGACTACTTCACCGCAACAGAGCCTCAGTATCAACCCGGGGAAAACCTGTAA
Enzyme 1 GenBank Gene ID BC126591 Link Image
Enzyme 1 GeneCard ID FYN Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:6
Enzyme 1 Locus 6q21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 146
Enzyme 2 Name Activin receptor type-2A
Enzyme 2 Synonyms
  1. Activin receptor type IIA
  2. ACTR-IIA
Enzyme 2 Gene Name ACVR2A
Enzyme 2 Protein Sequence >Activin receptor type-2A
MGAAAKLAFAVFLISCSSGAILGRSETQECIFYNANWERDRTNRTGVESCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNERFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
Enzyme 2 Number of Residues 513
Enzyme 2 Molecular Weight 57951.2
Enzyme 2 Theoretical pI 5.90
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in activin receptor activity
Enzyme 2 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • 1-19
Enzyme 2 Transmembrane Regions
  • 136-161
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 393114 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q28043 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AVR2A_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1542 bp
ATGGGAGCCGCTGCAAAGTTGGCGTTTGCCGTCTTTCTTATCTCTTGTTCTTCAGGTGCT
ATACTTGGTAGATCAGAAACTCAGGAGTGTATTTTCTATAATGCTAATTGGGAAAGAGAT
AGAACGAATCGCACTGGTGTTGAATCCTGTTACGGTGACAAAGATAAACGGCGGCATTGT
TTTGCTACATGGAAGAATATTTCTGGTTCCATTGAAATAGTGAAGCAAGGTTGTTGGCTG
GATGATATCAACTGCTATGACAGGACTGATTGTATAGAAAAAAAAGATAGCCCTGAAGTA
TATTTTTGTTGCTGTGAGGGCAATATGTGTAACGAAAGGTTTTCTTATTTTCCGGAGATG
GAGGTCACACAGCCTACGTCGAATCCAGTAACTCCTAAGCCTCCCTATTACAACATCTTG
CTCTATTCTTTGGTGCCACTTATGTTAATTGCGGGGATTGTCATTTGTGCATTTTGGGTG
TACAGACATCATAAGATGGCTTACCCTCCTGTGCTCGTTCCAACTCAAGACCCAGGACCA
CCCCCACCTTCTCCATTACTAGGTTTGAAGCCATTACAGTTACTAGAAGTGAAAGCAAGA
GGAAGATTTGGTTGTGTGTGGAAAGCCCAGTTACTCAATGAATATGTGGCTGTGAAAATA
TTTCCAATACAGGATAAACAGTCATGGCAGAATGAATATGAAGTCTATAGTTTGCCTGGA
ATGAAGCATGAGAACATACTGCAGTTCATTGGTGCAGAGAAACGAGGCACCAGTGTTGAT
GTGGATCTTTGGCTAATCACAGCATTTCATGAAAAGGGTTCACTATCAGACTTTCTTAAG
GCTAATGTGGTCTCTTGGAATGAATTGTGTCATATTGCAGAAACCATGGCTAGAGGATTG
GCATATTTACATGAGGATATACCTGGCCTAAAAGATGGCCACAAACCCGCCATATCTCAC
AGGGACATCAAAAGTAAAAATGTGCTGTTGAAAAACAATCTGACAGCCTGCATTGCTGAC
TTTGGGTTGGCGTTGAAGTTTGAGGCTGGCAAGTCTGCAGGTGATACTCATGGACAGGTG
GGTACCCGAAGGTATATGGCTCCAGAGGTGTTAGAGGGTGCTATCAACTTCCAAAGGGAT
GCATTTTTGAGGATAGATATGTACGCCATGGGATTAGTCCTGTGGGAACTGGCTTCTCGC
TGTACTGCTGCAGATGGACCTGTAGATGAATACATGCTGCCATTTGAGGAAGAAATTGGC
CAGCATCCCTCTCTTGAAGACATGCAGGAAGTTGTTGTGCATAAAAAAAAGAGGCCTGTT
TTAAGAGATTATTGGCAGAAACATGCTGGAATGGCAATGCTCTGTGAAACGATAGAAGAA
TGTTGGGATCACGATGCAGAAGCCAGGTTATCAGCTGGATGTGTAGGTGAAAGAATTACT
CAGATGCAAAGACTAACAAATATCATTACCACAGAGGACATTGTAACAGTGGTCACGATG
GTGACAAATGTTGACTTTCCTCCCAAAGAATCTAGTCTATGA
Enzyme 2 GenBank Gene ID L21717 Link Image
Enzyme 2 GeneCard ID ACVR2A Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 2q22.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 152
Enzyme 3 Name Activin receptor type-2B
Enzyme 3 Synonyms
  1. Activin receptor type IIB
  2. ACTR-IIB
Enzyme 3 Gene Name ACVR2B
Enzyme 3 Protein Sequence >Activin receptor type-2B
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGERDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPVGGLSLIALLAFWMYRHRKPPYGHADIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSSLEAELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPAIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
Enzyme 3 Number of Residues 512
Enzyme 3 Molecular Weight 57568.2
Enzyme 3 Theoretical pI 5.60
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in activin receptor activity
Enzyme 3 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • 1-18
Enzyme 3 Transmembrane Regions
  • 138-158
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 1621097 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q95126 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name AVR2B_BOVIN Link Image
Enzyme 3 PDB ID 1NYU Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1539 bp
ATGACGGCGCCCTGGGCGGCCCTCGCCCTCCTTTGGGGATCGCTGTGCGCCGGTTCGGGG
CGCGGGGAGGCCGAGACACGGGAGTGCATCTACTACAACGCCAACTGGGAGCTGGAGCGC
ACCAACCAGAGCGGCCTGGAGCGCTGCGAGGGCGAGCGGGACAAGCGGCTGCACTGCTAC
GCCTCCTGGCGCAACAGCTCGGGCACCATCGAGCTCGTCAAGAAAGGCTGCTGGCTGGAC
GACTTCAACTGCTACGACAGGCAGGAGTGCGTGGCCACCGAGGAGAACCCCCAGGTGTAC
TTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACCTGCCCGAGGCGGGC
GGCCCAGAAGTCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACTGTGCTGGCC
TACTCGCTGCTGCCCGTCGGGGGCCTCTCCCTCATCGCCCTGCTGGCCTTCTGGATGTAC
CGACATCGCAAGCCCCCCTACGGCCACGCGGACATCCACGAGGACCCTGGACCTCCACCC
CCGTCCCCTCTGGTGGGCCTGAAGCCTCTGCAACTGCTGGAGATCAAGGCTCGGGGGCGC
TTTGGTTGTGTCTGGAAGGCGCAGCTCATGAACGACTTCGTGGCTGTCAAGATCTTCCCA
CTCCAGGACAAGCAGTCGTGGCAGAGTGAGCGGGAGATCTTCAGCACGCCTGGCATGAAG
CACGAGAACCTGCTGCAGTTCATTGCCGCTGAGAAGCGAGGCTCCAGCCTGGAGGCAGAG
CTGTGGCTCATCACGGCCTTCCACGACAAGGGCTCCCTCACGGATTACCTCAAGGGGAAC
ATCATCACATGGAACGAACTGTGTCACGTGGCAGAGACGATGTCTAGAGGCCTCTCATAC
CTACACGAGGATGTGCCCTGGTGCCGGGGCGAGGGCCACAAGCCATCTATTGCCCACAGG
GACTTTAAGAGCAAGAATGTATTGCTGAAGAGTGACCTCACTGCTGTGCTGGCTGACTTT
GGCCTGGCTGTTCGGTTTGAGCCAGGGAAACCTCCGGGGGACACTCACGGGCAGGTGGGC
ACGCGGCGGTACATGGCCCCCGAGGTGCTCGAGGGAGCCATCAACTTCCAGAGAGACGCC
TTTCTGCGCATCGACATGTACGCCATGGGGCTGGTGCTGTGGGAGCTCGTGTCCCGCTGC
AAAGCTGCCGATGGACCTGTGGATGAGTACATGCTGCCTTTTGAGGAGGAGATCGGCCAG
CACCCGTCACTGGAGGAGCTGCAGGAGGTGGTGGTGCACAAGAAGATGCGGCCCGCCATC
AAGGATCACTGGCTGAAACACCCGGGCCTGGCCCAGCTCTGCGTGACCATCGAGGAGTGC
TGGGACCACGATGCAGAGGCTCGCCTGTCTGCGGGCTGTGTGGAGGAGCGAGTGTCCCTG
ATCCGGAGGTCGGTCAACGGCACTACCTCGGACTGTCTTGTCTCCCTGGTGACCTCCGTC
ACCAATGTGGACCTGCCCCCGAAGGAGTCGAGCATCTAA
Enzyme 3 GenBank Gene ID U57707 Link Image
Enzyme 3 GeneCard ID ACVR2B Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:3
Enzyme 3 Locus 3p22
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 177
Enzyme 4 Name Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
Enzyme 4 Synonyms
  1. E-NPP 2
  2. Extracellular lysophospholipase D
  3. LysoPLD
  4. Autotaxin
Enzyme 4 Gene Name ENPP2
Enzyme 4 Protein Sequence >Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
MARRRSCQLHQVISLFTFAVGVNICLGVTANRIKRAEGWGEGPPTVLSDSPSINISGSCK
GRCFELQEAGPPDCRCDNLCKSYSSCCLDFDELCLKTAGGWECTKDRCGEVRNEDHACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKTPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
HFNLRGREKFNHRWWGGQPLWITATKQGVIAGTFFWPVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLRDIDKTVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDIILVPGTLGRIRPKFNNHAKYDPKVIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDVHLLVERRWHVARKPLEVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTVPEEVTRPNYPGVMYLQSDFDLGCTCDDKAEPKNKLDELNKHLHIKESTEAETRKFR
GSKNEIKENVNGNFEPRKERHLLYGRPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYT
VSKQADVSDIPAHLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYGFLFPPYLSSSPEAKYD
AFLVTNMVPMYPAFKRIWNYFQRVLVKKYASERNGVNVISGPIFDYDYDGLHDTQDKIKQ
YVEGSSVPVPTHYYSILTSCLDFTQPADRCDGPLSVSAFVLPHRPDNDESCNSSEDESKW
VEELLKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLQTYESEI
Enzyme 4 Number of Residues 888
Enzyme 4 Molecular Weight 101715.9
Enzyme 4 Theoretical pI 7.56
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in alkylglycerophosphoethanolamine phosphodies
Enzyme 4 Specific Function Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility- related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-27
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 119224048 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID A1A4K5 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name ENPP2_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >2667 bp
ATGGCCAGGAGACGCTCCTGCCAGCTCCATCAGGTGATATCTCTGTTCACTTTTGCCGTC
GGTGTCAATATCTGCTTAGGAGTCACAGCAAATCGAATTAAGAGGGCAGAAGGATGGGGT
GAAGGCCCTCCTACAGTGTTATCAGACTCCCCCTCGATCAACATCTCTGGGTCTTGCAAG
GGCAGATGCTTTGAACTTCAAGAGGCTGGACCCCCTGATTGTCGATGTGACAACTTGTGT
AAGAGCTATAGCAGCTGCTGCCTTGACTTTGATGAGCTCTGCTTGAAGACAGCTGGTGGC
TGGGAGTGTACCAAGGACAGATGCGGAGAAGTAAGAAATGAAGACCATGCTTGTCACTGC
TCGGAGGACTGCTTGGCCCGGGGAGACTGTTGCACTAATTACCAAGTGGTTTGCAAAGGA
GAGTCTCACTGGGTGGATGATGACTGTGAGGAAATAAAGACCCCAGAATGCCCTGCAGGG
TTCGTTCGCCCTCCGCTGATCATCTTCTCTGTGGACGGTTTCCGCGCATCGTACATGAAG
AAAGGCAGCAAGGTCATGCCTAACATCGAAAAGCTGAGGTCTTGTGGCACTCACTCCCCC
TACATGAGGCCTGTGTACCCGACGAAAACTTTCCCTAACTTATACACTCTGGCCACTGGG
CTGTATCCAGAATCACATGGAATTGTTGGCAATTCCATGTATGATCCTGTTTTTGATGCA
CATTTCAACCTTCGAGGGCGAGAGAAATTTAACCATAGGTGGTGGGGAGGTCAACCGCTA
TGGATTACAGCCACGAAGCAAGGGGTGATCGCTGGGACATTCTTCTGGCCTGTGGTGATC
CCCCACGAGCGGAGAATACTGACCATCCTGCAGTGGCTGACCCTGCCGGACCACGAAAGG
CCTTCAGTCTATGCCTTCTATTCCGAACAACCTGATTTCTCTGGACACAAGTATGGCCCC
TTTGGCCCTGAGATGACGAATCCTCTGAGGGACATTGACAAAACCGTGGGGCAGTTAATG
GATGGATTGAAGCAACTGAAGCTGCACCGCTGCGTGAATGTCATCTTCGTTGGAGACCAT
GGAATGGAAGATGTCACATGTGATAGAACAGAATTCTTGAGCAATTACCTGACTAATGTG
GATGATATTATTTTAGTGCCAGGAACTCTAGGAAGAATTCGACCCAAATTCAACAATCAT
GCTAAATATGACCCGAAAGTCATTATTGCTAATCTCACGTGTAAAAAACCAGACCAGCAC
TTTAAGCCTTACTTGAAACAGCACCTTCCCAAACGTTTGCACTACGCCAACAACAGAAGG
ATCGAAGACGTCCATTTACTGGTGGAGCGCAGATGGCACGTCGCAAGGAAACCTTTGGAG
GTTTATAAGAAACCATCAGGAAAATGTTTTTTCCAGGGAGACCACGGATTTGATAACAAG
GTCAACAGTATGCAGACTGTTTTTGTAGGTTATGGCCCAACATTTAAGTACAAGACCAAA
GTGCCTCCATTTGAAAACATTGAACTTTACAACGTTATGTGCGATCTCCTGGGATTGAAG
CCAGCTCCAAATAACGGGACCCACGGGAGTCTGAACCATCTCCTGCGTACCAACACCTTC
AGACCGACTGTGCCAGAGGAAGTCACCAGACCCAATTACCCAGGGGTTATGTACCTTCAG
TCCGATTTTGACCTGGGCTGTACCTGTGATGATAAGGCAGAGCCAAAGAACAAATTGGAT
GAACTCAACAAACACCTTCATATAAAAGAGTCCACAGAAGCTGAAACCAGGAAATTCAGA
GGCAGCAAAAATGAAATCAAGGAAAACGTTAATGGAAATTTTGAACCTAGAAAAGAGAGA
CATCTCCTCTATGGACGGCCTGCCGTGCTCTATCGGACTAGATATGATATCTTATATCAC
ACTGACTTTGAAAGCGGTTATAGTGAAATATTTCTAATGCCACTCTGGACATCATACACT
GTTTCCAAACAGGCTGACGTCTCTGACATCCCTGCACACCTGACCAACTGTGTCCGGCCC
GACGTCCGCGTTTCTCCGAGTTTCAGTCAGAGCTGTTTGGCCTACAAAAATGATAAACAG
ATGTCCTATGGATTCCTCTTTCCTCCCTATCTGAGCTCGTCCCCAGAAGCTAAATATGAT
GCATTCCTTGTAACCAATATGGTTCCAATGTATCCTGCTTTTAAACGCATCTGGAATTAT
TTCCAAAGGGTTCTGGTGAAGAAATATGCTTCAGAAAGAAATGGAGTTAATGTGATAAGT
GGACCAATCTTTGACTATGACTACGATGGCTTACACGACACACAAGACAAAATCAAACAG
TACGTGGAGGGCAGCTCCGTCCCCGTGCCCACCCACTACTACAGCATCCTCACCAGCTGC
CTGGACTTCACGCAGCCTGCCGACCGCTGCGACGGGCCGCTCTCCGTGTCCGCCTTCGTG
CTGCCCCACAGGCCCGACAACGACGAGAGCTGCAACAGCTCAGAGGACGAGTCGAAATGG
GTGGAAGAGCTTCTCAAGATGCACACAGCACGGGTGCGGGACATCGAGCATCTCACCAGC
CTGGACTTCTTCCGCAAGACCAGCCGCAGCTACCCAGAAATTCTGACCCTAAAGACGTAC
CTGCAGACGTATGAGAGCGAGATCTAG
Enzyme 4 GenBank Gene ID BC126631 Link Image
Enzyme 4 GeneCard ID ENPP2 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:8
Enzyme 4 Locus 8q24.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 204
Enzyme 5 Name Acetyl-CoA carboxylase 1
Enzyme 5 Synonyms
  1. ACC-alpha
  2. Biotin carboxylase
Enzyme 5 Gene Name ACACA
Enzyme 5 Protein Sequence >Acetyl-CoA carboxylase 1
MDEPSSLAKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVSSDTLS
DLGISSLQDGLALHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLCVDWHENDFSKRILNVPQELYEKGYVKDVDDGLKA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLARMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQLNRIGTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSISNFLHSLERGQV
LTAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDV
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVLRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLTAAESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTRKNLLVTMLIDQLCGRGPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRLNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSP
PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDSLAAMFREFTQQNKATLV
EHGIRRLTFLVAQKDFRKQVNYEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDQLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSSQA
FLPPPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTLKSPEYPDGRDIIVI
GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVD
PEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGS
GMIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVYSSVPLLNSKDPID
RVIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSVAE
RKELESKLKEREEFLLPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTE
EDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILST
MDSPST
Enzyme 5 Number of Residues 2346
Enzyme 5 Molecular Weight 265300.6
Enzyme 5 Theoretical pI 6.35
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Lipid transport and metabolism
Enzyme 5 Specific Function Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions:biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase
Enzyme 5 Pathways
  • Lipid metabolism
  • malonyl-CoA biosynthesis
  • malonyl-CoA from acetyl-CoA:step 1/1
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 6006405 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q9TTS3 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name ACACA_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence Not Available
Enzyme 5 GenBank Gene ID AJ132890 Link Image
Enzyme 5 GeneCard ID ACACA Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 17q21
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 205
Enzyme 6 Name Activin receptor type-1
Enzyme 6 Synonyms
  1. Activin receptor type I
  2. ACTR-I
  3. Serine/threonine-protein kinase receptor R1
  4. SKR1
Enzyme 6 Gene Name ACVR1
Enzyme 6 Protein Sequence >Activin receptor type-1
MVDGVMILPVLVMIAFPFPSMEDEKPKVNPKLYMCVCEGLSCGDEAHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
Enzyme 6 Number of Residues 509
Enzyme 6 Molecular Weight 57189.5
Enzyme 6 Theoretical pI 7.36
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in activin receptor activity, type I
Enzyme 6 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta. May also bind activin
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • 1-20
Enzyme 6 Transmembrane Regions
  • 124-146
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 1381584 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q28041 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name ACVR1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1530 bp
ATGGTGGATGGAGTGATGATTCTTCCTGTGCTCGTGATGATTGCTTTCCCTTTCCCTAGT
ATGGAAGATGAGAAGCCCAAGGTAAACCCCAAGCTTTACATGTGTGTGTGTGAAGGCCTC
TCCTGTGGGGATGAGGCCCACTGTGAAGGCCAGCAGTGCTTTTCCTCGCTGAGCATAAAT
GATGGCTTCCACGTCTACCAGAAAGGCTGCTTCCAGGTCTACGAGCAGGGGAAGATGACC
TGTAAGACCCCGCCGTCACCTGGCCAGGCTGTGGAGTGCTGCCAAGGGGACTGGTGTAAC
AGGAACATCACGGCCCAGCTGCCTACTAAAGGGAAATCTTTTCCTGGAACACAGAATTTC
CACTTGGAGGTTGGCCTCATCATTTTGTCTGTAGTGTTCGCAGTATGCCTTCTAGCCTGC
CTATTGGGAGTTGCTCTCCGAAAATTTAAAAGGCGCAATCAAGAACGCCTCAACCCCAGA
GATGTGGAATATGGCACCATTGAAGGACTCATCACCACCAACGTTGGAGACAGCACTTTA
GCAGATTTATTGGATCATTCATGTACATCGGGAAGCGGCTCTGGCCTTCCTTTTCTGGTA
CAGAGAACAGTGGCCCGTCAGATCACACTGCTGGAGTGTGTTGGGAAGGGCAGGTATGGC
GAGGTGTGGAGGGGCAGCTGGCAAGGGGAGAACGTCGCTGTGAAGATCTTTTCCTCCCGG
GATGAGAAGTCGTGGTTTAGGGAAACAGAATTGTACAACACTGTGATGCTGAGGCATGAA
AATATCTTAGGTTTCATTGCTTCAGACATGACATCAAGACACTCCAGTACACAGTTGTGG
TTGATCACACATTATCATGAAATGGGATCGCTGTACGACTACCTTCAGCTTACTACTCTG
GATACAGTGAGCTGCCTGAGAATAGTGCTGTCCATAGCGAGCGGTCTCGCACATTTGCAC
ATAGAGATCTTTGGGACCCAAGGGAAACCGGCCATTGCTCACCGAGATCTAAAAAGCAAA
AACATCCTGGTTAAGAAGAATGGACAGTGTTGCATAGCAGATTTGGGCCTGGCAGTCATG
CATTCCCAGAGCACCAATCAGCTCGATGTGGGGAACAACCCCCGTGTGGGCACCAAACGC
TACATGGCCCCCGAAGTTCTTGATGAAACTATCCAGGTGGATTGTTTCGATTCTTACAAG
AGAGTCGATATTTGGGCCTTTGGACTTGTCTTGTGGGAGGTGGCCAGGCGGATGGTGAGC
AATGGTATTGTGGAGGATTACAAGCCACCATTCTATGATGTGGTTCCCAATGACCCAAGT
TTTGAAGATATGAGGAAGGTAGTCTGTGTGGATCAACAGAGGCCTAACATACCCAACAGA
TGGTTCTCAGACCCGACATTAACCTCCCTGGCCAAGCTGATGAAAGAATGCTGGTATCAA
AATCCATCTGCCAGACTCACAGCCCTGCGTATCAAAAAGACTTTGACCAAAATTGATAAT
TCCCTAGACAAATTGAAAACTGACTGTTGA
Enzyme 6 GenBank Gene ID U58095 Link Image
Enzyme 6 GeneCard ID ACVR1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 2q23-q24
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 381
Enzyme 7 Name Polypeptide N-acetylgalactosaminyltransferase 6
Enzyme 7 Synonyms
  1. Polypeptide GalNAc transferase 6
  2. pp-GaNTase 6
  3. GalNAc-T6
  4. Protein-UDP acetylgalactosaminyltransferase 6
  5. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
Enzyme 7 Gene Name GALNT6
Enzyme 7 Protein Sequence >Polypeptide N-acetylgalactosaminyltransferase 6
MRLLRRRHMAVRLVMVGSAFVLFLFILQRDVSGREQATEKPWLRSLVSQKDHVLDLMLGA
VHNLRDSMPKFQIRAPEPQQTLASTNQSCLPGFYTPAELKPFWERPPQDPNGPGADGKAF
QKKEWTPQETQEKEEGYKKHCFNAFASDRISLQRALGPDTRPPECVDQKFRRCPPLPATS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTDEYLKEPLERYVKQLQVVQV
VRQQERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDETVVVSPNIVT
IDLNTFEFSKPVQRGRVQSRGNFDWSLTFGWEVLPAREKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
INVIARNQVRLAEVWMDGYKEIFYRRNLQAAQMAREKSFGDISERLQLRERLNCHNFSWF
LDNVYPEMFVPDLKPTFFGALKNLGVDHCLDVGENNNGGKPLILYTCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHASAGTLGLRSCHFTGKNSQVPKDEEWEFTQDQLIRNSGSGTCLTS
KDKKPVMATCNPSDPHQHWLFI
Enzyme 7 Number of Residues 622
Enzyme 7 Molecular Weight 71137.8
Enzyme 7 Theoretical pI 8.07
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Cell wall/membrane/envelope biogenesis
Enzyme 7 Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D- galactosamine residue to a serine or threonine residue on the protein receptor. May participate in synthesis of oncofetal fibronectin. Has activity toward Muc1a, Muc2, EA2 and fibronectin peptides
Enzyme 7 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 9-28
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 59857821 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q5EA41 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name GALT6_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1869 bp
ATGAGGCTGCTCCGCAGACGCCACATGGCCGTGCGCCTGGTCATGGTGGGCAGCGCCTTC
GTGCTCTTTCTCTTCATCCTGCAGAGGGACGTAAGTGGCAGGGAGCAGGCCACAGAGAAG
CCATGGCTGAGGTCCTTGGTGAGCCAGAAGGACCACGTCTTGGACCTCATGCTGGGGGCC
GTGCACAACCTCAGGGACTCGATGCCCAAGTTCCAGATCAGGGCTCCAGAGCCCCAGCAG
ACACTGGCCTCCACCAACCAGTCCTGCCTCCCAGGTTTCTACACCCCAGCTGAGCTGAAG
CCATTCTGGGAACGGCCGCCACAGGACCCCAATGGCCCTGGGGCGGATGGGAAGGCGTTT
CAGAAGAAAGAGTGGACGCCCCAGGAGACCCAGGAAAAGGAAGAGGGCTATAAGAAGCAC
TGCTTCAATGCCTTTGCCAGTGACCGCATCTCCCTGCAGAGGGCCCTGGGGCCGGACACC
CGACCCCCTGAGTGTGTCGACCAGAAGTTCCGGCGCTGCCCCCCGCTGCCTGCCACCAGC
GTCATCATTGTGTTCCACAATGAGGCCTGGTCCACTCTGCTGCGGACGGTGTACAGCGTC
CTGCACACCACCCCTGCCATCCTGCTGAAGGAGATCATTCTGGTAGATGATGCCAGCACG
GACGAGTACTTGAAGGAGCCCCTGGAGCGGTACGTGAAGCAGCTGCAGGTGGTGCAGGTG
GTGCGGCAGCAGGAGAGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCC
CAGGCGGAGGTGCTCACCTTCCTGGATGCCCACTGTGAGTGCTTCCACGGCTGGCTAGAG
CCACTCCTGGCTCGCATCGCCGAGGACGAGACGGTGGTGGTGAGCCCAAACATCGTCACC
ATTGACCTGAACACTTTTGAGTTCTCCAAGCCTGTCCAGAGGGGCCGAGTCCAGAGTCGG
GGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAGGTTTTACCGGCACGAGAGAAGCAG
AGGCGCAAGGATGAGACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCC
ATCTCCAAGTCCTACTTTGAGCACATCGGTACCTATGATAACCAGATGGAGATCTGGGGA
GGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGCGGCGGCCAGCTAGAGATTATC
CCCTGCTCTGTGGTCGGACACGTGTTCCGTACCAAGAGCCCCCACACCTTCCCCAAGGGC
ATCAATGTCATTGCTCGCAACCAAGTGCGCCTGGCTGAGGTCTGGATGGATGGCTACAAG
GAGATTTTCTACAGGAGAAATCTGCAGGCAGCACAGATGGCCCGAGAGAAATCCTTTGGC
GACATTTCGGAACGACTGCAGCTGAGGGAGCGACTAAACTGTCACAACTTTTCCTGGTTC
CTGGACAACGTTTACCCGGAGATGTTTGTCCCTGACCTGAAGCCCACCTTCTTTGGAGCT
CTCAAGAACCTCGGCGTGGATCACTGTCTGGATGTGGGAGAGAACAACAACGGGGGAAAG
CCCCTCATCCTGTACACCTGCCATGGCCTCGGTGGCAACCAGTACTTTGAGTACACAACC
CAGAGAGACCTTCGCCACAACATCGCAAAGCAGCTGTGTCTACATGCCAGTGCTGGCACT
CTGGGCCTTAGGAGCTGTCACTTCACCGGCAAGAATAGCCAAGTGCCCAAGGATGAGGAA
TGGGAATTCACCCAGGATCAACTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCC
AAAGACAAAAAGCCAGTCATGGCCACCTGCAACCCCAGTGATCCCCACCAGCACTGGCTC
TTCATTTAG
Enzyme 7 GenBank Gene ID BT020728 Link Image
Enzyme 7 GeneCard ID GALNT6 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 12q13
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 382
Enzyme 8 Name Polypeptide N-acetylgalactosaminyltransferase 1
Enzyme 8 Synonyms
  1. Protein-UDP acetylgalactosaminyltransferase 1
  2. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
  3. Polypeptide GalNAc transferase 1
  4. pp-GaNTase 1
  5. GalNAc-T1
  6. Polypeptide N-acetylgalactosaminyltransferase 1 soluble form
Enzyme 8 Gene Name GALNT1
Enzyme 8 Protein Sequence >Polypeptide N-acetylgalactosaminyltransferase 1
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYP
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDEDSQVPSIRDC
SGSRSQQWLLRNVTLPEIF
Enzyme 8 Number of Residues 559
Enzyme 8 Molecular Weight 64191.5
Enzyme 8 Theoretical pI 7.77
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in calcium ion binding
Enzyme 8 Specific Function Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D- galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7
Enzyme 8 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • 9-28
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 289412 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q07537 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name GALT1_BOVIN Link Image
Enzyme 8 PDB ID 1XHB Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1680 bp
ATGAGAAAATTTGCATACTGCAAGGTGGTCCTAGCCACCTCCTTGATTTGGGTACTCTTG
GATATGTTCCTGCTGCTTTACTTCAGTGAATGCAACAAATGTGATGAAAAAAAAGAGAGA
GGACTTCCTGCTGGGGATGTTCTAGAGCCAGTACAAAAGCCTCATGAAGGTCCTGGAGAA
ATGGGGAAACCAGTCGTCATTCCTAAAGAGGATCAAGAAAAGATGAAAGAGATGTTTAAA
ATCAATCAGTTCAATTTAATGGCAAGTGAGATGATTGCACTCAACAGATCTCTACCAGAT
GTTAGATTAGAAGGGTGTAAAACAAAGGTGTATCCAGATAACCTTCCTACAACCAGTGTG
GTGATTGTTTTCCACAATGAGGCTTGGAGCACACTTCTGCGAACTGTCCATAGCGTCATT
AATCGCTCACCAAGGCACATGCTAGAAGAAATTGTTCTAGTAGATGATGCCAGTGAAAGA
GACTTTTTAAAAAGACCTCTAGAGAGTTACGTGAAAAAATTAAAAGTACCCGTTCACGTC
ATTCGAATGGAGCAGCGTTCTGGATTGATCAGAGCTAGGTTAAAAGGTGCTGCTGTGTCT
AAAGGCCAAGTGATCACCTTTTTAGACGCGCACTGTGAGTGCACAGTGGGGTGGCTGGAG
CCTCTCTTAGCCAGGATCAAACATGACAGGAAGACAGTGGTCTGTCCCATCATAGATGTG
ATCAGTGATGACACTTTCGAGTACATGGCAGGTTCTGACATGACCTATGGCGGGTTCAAC
TGGAAGCTCAACTTTCGCTGGTATCCTGTTCCCCAAAGAGAAATGGACAGAAGGAAAGGT
GATCGGACTCTTCCTGTGAGAACACCTACAATGGCAGGAGGCCTTTTTTCAATAGACAGA
GATTACTTTCAGGAAATTGGAACATATGATGCTGGAATGGATATTTGGGGAGGAGAAAAC
CTAGAAATTTCCTTTAGGATTTGGCAGTGTGGAGGAACTTTGGAGATTGTTACTTGCTCA
CATGTTGGACATGTGTTTCGGAAAGCTACACCCTACACGTTTCCAGGAGGCACGGGGCAG
ATTATCAATAAAAATAACAGACGACTTGCAGAAGTATGGATGGATGAATTCAAGAATTTC
TTCTATATAATTTCTCCAGGTGTTACAAAGGTAGATTATGGAGATATATCATCAAGACTT
GGTCTAAGGCACAAACTCCAATGCAGACCATTCTCTTGGTACCTAGAGAATATTTATCCT
GATTCTCAGATTCCTCGTCACTATTTCTCTTTGGGAGAGATACGAAATGTGGAAACAAAT
CAGTGTCTAGATAACATGGCTAGAAAAGAGAATGAAAAAGTTGGAATTTTTAACTGTCAT
GGTATGGGAGGTAATCAGGTTTTCTCTTACACTGCCAACAAAGAAATTAGAACAGATGAC
CTTTGCTTGGATGTCTCCAAACTTAATGGCCCAGTCACAATGCTCAAATGCCACCACCTA
AAAGGCAACCAGCTTTGGGAGTATGACCCGGTGAAGTTGACCCTGCAGCATGTGAACAGT
AACCAGTGCCTGGACAAAGCCACAGACGAGGACAGCCAGGTGCCCAGCATCAGAGACTGC
AGCGGAAGCCGATCCCAGCAGTGGCTTCTTCGGAACGTCACCCTTCCAGAAATATTCTGA
Enzyme 8 GenBank Gene ID L07780 Link Image
Enzyme 8 GeneCard ID GALNT1 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 18q12.1
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 387
Enzyme 9 Name Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
Enzyme 9 Synonyms
  1. ATP-dependent dihydroxyacetone kinase
  2. DHA kinase
  3. Glycerone kinase
  4. FAD-AMP lyase (cyclizing)
  5. FAD-AMP lyase (cyclic FMN forming)
  6. FMN cyclase
Enzyme 9 Gene Name DAK
Enzyme 9 Protein Sequence >Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)
MTSKKLVNSVAGCADDALAGLVACNPSLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGL
AREQARAEGIPVEMVVVGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEITDR
VSVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRRIKMATANEIVAL
MLDHMTSSSNASHVPVPPGSSVVLMVNNLGGLSFLELGIIADAAVCSLEGHGVKIARALV
GTFMSALEMPGVSLTLLLVDEPLLKLIDAETTASAWPNVAKVWVTGRKRSRAAPTEPLAA
PDSTTAAGEASKQMVLVLEWVCTTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIXGWLK
EGPPPASPAQLLSKLSFLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLPAWSAAMDAGLE
AMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGANMLQILTKAVKSAEAAAEATKNMEAG
AGRASYISSARLDQPDPGAVAAAAILRAILEVLQSQGA
Enzyme 9 Number of Residues 578
Enzyme 9 Molecular Weight 59068.6
Enzyme 9 Theoretical pI 6.85
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Carbohydrate transport and metabolism
Enzyme 9 Specific Function Catalyzes both the phosphorylation of dihydroxyacetone and the splitting of ribonucleoside diphosphate-X compounds among which FAD is the best substrate
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 61553673 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q58DK4 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name DHAK_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1737 bp
ATGACCTCCAAGAAGCTAGTGAACTCAGTGGCAGGCTGTGCTGACGACGCTCTTGCCGGC
CTGGTGGCCTGCAACCCCAGCCTACAGCTCCTGCAGGGCCACCGCGTGGCCCTCCGTTCT
GACCTGGACAGTCTCAAGGGCCGGGTGGCCCTACTGTCGGGTGGGGGCTCCGGCCATGAG
CCTGCCCATGCTGGTTTCATAGGGAAGGGGATGCTGACGGGGGTCATCGCGGGAGCCGTG
TTCACCTCCCCGGCAGTGGGCAGCATCCTGGCGGCTATCAGGGCCGTGGCCCAGGCAGGC
ACAGTGGGGACCCTCCTCATCGTGAAGAACTACACTGGGGACCGACTCAACTTCGGCCTG
GCCCGGGAGCAGGCCCGGGCGGAGGGCATCCCTGTGGAGATGGTGGTTGTCGGGGACGAC
AGTGCCTTCACCGTCCTGAAGAAGGCGGGCCGGCGCGGGCTCTGTGGCACAGTGCTCATA
CACAAGGTGGCGGGTGCTCTGGCCGAGGCAGGTGTGGGACTCGAGGAGATCACAGATCGG
GTGAGCGTCGTCGCCAAGGCCATGGGAACCCTGGGAGTGAGCTTGTCCTCTTGCAGCGTC
CCTGGTTCTAAACCCACTTTTGAGCTCTCAGCTGATGAGGTGGAGCTGGGGCTGGGGATC
CATGGGGAGGCTGGCGTGCGCCGGATAAAGATGGCGACTGCCAACGAGATTGTGGCGCTC
ATGCTGGACCACATGACGAGCTCCTCCAACGCATCCCACGTGCCTGTGCCACCCGGCTCC
TCAGTAGTGCTGATGGTCAACAACCTGGGTGGCCTGTCGTTCCTGGAACTGGGCATCATA
GCCGACGCCGCCGTCTGCTCTCTGGAGGGCCACGGGGTGAAGATCGCCCGTGCCCTAGTG
GGCACCTTCATGTCAGCCCTGGAGATGCCTGGCGTTTCTCTCACCCTCCTGCTGGTGGAT
GAGCCCCTCCTGAAACTGATAGATGCTGAAACCACTGCCTCGGCCTGGCCTAACGTGGCC
AAGGTCTGGGTGACTGGGCGGAAGCGGAGCCGGGCCGCCCCCACGGAGCCCCTGGCGGCC
CCTGACTCCACTACTGCAGCAGGTGAAGCCTCAAAGCAGATGGTACTTGTGCTGGAGTGG
GTGTGCACCACCCTCCTGGGCCTGGAGGAACATCTGAACGCCCTGGACCGTGCTGCCGGT
GATGGAGACTGTGGCACCACCCACAGCCGTGCAGCCAGAGCGATTCANGGGTGGCTAAAG
GAGGGCCCACCCCCAGCCAGCCCTGCCCAGCTACTCTCCAAATTGTCCTTCCTGCTACTG
GAGAAGATGGGAGGCTCCTCAGGGGCACTCTACGGCCTGTTCCTGACTGCGGCGGCCCAG
CCACTCAAGGCCAAGACTGACCTCCCGGCCTGGTCTGCTGCCATGGATGCCGGCCTGGAG
GCCATGCAGAAGTATGGAAAGGCTGCCCCAGGTGACAGGACTATGCTGGATTCTCTGTGG
GCAGCAGGACAGGAGCTCCAAGCCTGGAAGAGCCCAGGGGCCAATATGCTCCAGATTCTG
ACCAAGGCTGTCAAGAGTGCAGAAGCTGCAGCCGAGGCCACCAAGAACATGGAAGCTGGA
GCTGGAAGAGCCAGTTACATCAGCTCTGCGCGCCTGGATCAGCCAGACCCCGGGGCGGTG
GCAGCCGCGGCCATTCTGCGTGCCATCCTGGAGGTCTTGCAGAGTCAGGGTGCGTGA
Enzyme 9 GenBank Gene ID BT021593 Link Image
Enzyme 9 GeneCard ID DAK Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 11q12.2
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 390
Enzyme 10 Name Cholinephosphotransferase 1
Enzyme 10 Synonyms
  1. Diacylglycerol cholinephosphotransferase 1
Enzyme 10 Gene Name CHPT1
Enzyme 10 Protein Sequence >Cholinephosphotransferase 1
MAAGAGARPAPRWLKALTEPLSAAQLRRLEEHRYTAAGVSLLEPPLQLYWTWLLQWIPLW
MAPNSITLLGLAINMLTTLVLISYCPTVTEEAPYWTYLLCALGLFIYQSLDAIDGKQARR
TNSCSPLGELFDHGCDSLSTVFMAVGASIAVRLGTHPDWLFFCSFIGMFMFYCAHWQTYV
SGVLRFGKVDVTEIQIALVIVFVLSTFGGATMWDYTIPILEIKLKILPVLGVVGGAIFSC
SNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGIIIILAIMIYKKSATNLFEKHPCLYTLM
FGCVFAKVSQKLVIAHMTKSELYLQDTVFIGPGLLFLDQYFNNFVDEYIVLWIAMVISSL
DMMRYFSALCLQISRHLHLSIFKTSCHQAPEQVQVLPPKSHQNNMD
Enzyme 10 Number of Residues 406
Enzyme 10 Molecular Weight 45248.9
Enzyme 10 Theoretical pI 7.51
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Lipid transport and metabolism
Enzyme 10 Specific Function Catalyzes phosphatidylcholine biosynthesis from CDP- choline. It thereby plays a central role in the formation and maintenance of vesicular membranes
Enzyme 10 Pathways
  • Phospholipid metabolism
  • phosphatidylcholine biosynthesis
  • phosphatidylcholine from phosphocholine:step 2/2
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • 66-86 93-113 160-180 193-213 226-248 261-281 295-315 349-369
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 94534811 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q1LZE6 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name CHPT1_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1221 bp
ATGGCGGCGGGCGCCGGGGCCAGGCCGGCGCCGCGCTGGCTGAAGGCGCTGACCGAGCCG
CTGAGCGCGGCGCAGCTGCGGCGGCTGGAGGAGCACCGCTACACCGCGGCGGGCGTCTCG
CTGCTCGAGCCGCCGCTGCAGCTCTACTGGACCTGGCTGCTCCAGTGGATCCCGCTGTGG
ATGGCCCCCAACTCCATCACCCTCCTGGGCCTCGCCATCAACATGCTCACCACGCTCGTG
CTCATCTCCTATTGCCCCACGGTCACCGAGGAGGCACCATACTGGACATACCTTTTATGT
GCATTAGGACTCTTCATCTACCAGTCACTGGATGCTATTGATGGGAAACAAGCCAGAAGG
ACAAATTCTTGTTCTCCTTTAGGGGAACTTTTTGACCATGGTTGCGACTCTCTTTCCACA
GTTTTTATGGCAGTTGGAGCTTCAATTGCTGTTCGCTTAGGAACTCACCCCGACTGGTTG
TTTTTCTGCTCTTTTATTGGGATGTTCATGTTTTATTGTGCTCACTGGCAGACTTATGTT
TCAGGCGTGTTGAGGTTTGGAAAAGTGGATGTAACTGAAATTCAGATAGCTTTAGTGATC
GTCTTCGTGTTATCTACATTTGGAGGAGCAACAATGTGGGACTACACGATACCCATCCTA
GAAATAAAATTGAAGATCTTACCAGTTCTTGGAGTAGTAGGTGGAGCAATATTTTCCTGT
TCAAATTATTTCCATGTTATCCTCCATGGTGGTGTTGGCAAGAATGGATCCACTATAGCA
GGTACCAGTGTCTTATCACCTGGACTCCACATAGGAATAATTATTATACTGGCAATAATG
ATTTATAAAAAGTCAGCAACTAATTTGTTTGAAAAGCATCCTTGTCTTTATACCCTAATG
TTTGGATGTGTCTTTGCTAAAGTCTCACAGAAATTGGTGATAGCTCACATGACCAAAAGT
GAACTGTATCTTCAAGACACTGTCTTTATTGGCCCAGGTCTTTTATTTTTAGACCAGTAC
TTTAATAATTTTGTAGACGAATATATTGTTCTATGGATAGCAATGGTCATTTCTTCACTT
GATATGATGAGGTACTTTAGTGCTTTGTGCCTGCAAATTTCAAGACACCTTCATCTAAGT
ATCTTCAAGACTTCATGTCATCAAGCACCTGAACAGGTTCAAGTTCTTCCTCCAAAGAGT
CATCAGAATAACATGGATTGA
Enzyme 10 GenBank Gene ID BC116046 Link Image
Enzyme 10 GeneCard ID CHPT1 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:1
Enzyme 10 Locus 12q
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 391
Enzyme 11 Name Ethanolaminephosphotransferase 1
Enzyme 11 Synonyms
  1. Selenoprotein I
  2. SelI
Enzyme 11 Gene Name SELI
Enzyme 11 Protein Sequence >Ethanolaminephosphotransferase 1
MASYEYVSPEQLAGFDKYKYSAVDTNPLSLYVMHPFWNTVVKVFPTWLAPNLITFSGFLL
VVFNFLLLAYFDPDFYASAPGHKHVPDWVWIVVGILNFMAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWSCVYFVVTVYSIFGRGSSGVSVFVLYLLLWVVLFSFILSHWEKYNTGIL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIFGCALCVTLPMSLL
NFFRSYKNNTLKHNSVYEAVVPFFSPCLLFILSTAWILLSPSDILELHPRVFYLMVGTAF
ANSTCQLIVCQMSSTRCPTLNWLLLPLFVIVMVVNVGVTPYVESILLFTLTAAFTLAHIH
YGVRVVKQLSNHFHIYPFSLRKPNSDULGVEEKNIGL
Enzyme 11 Number of Residues 397
Enzyme 11 Molecular Weight 45213.4
Enzyme 11 Theoretical pI 6.73
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in ethanolaminephosphotransferase activity
Enzyme 11 Specific Function Catalyzes phosphatidylethanolamine biosynthesis from CDP-ethanolamine. It thereby plays a central role in the formation and maintenance of vesicular membranes. Involved in the foramtion of phosphatidylethanolamine via 'Kennedy' pathway
Enzyme 11 Pathways
  • Phospholipid metabolism
  • phosphatidylethanolamine biosynthesis
  • phosphatidylethanolamine from ethanolamine:step 3/3
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • 47-69 84-103 123-145 150-172 179-201 221-243 256-278 291-310 317-339 344-366
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 109659351 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q17QM4 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name SELI_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >1161 bp
ATGGCAAGTTACGAATACGTGAGCCCGGAGCAGCTGGCTGGCTTTGATAAGTACAAGTAC
AGTGCTGTGGATACCAATCCACTCTCTCTGTATGTCATGCACCCATTTTGGAACACTGTA
GTAAAGGTATTTCCTACTTGGCTGGCTCCAAATCTGATAACCTTCTCTGGCTTTCTGCTG
GTTGTGTTCAATTTTCTACTTTTGGCATACTTTGATCCTGACTTTTATGCTTCAGCACCA
GGTCACAAGCATGTACCCGACTGGGTCTGGATTGTAGTGGGCATCCTCAACTTCATGGCC
TACACTCTAGATGGTGTGGACGGAAAGCAAGCCCGCAGAACCAATTCCAGCACCCCGCTG
GGGGAGCTTTTTGACCACGGCCTGGATAGTTGGTCGTGTGTTTACTTTGTTGTCACCGTG
TATTCCATTTTTGGACGAGGATCATCTGGTGTCAGTGTTTTCGTTCTTTATCTCCTGCTA
TGGGTAGTTTTGTTTTCTTTCATCCTGTCTCACTGGGAAAAGTATAACACAGGGATTCTT
TTCCTGCCATGGGGATATGACATTAGCCAGGTGACTATTTCTTTTGTCTACATAGTGACT
GCGGTTGTGGGAGTTGAGGCCTGGTATGAACCTTTCCTGTTTAATTTCTTATATAGAGAC
CTATTCACTGCAATGATCTTTGGTTGTGCACTGTGCGTGACTCTTCCAATGAGTTTGTTA
AATTTTTTCAGAAGCTATAAAAATAACACGTTGAAACACAATTCAGTCTATGAAGCTGTG
GTTCCCTTCTTTTCTCCATGTTTGCTATTCATTTTGTCTACAGCGTGGATCCTCCTGTCA
CCTTCAGATATTTTAGAGTTACACCCTAGAGTGTTCTACTTAATGGTTGGAACAGCCTTT
GCCAACAGCACATGTCAGCTGATTGTTTGTCAAATGAGCAGTACCCGGTGCCCGACTTTG
AACTGGTTGCTGCTTCCTCTTTTTGTGATTGTCATGGTGGTGAATGTAGGAGTAACCCCT
TACGTTGAGAGCATTCTCCTGTTTACGCTAACGGCTGCTTTCACTTTGGCCCACATCCAC
TATGGAGTACGAGTGGTAAAGCAGCTGAGCAACCATTTTCACATTTACCCCTTCTCCTTG
AGAAAACCAAACTCGGATTGA
Enzyme 11 GenBank Gene ID BC118273 Link Image
Enzyme 11 GeneCard ID SELI Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:2
Enzyme 11 Locus 2p23.3
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References Not Available
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 444
Enzyme 12 Name U8 snoRNA-decapping enzyme
Enzyme 12 Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 16
  2. Nudix motif 16
Enzyme 12 Gene Name NUDT16
Enzyme 12 Protein Sequence >U8 snoRNA-decapping enzyme
MAGMRRLELSEALHLGPGWRHACHALLYAPDPGLLFGRIPLRYAVLMQMRFDGRLGFPGG
FVDLRDGSLEDGLNRELGEELGEAAGAFRVERADYRSSHAGSRPRVVAHFYTKLLTLEQL
TAVEMGAPRARDHGLEVLGLVRVPLYTLRDGVGGLPAFLENTFIGNAREQLLEAVQNLGL
LEPGSFARLKISTPP
Enzyme 12 Number of Residues 195
Enzyme 12 Molecular Weight 21398.4
Enzyme 12 Theoretical pI 7.17
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in hydrolase activity
Enzyme 12 Specific Function RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro)
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 119224036 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID A1A4Q9 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name NUD16_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >588 bp
ATGGCCGGTATGCGTAGGCTTGAGCTGTCGGAAGCCCTGCATCTGGGGCCGGGCTGGCGG
CACGCGTGCCACGCGCTGCTCTACGCACCGGACCCAGGGCTGCTCTTTGGCCGCATTCCG
CTACGCTACGCCGTGCTGATGCAGATGCGCTTTGATGGGCGCCTGGGCTTCCCTGGCGGC
TTCGTGGACTTGCGCGACGGCAGCTTGGAGGACGGGCTGAATCGCGAGTTGGGCGAGGAG
CTGGGCGAGGCTGCGGGCGCCTTTCGTGTGGAGCGCGCTGACTACCGCAGCTCCCACGCT
GGGTCCCGGCCGCGCGTGGTGGCGCACTTCTACACTAAGCTCCTGACCCTGGAGCAGCTG
ACTGCGGTGGAGATGGGCGCGCCTCGCGCCCGAGACCACGGGCTGGAGGTGCTGGGCCTG
GTGCGGGTGCCCCTGTATACCCTGCGGGATGGTGTGGGAGGCCTGCCTGCCTTCCTGGAG
AATACCTTTATTGGAAATGCACGGGAACAGCTGCTGGAAGCCGTCCAGAACCTGGGACTG
CTGGAACCTGGCTCTTTTGCACGCCTTAAGATTTCAACTCCTCCCTAG
Enzyme 12 GenBank Gene ID BC126814 Link Image
Enzyme 12 GeneCard ID NUDT16 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:3
Enzyme 12 Locus 3q22.1
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 445
Enzyme 13 Name Diphosphoinositol polyphosphate phosphohydrolase 3-beta
Enzyme 13 Synonyms
  1. DIPP-3-beta
  2. DIPP3-beta
  3. Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta
  4. Nucleoside diphosphate-linked moiety X motif 11
  5. Nudix motif 11
Enzyme 13 Gene Name NUDT11
Enzyme 13 Protein Sequence >Diphosphoinositol polyphosphate phosphohydrolase 3-beta
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGG
AAVREVFEEAGVKGKLGRLLGNFEQNQDRKHRTYVYVLTVTEILEDWEDSVSIGRKREWF
KVEDAIKVLQCHKPVHAEYLQKLKLGGSPTNGNSVAPSPPEGDP
Enzyme 13 Number of Residues 164
Enzyme 13 Molecular Weight 18518.8
Enzyme 13 Theoretical pI 6.28
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Replication, recombination and repair
Enzyme 13 Specific Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyzes the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 61555249 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q58CW0 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name NUD11_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >804 bp
ATGAAGTGCAAGCCGAACCAGACGCGGACCTACGACCCGGAGGGGTTCAAGAAGCGGGCG
GCGTGCCTGTGCTTCCGGAGCGAGCGCGAGGACGAGGTGCTGTTAGTGAGTAGCAGTCGG
TACCCGGACCGCTGGATCGTGCCGGGCGGGGGCATGGAGCCCGAGGAGGAGCCGGGCGGT
GCGGCCGTCCGCGAGGTGTTTGAAGAAGCGGGAGTCAAGGGGAAGTTAGGCCGGCTCCTG
GGCAATTTCGAGCAGAACCAAGATCGCAAGCACAGAACGTACGTGTATGTACTGACTGTC
ACTGAGATTCTGGAGGATTGGGAAGATTCGGTTAGCATTGGGAGGAAGCGAGAGTGGTTC
AAAGTCGAAGATGCGATCAAGGTTCTCCAGTGCCACAAGCCCGTGCATGCCGAATATCTG
CAAAAACTAAAGCTGGGCGGTTCCCCAACCAATGGAAACTCCGTGGCCCCGTCCCCCGCC
GGAGGGCGATCCCTAGTGAATGGCATAGATGTTCAGATTTACTTTGAAAGAATCAAGTAT
ATGAACCCAGTGATGAATGGAATTATGAAGACAGGTGAGCTCTTTCACACTCCCAAGGAC
ACAGCTCGTCCTATCCTTTTGGACACTTCCTCCCTGTTTATTGCAATGACTATTCTCCAG
GTTGTTGCACTACTTCTGTATCTGTACAGACTTCTAATTTGGCACCTATGGCCTTCTTTG
TGCTCTTATGATTATGTGTCTGTATTTCCCACCAGGTTATGTGACCTTGAGTGCAAAGAC
CTTATTTCTTTCATCTTTTTATAA
Enzyme 13 GenBank Gene ID BT021837 Link Image
Enzyme 13 GeneCard ID NUDT11 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Not Available
Enzyme 13 Locus Xp11.22
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References
  1. [PubMed Link Image]
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 448
Enzyme 14 Name Isocitrate dehydrogenase [NADP], mitochondrial
Enzyme 14 Synonyms
  1. IDH
  2. Oxalosuccinate decarboxylase
  3. NADP(+)-specific ICDH
  4. IDP
  5. ICD-M
Enzyme 14 Gene Name IDH2
Enzyme 14 Protein Sequence >Isocitrate dehydrogenase [NADP], mitochondrial
MAGYLRVVRSLCRASGSGSAWAPAALTAPNLQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVVDRAGTFKVVFTPKDGSGPKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQAIFEKHYKTEFDKHKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTSDFLDTIKSNLDRALGQQ
Enzyme 14 Number of Residues 452
Enzyme 14 Molecular Weight 50738.7
Enzyme 14 Theoretical pI 8.95
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Energy production and conversion
Enzyme 14 Specific Function Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 430 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q04467 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name IDHP_BOVIN Link Image
Enzyme 14 PDB ID 1LWD Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1359 bp
ATGGCTGGTTACCTGCGAGTCGTACGCTCGCTCTGCAGAGCCTCTGGCTCCGGGTCGGCC
TGGGCGCCACGAGCCTTGACAGCCCCCAACTTGCAAGAGCAGCCGCGGCGCCACTATGCC
GACAAGAGGATCAAGGTGGCGAAGCCAGTGGTGGAGATGGACGGCGATGAGATGACCCGT
ATTATCTGGCAGTTCATCAAAGAGAAGCTCATCCTGCCCCACGTGGACGTCCAGCTCAAG
TATTTCGACCTGGGGCTCCCGAACCGTGACCAGACCAATGATCAGGTCACCATCGACTCC
GCGTTGGCCACCCAGAAGTACAGTGTGGCTGTGAAGTGTGCCACCATCACCCCCGACGAG
GCCCGTGTGGAAGAGTTCAAGCTGAAGAAGATGTGGAAGAGCCCCAATGGAACCATCCGG
AACATCCTCGGGGGAACGGTCTTCCGGGAGCCCATCATCTGTAAGAACATCCCGCGTCTC
GTCCCTGGCTGGACCAAGCCCATCACCATTGGCAGGCATGCCCACGGCGACCAGTACAAA
GCCACAGACTTTGTGGTTGACCGGGCTGGCACATTCAAGGTGGTCTTCACCCCGAAGGAT
GGCAGCGGCCCTAAGGAATGGGAGGTGTACAACTTTCCTGCTGGTGGCGTGGGCATGGGC
ATGTATAACACGGATGAGTCCATCTCAGGTTTTGCACACAGCTGCTTCCAGTATGCCATC
CAGAAGAAGTGGCCACTCTACATGAGCACCAAGAACACCATCCTGAAAGCTTACGACGGG
CGCTTCAAGGACATCTTCCAGGCCATCTTTGAGAAGCACTACAAGACTGAGTTCGACAAA
CATAAGATCTGGTACGAGCACCGGCTCATTGATGACATGGTGGCTCAGGTCCTCAAGTCC
TCAGGCGGCTTTGTGTGGGCCTGCAAGAACTACGATGGAGACGTGCAGTCGGACATCCTG
GCCCAGGGCTTTGGCTCCCTTGGTCTGATGACGTCCGTGCTGGTCTGCCCGGATGGGAAG
ACCATTGAGGCTGAGGCTGCTCATGGCACAGTCACCCGCCACTATCGGGAGCACCAGAAG
GGCCGGCCGACCAGCACCAACCCCATCGCCAGCATCTTTGCCTGGACGCGTGGCCTAGAA
CACCGGGGCAAGTTGGATGGGAACCAGGACCTCATCAGGTTCGCCCAGACCCTGGAGAAG
GTGTGCGTCGAGACGGTGGAGAGCGGAGCCATGACCAAGGACCTGGCGGGCTGCATCCAC
GGCCTCAGCAATGTGAAGCTGAACGAACACTTCCTGAACACCTCGGACTTCCTGGACACC
ATCAAGAGCAACCTGGACAGAGCTCTGGGCCAGCAGTAG
Enzyme 14 GenBank Gene ID X69432 Link Image
Enzyme 14 GeneCard ID IDH2 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 15q26.1
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 450
Enzyme 15 Name Endonuclease G, mitochondrial
Enzyme 15 Synonyms
  1. Endo G
Enzyme 15 Gene Name ENDOG
Enzyme 15 Protein Sequence >Endonuclease G, mitochondrial
MQLLRAGLTLALGAGLGAAAESWWRQRADARATPGLLSRLPVLPVAAAAGLPAVPGAPAG
GGPGELAKYGLPGVAQLKSRASYVLCYDPRTRGALWVVEQLRPEGLRGDGNRSSCDFHED
DSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNN
LEKYSRSLTRTYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAA
GGQIELRSYVMPNAPVDEAIPLEHFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
Enzyme 15 Number of Residues 299
Enzyme 15 Molecular Weight 32261.4
Enzyme 15 Theoretical pI 9.42
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Nucleotide transport and metabolism
Enzyme 15 Specific Function Cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, also has ribonuclease (RNase) and RNase H activities. Capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 397486 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID P38447 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name NUCG_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >900 bp
ATGCAGTTGCTTCGGGCCGGCTTGACTCTGGCCCTGGGCGCAGGGCTGGGTGCAGCTGCC
GAGAGCTGGTGGCGACAGCGGGCGGACGCGCGGGCGACGCCGGGGCTGCTGAGCCGGCTG
CCGGTGCTGCCAGTGGCGGCGGCGGCGGGGCTTCCCGCGGTGCCAGGGGCTCCCGCGGGT
GGCGGCCCGGGCGAGTTAGCCAAGTATGGGCTGCCCGGGGTGGCGCAACTCAAGAGCCGC
GCGTCGTACGTGCTGTGTTACGACCCGCGCACCCGCGGCGCGCTCTGGGTGGTCGAGCAG
CTGCGGCCCGAGGGGCTCCGCGGCGACGGCAACCGCAGCTCCTGCGACTTCCACGAGGAC
GACTCGGTGCATGCGTACCACCGCGCCACCAACGCCGATTACCGCGGCAGCGGCTTCGAC
CGCGGCCACCTCGCTGCCGCGGCCAACCACCGCTGGAGCCAGAAGGCAATGGACGACACC
TTCTACCTGAGCAACGTCGCGCCCCAGGTGCCACACCTCAACCAAAATGCCTGGAACAAC
CTGGAAAAGTACAGCCGCAGTCTGACCCGCACCTACCAAAATGTCTATGTCTGCACCGGG
CCACTCTTCCTGCCCAGGACGGAGGCTGATGGGAAGTCCTACGTGAAGTACCAAGTCATT
GGCAAGAACCACGTGGCGGTGCCCACCCACTTCTTCAAGGTGCTGATCCTGGAGGCGGCA
GGTGGGCAGATAGAACTCCGCTCCTATGTGATGCCCAATGCGCCGGTGGATGAGGCAATC
CCGCTGGAGCACTTCCTGGTGCCCATTGAGAGCATTGAGCGGGCCTCCGGGCTGCTCTTT
GTGCCAAACATCCTGGCACGGGCGGGCAGCCTGAAGGCCATCACTGCTGGCAGCAAGTAA
Enzyme 15 GenBank Gene ID X72802 Link Image
Enzyme 15 GeneCard ID ENDOG Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:9
Enzyme 15 Locus 9q34.1
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 454
Enzyme 16 Name Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
Enzyme 16 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
Enzyme 16 Gene Name IDH3G
Enzyme 16 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
MALKVATAAGGAVKAALRPALLWRPWEVLGSHEAPRRSFSQQTIPPSAKYGGRHTVTMIP
GDGIGPELMLHVKSVFRHACVPVDFEEVHVSSTADEEDIRNAIMAIRRNRVALKGNIETN
HNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHRDIDILIVRENTEGEYSSLEHES
VAGVVESLKIITKAKSLRIAEYAFQLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAA
RYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGH
VYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENM
HTPDIGGQGTTSEAIQDIIRHIRVINGRAVEA
Enzyme 16 Number of Residues 392
Enzyme 16 Molecular Weight 42863.0
Enzyme 16 Theoretical pI 9.16
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Energy production and conversion
Enzyme 16 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 61555748 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q58CP0 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name IDH3G_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >1179 bp
ATGGCGCTGAAGGTGGCGACGGCCGCGGGCGGCGCTGTGAAGGCAGCGCTCAGGCCGGCC
CTCCTCTGGCGTCCTTGGGAGGTTCTAGGTTCCCACGAGGCCCCCCGGAGGAGCTTCTCA
CAACAAACAATTCCCCCGTCGGCGAAGTATGGTGGGCGGCACACGGTGACCATGATCCCG
GGAGATGGCATTGGGCCAGAGCTCATGCTGCACGTCAAGTCAGTGTTCAGGCATGCATGT
GTGCCTGTGGACTTTGAAGAGGTGCACGTGAGCTCCACCGCGGACGAGGAGGACATCCGC
AATGCCATCATGGCCATCCGTCGGAACCGCGTAGCCCTGAAGGGCAACATTGAAACAAAC
CACAACCTGCCCCCATCCCACAAATCGCGAAACAACATCCTTCGCACCAGCCTGGACCTC
TATGCCAACGTCATCCACTGTAAGAGCCTGCCAGGTGTGGTGACCCGGCATCGGGACATT
GATATCCTCATTGTCCGGGAGAACACAGAGGGCGAGTACAGCAGCCTGGAACACGAGAGT
GTGGCGGGCGTGGTGGAGAGCCTGAAGATCATCACCAAGGCCAAGTCCCTGCGTATTGCT
GAGTACGCCTTCCAACTGGCCCAGGAGAGCGGGCGCAAGAAAGTGACAGCCGTGCACAAG
GCCAACATCATGAAACTGGGCGATGGGCTTTTCCTCCAGTGCTGCAGGGAAGTGGCAGCC
CGCTACCCCCAGATCACCTTTGAGAATATGATTGTGGACAACACCACCATGCAGCTGGTG
TCCCGGCCCCAGCAGTTTGATGTCATGGTGATGCCCAATCTCTATGGCAACATCGTCAAC
AACGTCTGTGCTGGGCTAGTTGGGGGCCCCGGCCTTGTGGCTGGGGCCAACTATGGCCAT
GTGTATGCCGTGTTTGAGACGGCTACAAGGAACACAGGGAAGAGTATTGCCAATAAGAAC
ATTGCCAACCCCACAGCTACACTGCTGGCAAGTTGCATGATGCTCGACCACCTCAAGCTG
CACTCCTATGCCACCTCCATCCGCAAGGCCGTCCTGGCATCCATGGACAATGAAAACATG
CACACCCCAGACATCGGGGGCCAGGGCACCACGTCGGAAGCCATCCAGGACATCATCCGC
CATATCCGTGTCATTAACGGTCGGGCCGTGGAGGCCTAG
Enzyme 16 GenBank Gene ID BT021907 Link Image
Enzyme 16 GeneCard ID IDH3G Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Not Available
Enzyme 16 Locus Xq28
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 460
Enzyme 17 Name Polyribonucleotide 5'-hydroxyl-kinase Clp1
Enzyme 17 Synonyms
  1. Polynucleotide kinase Clp1
  2. Pre-mRNA cleavage complex II protein Clp1
Enzyme 17 Gene Name CLP1
Enzyme 17 Protein Sequence >Polyribonucleotide 5'-hydroxyl-kinase Clp1
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAG
AKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVV
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI
QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQ
ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRD
MVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR
FMDLK
Enzyme 17 Number of Residues 425
Enzyme 17 Molecular Weight 47629.2
Enzyme 17 Theoretical pI 6.60
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in ATP binding
Enzyme 17 Specific Function Polynucleotide kinase that can phosphorylate the 5'- hydroxyl groups of double-stranded RNA (dsRNA), single-stranded RNA (ssRNA), double stranded DNA (dsDNA) and double-stranded DNA:RNA hybrids. dsRNA is phosphorylated more efficiently than dsDNA, and the RNA component of a DNA:RNA hybrid is phosphorylated more efficiently than the DNA component. Appears to have roles in both tRNA splicing and mRNA 3'-end formation. Component of the tRNA splicing endonuclease complex. Phosphorylates the 5'-terminus of the tRNA 3'-exon during tRNA splicing; this phosphorylation event is a prerequisite for the subsequent ligation of the two exon halves and the production of a mature tRNA. Component of the pre-mRNA cleavage complex II (CF-II), which seems to be required for mRNA 3'-end formation. Also phosphorylates the 5'-terminus of exogenously introduced short interfering RNAs (siRNAs), which is a necessary prerequisite for their incorporation into the RNA- induced silencing complex (RISC). However endogenous siRNAs and microRNAs (miRNAs) that are produced by the cleavage of dsRNA precursors by DICER1 already contain a 5'-phosphate group, so this protein may be dispensible for normal RNA-mediated gene silencing
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 126010715 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID A2VE01 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name CLP1_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >1278 bp
ATGGGAGAGGAGGCCAATGATGACAAGAAGCCAACAACTAAATTTGAACTGGAGCGGGAG
ACAGAGCTTCGCTTTGAGGTGGAGGCGTCGCAGTCAGTTCAGTTGGAGCTGCTGGCTGGC
ATGGCAGAAATCTTCGGCACAGAGCTGACCCGAAACAAGAAGTTCACCTTTGATGCCGGC
GCCAAGGTGGCTGTCTTCACTTGGCACGGCTGTTCGCTGCAGCTCAGTGGCCGCACCGAG
GTGGCTTACGTCTCCAAGGATACCCCAATGTTGCTTTATCTCAACACGCATACGGCCTTG
GAGCAGATGCGGAGGCAGGCAGAGAAGGAGGAGGAGCGAGGCCCCCGGGTGATGGTCGTG
GGCCCCACGGACGTGGGCAAGTCCACCGTGTGCCGTCTGCTGCTCAACTACGCGGTGCGT
TTGGGCCGCCGGCCCACGTACGTGGAGCTGGATGTGGGCCAGGGCTCTGTGTCCATCCCC
GGCACCATGGGGGCCCTGTACATTGAGCGGCCAGCGGACGTTGAGGAGGGGTTCTCCATC
CAGGCCCCGCTGGTGTACCACTTCGGCTCCACCACGCCTGGCACCAACATCAAGCTTTAT
AATAAGATTACATCTCGTTTAGCCGATGTGTTCAACCAGAGGTGTGAAGTGAACCGCAGG
GCCTCGGTGAGCGGCTGTGTCATTAACACCTGTGGCTGGGTCAAGGGCTCTGGTTACCAG
GCCCTGGTCCATGCAGCCTCAGCCTTTGAGGTGGATGTCGTTGTGGTTCTGGATCAAGAA
CGGCTGTACAATGAACTGAAACGGGACCTGCCTCACTTCGTCCGCACGGTGCTGCTCCCC
AAGTCGGGGGGTGTGGTGGAGCGCTCCAAGGACTTCCGGCGGGAATGCCGGGATGAGCGC
ATCCGTGAGTATTTCTATGGGTTCCGGGGCTGTTTCTATCCCCATGCCTTCAACGTCAAA
TTTTCAGATGTGAAAATCTACAAAGTCGGGGCACCCACCATCCCAGACTCTTGCCTGCCT
CTGGGCATGTCTCAGGAAGACAATCAGCTCAAGCTGGTGCCTGTTACCCCCGGCCGAGAT
ATGGTGCACCACCTGCTGAGCGTCAGCACGGCGGAGGGCACAGAGGAGAACCTCTCCGAG
ACCAGCGTGGCGGGCTTCATCGTGGTGACCAGTGTGGACCTGGAGCACCAGGTGTTCACC
GTTCTCTCTCCGGCCCCCCGCCCACTGCCCAAGAACTTCCTTCTCATCATGGATATCCGG
TTCATGGATCTTAAGTAG
Enzyme 17 GenBank Gene ID BC133499 Link Image
Enzyme 17 GeneCard ID CLP1 Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 11q12
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 468
Enzyme 18 Name Protein phosphatase 1B
Enzyme 18 Synonyms
  1. Protein phosphatase 2C isoform beta
  2. PP2C-beta
Enzyme 18 Gene Name PPM1B
Enzyme 18 Protein Sequence >Protein phosphatase 1B
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYD
GHAGSRVANYCSTHLLEHITNNEDFRAAGKSGSALEPSVENVKNGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRSGQVCFSTQDHKPCNPREKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEEDEFIIL
ACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSIVLVCFSNAPK
VSDEAMRKDSELDKYLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGNI
IFFRRHVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEML
TSYRLAKVEGEENPAEQAATAASSNSDAGNTVAMQESHTESKSDLAELDSCTEDAGTKMS
GEKL
Enzyme 18 Number of Residues 484
Enzyme 18 Molecular Weight 53430.2
Enzyme 18 Theoretical pI 4.73
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Signal transduction mechanisms
Enzyme 18 Specific Function Enzyme with a broad specificity
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 3063745 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID O62830 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name PPM1B_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >1164 bp
ATGGGTGCATTTTTGGACAAACCCAAAACTGAGAAACATAATGCTCATGGTGCTGGGAAT
GGTTTACGTTACGGCCTGAGCAGCATGCAAGGATGGAGAGTGGAAATGGAAGATGCGCAC
ACAGCTGTTGTAGGTATTCCGCACGGCTTGGAAGACTGGTCGTTTTTTGCAGTTTATGAT
GGTCACGCCGGATCCCGAGTAGCAAATTACTGCTCAACACACTTATTAGAACACATCACG
AACAACGAAGACTTCAGGGCAGCTGGAAAGTCAGGATCTGCTCTTGAGCCTTCAGTGGAA
AATGTCAAGAATGGTATCAGAACTGGCTTTTTGAAGATTGATGAATACATGCGTAACTTT
TCAGACCTCAGAAATGGCATGGACAGGAGCGGTTCAACTGCAGTGGGAGTTATGATTTCA
CCTAAGCACATCTACTTCATCAACTGTGGCGATTCACGGGCTGTTCTGTATAGGAGTGGA
CAAGTCTGCTTTTCTACCCAAGATCACAAACCTTGCAACCCAAGGGAGAAAGAGCGAATC
CAAAATGCAGGAGGCAGCGTAATGATACAGCGTGTTAATGGTTCATTAGCAGTGTCTCGT
GCTCTGGGGGACTATGATTACAAGTGTGTTGATGGCAAGGGCCCAACAGAACAACTTGTT
TCTCCAGAGCCTGAGGTTTATGAAATTTTAAGAGCAGAAGAGGATGAATTTATCATCTTG
GCTTGTGATGGGATCTGGGATGTTATGAGTAATGAGGAGCTCTGTGAATTTGTTAAATCT
AGGCTTGAGGTATCTGATGACCTGGAAAATGTGTGCAATTGGGTAGTGGACACTTGTTTA
CATAAGGGAAGTCGAGATAACATGAGTATTGTACTAGTTTGCTTTTCAAATGCTCCCAAG
GTCTCAGATGAAGCAATGAGAAAAGACTCAGAGTTGGATAAGTACTTGGAATCACGGGTG
GAAGAAATTATGGAGAAGTCTGGTGAGGAAGGGATGCCTGATCTTGCCCACGTCATGCGC
ATCTTGTCTGCAGAAAATATCCCAAATTTGCCTCCTGGGGGAGGTCTTGCTGGCAAGCGC
CATGTTATTGAAGCTGTTTATAGTAGGCTGAATCCACATAGAGAAAGTGATGGGGGTGCT
GGAGATCTAGAAGACCCATGGTAG
Enzyme 18 GenBank Gene ID AJ005458 Link Image
Enzyme 18 GeneCard ID PPM1B Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:2
Enzyme 18 Locus 2p21
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 470
Enzyme 19 Name Integrin-linked kinase-associated serine/threonine phosphatase 2C
Enzyme 19 Synonyms
  1. ILKAP
Enzyme 19 Gene Name ILKAP
Enzyme 19 Protein Sequence >Integrin-linked kinase-associated serine/threonine phosphatase 2C
MDLFGDLPEPERSPRPAAGSGGPLLFDDLPPASSGDSGSLDTSLSEEVKNEGKGAKRKAS
DEEKNGSEELVEKKVCKASSVIFSLKGYVAERKGEREEMQDAHVILNDITAECQPPSALV
TRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDGISVEKTVKRCLLDTFKHTDEEF
LKQASSQKPAWKDGSTATCVLAVDNTLYIANLGDSRAILCRYNEESQKHAALSLSKEHNP
TQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFIL
LACDGLFKVFTPEEAVNFILSCLEDEKIQRREGKPTVDARYEAACNRLANKAVQRGSADN
VTVMVVRIGL
Enzyme 19 Number of Residues 370
Enzyme 19 Molecular Weight 40621.5
Enzyme 19 Theoretical pI 7.05
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Signal transduction mechanisms
Enzyme 19 Specific Function Protein phosphatase that may play a role in regulation of cell cycle progression via dephosphorylation of its substrates whose appropriate phosphorylation states might be crucial for cell proliferation. Selectively associates with integrin linked kinase (ILK), to modulate cell adhesion and growth factor signaling. Inhibits the ILK-GSK3B signaling axis and may play an important role in inhibiting oncogenic transformation
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 113911858 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q0IIF0 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name ILKAP_BOVIN Link Image
Enzyme 19 PDB ID Not Available
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >1113 bp
ATGGACCTGTTCGGGGACCTGCCGGAGCCCGAGCGCTCGCCGCGGCCGGCTGCTGGCTCT
GGGGGACCTTTGCTTTTTGACGATCTCCCGCCAGCCAGCAGTGGCGATTCAGGTTCTCTT
GACACTTCGTTATCCGAGGAGGTAAAGAATGAAGGGAAAGGAGCAAAGAGAAAAGCCTCT
GATGAAGAGAAGAATGGGAGTGAAGAGCTTGTGGAAAAGAAAGTTTGTAAAGCCTCTTCG
GTGATCTTCAGCCTGAAAGGCTACGTGGCTGAGCGGAAGGGCGAGCGGGAAGAGATGCAG
GATGCCCACGTCATCCTGAACGACATCACCGCGGAGTGCCAGCCCCCGTCCGCTCTCGTC
ACCCGGGTTTCATACTTTGCTGTTTTTGATGGACATGGAGGAATTCGAGCCTCAAAATTC
GCCGCACAGAATTTGCATCAGAACTTAATCAGGAAATTTCCTAAAGGAGATGGAATCAGC
GTAGAGAAAACGGTGAAAAGGTGCCTTCTGGACACCTTCAAGCATACTGATGAAGAGTTC
CTTAAGCAAGCCTCAAGCCAGAAACCTGCCTGGAAAGATGGGTCCACTGCCACGTGTGTG
CTGGCCGTAGACAACACTCTTTACATCGCCAACCTGGGGGACAGTCGGGCAATCCTTTGT
CGTTACAATGAGGAGAGTCAAAAACACGCGGCCTTAAGCCTCAGCAAGGAGCATAATCCA
ACCCAGTATGAAGAACGAATGAGAATACAGAAGGCCGGAGGGAATGTCAGGGACGGGCGT
GTCCTGGGTGTGCTGGAGGTGTCCCGCTCCATCGGGGACGGGCAGTACAAGCGCTGCGGG
GTCACCTCGGTGCCGGACATCAGACGCTGCCAGCTGACCCCCAACGACAGGTTTATTTTG
CTGGCCTGTGATGGCCTCTTCAAGGTCTTTACCCCAGAAGAAGCCGTGAACTTCATCTTG
TCCTGCCTGGAGGACGAGAAGATCCAAAGGCGGGAAGGGAAGCCCACTGTGGATGCCCGC
TACGAAGCCGCCTGCAACAGGCTGGCCAACAAGGCGGTGCAGCGGGGCTCGGCGGACAAC
GTCACCGTGATGGTGGTGCGGATAGGGCTCTGA
Enzyme 19 GenBank Gene ID BC122677 Link Image
Enzyme 19 GeneCard ID ILKAP Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:2
Enzyme 19 Locus 2q37.3
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References Not Available
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 471
Enzyme 20 Name Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
Enzyme 20 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
  3. NAD(+)-isocitrate dehydrogenase subunit 1
  4. IDH1
Enzyme 20 Gene Name IDH3B
Enzyme 20 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
MAALSRVRWLTRALVAAPNPGAWRSLCTSTVAQASSRTQGEDVRVEGAFPVTMLPGDGVG
PELMHAVKEVFKAASVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPME
YKGELASYDMRLRRKLDLFANVVHVKSLPGYKTRHNNLDLVIIREQTEGEYSSLEHESAR
GVIECLKIVTRTKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELY
PKIKFEKMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEY
AVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEHHSNMIAEAVKKVIKVGKVRT
RDMGGYSTTTDFIKSVIGHLHPYGG
Enzyme 20 Number of Residues 385
Enzyme 20 Molecular Weight 42496.9
Enzyme 20 Theoretical pI 8.91
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Energy production and conversion
Enzyme 20 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 3643257 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID O77784 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name IDH3B_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >1152 bp
ATGGCTGCCCTCAGCCGTGTCCGCTGGCTGACCCGAGCACTGGTCGCCGCTCCGAATCCC
GGAGCATGGAGGAGCCTGTGTACCTCAACCGTGGCGCAAGCCTCCTCGCGGACCCAGGGC
GAGGATGTGAGGGTGGAGGGCGCCTTTCCCGTGACTATGCTGCCAGGAGACGGCGTGGGG
CCTGAGCTGATGCACGCTGTCAAGGAGGTGTTCAAGGCTGCCTCTGTCCCAGTGGAGTTC
CAGGAGCATCACCTGAGCGAGGTGCAGAATATGGCATCTGAGGAGAAGCTGGAGCAGGTG
CTGAGTTCCATGAAGGAGAACAAAGTGGCCATCATTGGAAAGATCCACACCCCAATGGAG
TATAAAGGGGAGCTAGCCTCCTATGATATGCGGCTGAGGCGGAAGTTGGACTTGTTTGCC
AATGTGGTCCATGTGAAGTCACTTCCTGGGTACAAGACTCGACACAACAATCTAGATTTG
GTGATTATTCGAGAGCAGACAGAAGGGGAGTACAGTTCTCTGGAACACGAGAGTGCGAGG
GGTGTGATTGAGTGCTTGAAGATTGTCACTCGAACCAAATCACAGCGGATTGCAAAGTTC
GCCTTTGACTATGCCACTAAGAAGGGGCGGGGCAAGGTCACGGCTGTCCACAAGGCCAAT
ATCATGAAACTGGGGGATGGGTTGTTCCTGCAGTGCTGTGAGGAAGTTGCTGAACTGTAT
CCCAAGATCAAGTTTGAGAAAATGATCATAGACAACTGCTGCATGCAGCTGGTGCAGAAT
CCTTACCAGTTTGACGTGCTGGTGATGCCCAATCTCTATGGGAACATTATTGACAATCTG
GCTGCTGGCCTGGTTGGGGGAGCTGGTGTGGTCCCTGGTGAGAGCTACAGTGCAGAGTAC
GCAGTGTTTGAGACGGGTGCCCGGCATCCATTTGCCCAGGCAGTGGGCAGGAATATAGCC
AACCCCACAGCCATGCTGCTGTCAGCTTCCAACATGCTGCGGCATCTCAATCTCGAGCAT
CACTCCAACATGATTGCAGAGGCAGTGAAGAAGGTGATTAAAGTTGGCAAGGTTCGAACT
TCTGACATGGGTGGTTATGCCACCTGCCAAGACTTCACTGAGGCTGTCATTGGTGCCCTG
TCCAACCCATAG
Enzyme 20 GenBank Gene ID AF090321 Link Image
Enzyme 20 GeneCard ID IDH3B Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:2
Enzyme 20 Locus 20p13
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 477
Enzyme 21 Name Bis(5'-adenosyl)-triphosphatase
Enzyme 21 Synonyms
  1. Diadenosine 5',5'''-P1,P3-triphosphate hydrolase
  2. Dinucleosidetriphosphatase
  3. AP3A hydrolase
  4. AP3Aase
  5. Fragile histidine triad protein
Enzyme 21 Gene Name FHIT
Enzyme 21 Protein Sequence >Bis(5'-adenosyl)-triphosphatase
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDMSPEEVADLFQ
AAQRVGTVVEKHFQGTSLTFSMQDGPEAGQTVKHVHVHILPRKAGDFHRNDSIYDALEKH
DREDKDSPALWRSEEEMAAEAAALRVYFQ
Enzyme 21 Number of Residues 149
Enzyme 21 Molecular Weight 16951.2
Enzyme 21 Theoretical pI 6.97
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Nucleotide transport and metabolism
Enzyme 21 Specific Function Cleaves A-5'-PPP-5'A to yield AMP and ADP
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 84688623 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID Q1KZG4 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name FHIT_BOVIN Link Image
Enzyme 21 PDB ID Not Available
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >450 bp
ATGTCGTTCAGATTTGGCCAACATCTCATCAAGCCCTCGGTGGTGTTTCTCAAAACAGAA
CTGTCCTTTGCCCTGGTGAACAGGAAGCCTGTGGTACCTGGACATGTCCTCGTGTGTCCC
CTCCGGCCAGTGGAGCGCTTCCGAGACATGAGTCCTGAAGAAGTGGCTGACTTGTTTCAG
GCAGCACAGAGAGTCGGCACGGTGGTAGAGAAGCATTTCCAGGGCACCTCGCTCACGTTT
TCCATGCAGGATGGCCCCGAAGCCGGACAGACTGTGAAGCATGTTCACGTCCACATTCTT
CCAAGGAAGGCTGGAGACTTTCACAGGAATGACAGCATCTATGATGCGCTCGAGAAACAC
GACAGAGAGGATAAAGACTCCCCAGCCTTGTGGCGGTCAGAGGAGGAAATGGCAGCTGAG
GCTGCAGCGCTGAGGGTCTACTTTCAGTGA
Enzyme 21 GenBank Gene ID DQ335870 Link Image
Enzyme 21 GeneCard ID FHIT Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:3
Enzyme 21 Locus 3p14.2
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References
  1. [PubMed Link Image]
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 484
Enzyme 22 Name Endoribonuclease Dicer
Enzyme 22 Synonyms Not Available
Enzyme 22 Gene Name DICER1
Enzyme 22 Protein Sequence >Endoribonuclease Dicer
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVSASWTKEKWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGEAD
TEPVVDDDDVFPPYVLRPEDGPRVTINTAIGHVNRYCARLPSDPFTHLAPKCRTRELPDG
TFYSTLYLPINSPLRASIVGPPMSCIRLAERVVALICCEKLHKIGELDDHLMPVGKETVK
YEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRESYPRPGQPCYLYVIGMVLTTPL
PDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFTLSLQ
MLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIE
KSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFP
SPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRK
AKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGVG
VRSLPVDFRYPNLDFGWKKSIDSKSFISIANSSSAENENYCKHSTIVVPENAAHQGANRT
SPLENHDQMSVNCRTLFSESPGKLQIEVSTDLTAINGLSYNKSLANGSYDLANRDFCQGN
HLNYYKQEIPVQPTTSYPIQNLYNYENQPKPSDECTLLSNKYLDGNANTSTSDGSPVTAA
VPGTTETGEAPPDRTASEQSPSPGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTVSLSALILDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVN
GLPPGYVVNQDKSNTEKWEKDEMTKDCMLANGKLDDDFEEEEEEEEDLMWRAHKEDADDE
DDFLEYDQEHIKFIDNMLMGSGAFVKKISLSPFSATDSAYEWKMPKKSSLGSLPFSSDFE
DFDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSI
ADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKAMCPTRENFTSQQKNLSG
SRAAASGAGYRASVLKDLEYGCLKIPPRCMFDHPEADRTLRHLISGFENFEKKINYRFKN
KAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSAL
VNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKE
EDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLE
MEPEITKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQV
PNS
Enzyme 22 Number of Residues 1923
Enzyme 22 Molecular Weight 218255.7
Enzyme 22 Theoretical pI 5.46
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Replication, recombination and repair
Enzyme 22 Specific Function Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, EIF2C2/AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre- miRNAs) to mature miRNAs and then load them onto EIF2C2/AGO2. EIF2C2/AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. Also cleaves double-stranded RNA to produce short interfering RNAs (siRNAs) which target the selective destruction of complementary RNAs
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • None
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 38679195 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID Q6TUI4 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name DICER_BOVIN Link Image
Enzyme 22 PDB ID Not Available
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >5772 bp
ATGAAAAGCCCTGCTTTGCAACCCCTCAGCATGGCAGGCCTGCAGCTCATGACCCCTGCT
TCCTCACCAATGGGTCCTTTCTTTGGACTGCCATGGCAACAAGAAGCAATTCATGATAAC
ATTTATACGCCAAGAAAATATCAGGTTGAACTGCTTGAAGCAGCTCTGGATCATAATACC
ATAGTCTGTTTAAACACTGGCTCAGGGAAGACGTTTATTGCAGTACTACTCACTAAAGAG
CTGTCTTATCAGATCAGGGGAGACTTCAACAGAAATGGCAAAAGGACGGTGTTCTTGGTC
AACTCTGCAAACCAGGTTGCCCAACAAGTGTCAGCTGTCAGAACTCACTCAGATCTCAAG
GTCGGGGAATACTCAAACCTAGAAGTAAGTGCATCTTGGACAAAAGAGAAATGGAACCAA
GAGTTTACTAAGCACCAGGTTCTCATTATGACCTGCTATGTCGCCTTGAATGTTTTGAAA
AATGGTTACTTATCACTGTCAGACATTAACCTTTTGGTGTTTGATGAGTGTCATCTTGCA
ATCCTAGACCACCCCTACCGAGAAATTATGAAGCTTTGTGAAAATTGTCCATCATGTCCT
CGTATTTTGGGACTAACTGCTTCCATTTTAAATGGGAAATGTGATCCAGAGGAATTGGAA
GAGAAGATTCAGAAACTGGAGAAAATTCTTAAGAGTAATGCTGAAACTGCAACTGACTTG
GTGGTCTTAGACAGATATACTTCTCAGCCATGTGAGATTGTGGTAGACTGTGGACCATTT
ACTGACAGAAGTGGGCTTTATGAAAGACTGCTGATGGAGTTAGAAGAAGCACTTAATTTT
ATCAATGACTGTAACATATCTGTACATTCAAAAGAAAGAGATTCTACTTTAATTTCTAAA
CAGATACTCTCAGACTGCCGTGCGGTCCTGGTTGTCCTGGGACCCTGGTGTGCCGATAAA
GTAGCTGGAATGATGGTCAGAGAGCTGCAGAAACACATCAAACATGAGCAGGAGGAGCTG
CACCGGAAGTTTCTGTTGTTCACAGACACTTTCCTACGGAAAATCCACGCCCTGTGTGAA
GAGCACTTCTCCCCTGCCTCGCTTGACCTGAAGTTTGTCACTCCTAAAGTAATAAAGCTG
CTCGAGATCTTACGCAAATACAAACCGTATGAGCGGCAGCAGTTTGAAAGCGTGGAGTGG
TATAATAATAGGAACCAGGATAATTACGTGTCCTGGAGCGATTCTGAGGATGACGAGGAA
GATGAAGAGATTGAAGAGAAAGAAAAGCCAGAGACAAATTTTCCTTCTCCGTTTACCAAC
ATTTTGTGTGGAATTATTTTTGTGGAAAGAAGATACACAGCCGTGGTCTTAAACAGATTG
ATAAAGGAAGCTGGCAAACAAGATCCAGAGCTGGCTTACATCAGCAGCAATTTTATAACT
GGACATGGCATCGGAAAGAATCAGCCTCGGAACAAACAGATGGAAGCGGAATTCAGAAAA
CAGGAAGAGGTACTTAGGAAATTTCGAGCACATGAAACCAACCTGCTTATTGCAACAAGT
ATTGTGGAGGAGGGTGTTGACATACCGAAATGCAACTTGGTGGTTCGTTTCGATCTGCCC
ACAGAGTATCGATCCTACGTTCAGTCCAAGGGAAGAGCGAGGGCACCCATCTCTAATTAT
GTAATGTTAGCAGACACAGATAAAATAAAGAGTTTTGAAGAAGACCTTAAAACATACAAA
GCTATTGAAAAGATCTTGCGAAACAAATGTTCCAAGTCGGTTGATACCGGGGAGGCCGAC
ACGGAGCCCGTGGTGGATGACGACGATGTTTTCCCACCGTATGTGCTGAGGCCTGAGGAC
GGTCCCCGCGTCACGATCAACACGGCCATTGGGCACGTCAACAGATACTGTGCTAGATTA
CCAAGTGATCCGTTTACTCATCTGGCTCCTAAATGTAGAACCCGAGAGTTGCCTGATGGT
ACATTTTATTCAACTCTTTATCTGCCAATTAACTCACCTCTTCGAGCCTCCATTGTTGGT
CCCCCAATGAGCTGCATTCGGTTGGCTGAAAGAGTCGTGGCTCTCATTTGCTGTGAAAAA
CTGCACAAAATTGGCGAACTGGATGACCATTTGATGCCAGTTGGGAAGGAGACTGTTAAA
TATGAGGAAGAGCTGGATTTACACGATGAAGAAGAGACCAGTGTTCCAGGAAGACCAGGT
TCCACAAAACGAAGACAGTGCTACCCAAAAGCAATTCCAGAATGTTTGAGGGAGAGCTAC
CCCAGGCCTGGTCAGCCCTGTTACCTGTACGTGATCGGAATGGTCCTGACGACACCTTTA
CCTGATGAGCTCAACTTCAGAAGGCGGAAGCTCTACCCCCCTGAGGACACCACAAGATGC
TTTGGAATACTGACAGCCAAGCCCATACCTCAGATCCCACACTTTCCTGTGTACACGCGC
TCTGGAGAGGTGACCATATCTATTGAGTTGAAGAAGTCCGGCTTCACGTTATCTCTGCAA
ATGCTTGAGTTGATCACAAGGCTTCACCAGTATATATTCTCACATATTCTTCGGCTTGAA
AAACCTGCACTAGAATTTAAACCCACAGACGCGGACTCAGCCTACTGCGTTCTACCTCTT
AATGTTGTTAATGACTCCAGCACTTTGGACATTGACTTTAAATTCATGGAAGATATCGAG
AAATCTGAAGCTCGAATAGGCATTCCCAGCACAAAGTATTCAAAAGAAACTCCTTTTGTT
TTCAAATTAGAAGATTACCAAGATGCAGTTATCATTCCAAGATACCGCAATTTTGATCAG
CCTCATCGATTTTATGTCGCTGACGTGTACACTGATCTTACCCCCCTGAGTAAATTTCCT
TCCCCTGAGTATGAAACGTTTGCGGAGTATTATAAAACAAAGTATAACCTTGACCTGACC
AATCTCAACCAGCCGCTGCTGGACGTGGACCACACGTCTTCACGACTCAATCTTTTGACA
CCTCGTCATTTGAATCAGAAGGGGAAAGCTCTCCCTCTGAGCAGTGCTGAGAAGAGGAAA
GCCAAGTGGGAGAGCCTGCAGAATAAGCAGATACTGGTTCCAGAACTCTGTGCTATACAT
CCAATTCCAGCATCACTGTGGAGAAAAGCCGTTTGTCTCCCGAGCATACTTTACCGCCTT
CACTGCCTTCTGACTGCAGAGGAGCTCAGAGCCCAGACGGCCAGCGACGCTGGTGTGGGA
GTCAGGTCACTTCCTGTGGATTTTAGATACCCTAACTTAGACTTCGGGTGGAAAAAATCT
ATCGACAGCAAATCTTTCATCTCAATTGCTAACTCCTCTTCAGCTGAAAATGAGAATTAC
TGTAAGCACAGCACAATTGTCGTCCCTGAAAATGCTGCACATCAAGGTGCTAATAGAACC
TCCCCTCTAGAAAATCATGACCAAATGTCTGTGAACTGCAGAACGTTGTTCAGCGAGTCA
CCTGGTAAGCTCCAAATTGAAGTTTCAACAGATCTGACAGCAATTAATGGTCTTTCTTAC
AATAAAAGTCTTGCCAATGGCAGTTACGATTTAGCTAACAGAGACTTTTGCCAAGGAAAC
CATCTGAATTACTACAAGCAGGAAATACCTGTACAACCAACTACCTCATATCCCATTCAG
AATTTATACAATTACGAGAACCAGCCCAAGCCCAGCGATGAATGTACTCTACTGAGTAAT
AAATACCTTGATGGAAATGCTAACACATCTACCTCAGATGGAAGTCCCGTGACGGCTGCC
GTGCCTGGTACTACAGAGACTGGGGAGGCGCCCCCGGACAGGACGGCTTCTGAGCAGAGC
CCTTCTCCTGGGTACTCCTCGAGGACGCTTGGCCCCAACCCTGGGCTCATTCTTCAGGCT
TTGACCCTTTCGAACGCTAGTGATGGATTTAACCTGGAGCGGCTCGAGATGCTTGGCGAC
TCCTTCCTCAAGCATGCCATCACCACCGTATCTCTTTCTGCACTTATCCTGGATGCGCAT
GAGGGCCGCCTTTCCTACATGAGAAGCAAAAAGGTCAGCAACTGTAATCTGTATCGGCTT
GGAAAAAAGAAGGGGCTGCCCAGCCGCATGGTGGTGTCCATATTTGACCCCCCTGTGAAT
GGGCTTCCTCCTGGTTACGTAGTAAATCAAGACAAAAGTAACACAGAGAAATGGGAAAAA
GATGAAATGACAAAAGACTGCATGTTGGCTAATGGCAAACTGGACGATGACTTCGAGGAG
GAGGAAGAGGAGGAGGAGGACCTGATGTGGAGGGCTCACAAGGAGGATGCGGACGATGAG
GACGACTTCCTGGAATACGATCAGGAGCACATCAAGTTCATAGATAACATGCTGATGGGG
TCAGGGGCTTTCGTCAAGAAAATCTCTCTTTCTCCTTTTTCTGCCACCGATTCTGCATAC
GAGTGGAAAATGCCCAAAAAGTCCTCCCTTGGTAGTCTGCCATTCTCATCCGATTTTGAG
GATTTCGACTACAGCTCCTGGGATGCGATGTGCTATCTGGATCCGAGCAAAGCCGTTGAA
GAGGATGACTTTGTGGTGGGGTTCTGGAATCCATCAGAAGAAAACTGTGGTGTGGACACA
GGGAAGCAGTCCATCTCTTACGACCTGCACACCGAGCAGTGCATTGCCGACAAAAGCATA
GCCGACTGTGTGGAAGCCCTGCTGGGCTGCTATTTAACCAGCTGTGGCGAGAGGGCTGCT
CAGCTTTTCCTCTGTTCGCTGGGGCTGAAGGTGCTCCCGGTAATTAAAAGGACTGATCGG
GAAAAGGCCATGTGCCCGACCAGGGAGAATTTCACCAGCCAACAAAAGAACCTTTCAGGG
AGCCGTGCGGCTGCCTCTGGAGCCGGCTACCGAGCCTCTGTGTTGAAAGACTTGGAGTAT
GGGTGTTTGAAGATCCCCCCGAGGTGTATGTTTGATCACCCCGAGGCAGACCGGACACTG
CGTCACCTGATCTCGGGTTTTGAAAATTTCGAAAAGAAAATCAACTACAGATTCAAGAAT
AAGGCTTACCTTCTACAGGCTTTTACACACGCCTCCTACCACTACAATACGATCACGGAT
TGTTACCAGCGCTTAGAATTCCTGGGAGATGCAATTTTGGACTACCTCATAACTAAGCAC
CTTTATGAAGACCCACGGCAGCACTCCCCAGGGGTCCTGACTGACCTGCGCTCTGCTCTG
GTCAACAATACCATCTTCGCGTCTTTGGCTGTGAAGTATGACTACCACAAGTACTTTAAG
GCCGTTTCTCCCGAGCTCTTCCATGTCATCGACGATTTCGTGCAGTTTCAGCTCGAGAAG
AACGAAATGCAAGGAATGGATTCTGAGCTTAGGAGATCCGAGGAGGATGAAGAGAAGGAA
GAGGATATTGAAGTTCCAAAGGCCATGGGGGATATTTTCGAGTCACTCGCGGGCGCCATT
TACATGGACAGCGGGATGTCGCTGGAGACGGTCTGGCAGGTGTACTATCCCATGATGCGG
CCGCTGATCGAAAAATTTTCTGCAAATGTGCCCCGTTCCCCTGTGCGAGAATTGCTTGAA
ATGGAACCAGAAATTACCAAATTCAGCCCAGCTGAGAGAACCTACGATGGCAAGGTCAGA
GTCACCGTGGAAGTGGTCGGGAAGGGGAAGTTCAAAGGCGTTGGCCGAAGTTACAGGATT
GCCAAGTCTGCAGCAGCAAGAAGAGCCCTGCGAAGCCTCAAAGCTAATCAACCTCAGGTT
CCCAATAGCTGA
Enzyme 22 GenBank Gene ID AY386968 Link Image
Enzyme 22 GeneCard ID DICER1 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:1
Enzyme 22 Locus 14q32.13
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 489
Enzyme 23 Name Nucleoside diphosphate-linked moiety X motif 17
Enzyme 23 Synonyms
  1. Nudix motif 17
Enzyme 23 Gene Name NUDT17
Enzyme 23 Protein Sequence >Nucleoside diphosphate-linked moiety X motif 17
MAAARVLLLLSGRPESVSFAQSVCGLLGAGSGLGPWPTHCGLKRGQLVLSDKPFPGASAR
LPLQRPPFCPFAALDQQPRAPGVELPPKGRGVDLGVAVILQSSDQTVLLTRRTSTLNISP
NLWVPPGGHVEPDEELLDGGLRELWEESGLQLPQGQFSWVPLGLWESAYPPKLSWGLPKY
HHIVLYLLVISQESQQQLQARIQPNAGEVSAFMWLGPDIAAAVAATEDGTETPKHLPQDL
PSSVPTVELKENGGAQPLALPTSTLLRTTPGTADSRERVSTGTKFALTLWLQHLGRKSRD
GS
Enzyme 23 Number of Residues 302
Enzyme 23 Molecular Weight 32388.7
Enzyme 23 Theoretical pI 6.79
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Involved in hydrolase activity
Enzyme 23 Specific Function Probably mediates the hydrolysis of some nucleoside diphosphate derivatives
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 133777807 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID A4FUG7 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name NUD17_BOVIN Link Image
Enzyme 23 PDB ID Not Available
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >909 bp
ATGGCGGCGGCACGGGTGCTGCTACTCCTCTCCGGGCGCCCGGAGTCGGTGAGCTTCGCG
CAGAGTGTGTGCGGCCTCCTGGGCGCCGGGTCGGGGCTCGGGCCGTGGCCCACGCACTGC
GGCCTGAAGCGGGGACAACTGGTCCTCTCGGACAAGCCTTTCCCAGGCGCGTCGGCCAGG
CTTCCGCTCCAGCGACCGCCTTTCTGCCCTTTTGCGGCCCTGGACCAACAGCCCAGGGCT
CCGGGGGTTGAGCTGCCCCCGAAAGGTCGAGGTGTGGATCTGGGTGTGGCGGTCATTCTG
CAGTCCAGCGACCAGACTGTCTTGTTGACGCGAAGGACAAGCACCCTCAACATTTCGCCC
AACCTCTGGGTACCCCCAGGTGGGCATGTGGAACCTGATGAAGAGCTGCTGGATGGGGGG
CTTCGAGAGCTTTGGGAGGAGAGTGGACTCCAGCTGCCCCAGGGCCAGTTCTCCTGGGTC
CCTCTGGGGTTATGGGAGTCTGCCTACCCCCCTAAGCTGAGCTGGGGTCTCCCCAAATAC
CATCACATCGTTCTCTACCTACTTGTCATCTCCCAGGAGTCACAGCAGCAGCTCCAGGCC
CGGATTCAACCAAATGCAGGAGAGGTGAGTGCCTTCATGTGGCTGGGACCAGACATAGCA
GCTGCAGTGGCTGCCACAGAGGATGGGACAGAGACCCCCAAACATCTTCCCCAGGACCTA
CCATCTTCTGTACCTACAGTGGAACTAAAAGAGAATGGAGGAGCCCAGCCTCTGGCCTTG
CCCACATCCACCCTGCTGCGGACAACCCCGGGCACGGCAGACAGCAGAGAGAGGGTCAGC
ACTGGCACCAAGTTTGCCCTCACGCTTTGGCTGCAACATCTGGGCAGGAAGAGCCGGGAT
GGCAGCTGA
Enzyme 23 GenBank Gene ID BC114872 Link Image
Enzyme 23 GeneCard ID NUDT17 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Chromosome:1
Enzyme 23 Locus 1q21.1
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References Not Available
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 494
Enzyme 24 Name Protein phosphatase 1K, mitochondrial
Enzyme 24 Synonyms
  1. Protein phosphatase 2C isoform kappa
  2. PP2C-kappa
Enzyme 24 Gene Name PPM1K
Enzyme 24 Protein Sequence >Protein phosphatase 1K, mitochondrial
MSTAALLTLVRSGGNQVRRRVLLRARGLQDDRWVMPTCHSSTSEPKWSRFDPDGSGRPAT
WDNFGIWDNRLEEPILLPPSIKYGKPIPKVSLQNVGSASQIGKRKENEDRFGFAQLTNEV
LYFAVYDGHGGPAAADFCHTHMEKCILDLLPKEENLETVLTLAFLEIDKTFARHAHLSAD
ATLLTSGTTATVALLRDGIELVIASVGDSRAILCRKGKPMKLTIDHTPERKDEKERIKKC
GGFVAWNSLGQPHVNGRLAMTRSLGDLDLKTSGVIAEPETKRIKLHHADDSFLVLTTDGI
NFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNTTAVVVPFGAWGKYKNSEITFS
FSRSFASSGRWA
Enzyme 24 Number of Residues 372
Enzyme 24 Molecular Weight 41150.3
Enzyme 24 Theoretical pI 7.13
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Signal transduction mechanisms
Enzyme 24 Specific Function Regulates the mitochondrial permeability transition pore and is essential for cellular survival and development
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • None
Enzyme 24 Transmembrane Regions
  • None
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 84617514 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID Q2PC20 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name PPM1K_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence >1119 bp
ATGTCAACAGCTGCCTTACTTACTTTGGTAAGAAGTGGTGGGAACCAGGTGAGGAGGAGA
GTGCTGCTCAGAGCCCGCGGTCTGCAGGATGACAGGTGGGTGATGCCCACGTGCCACAGC
TCCACTTCAGAGCCGAAATGGTCTCGCTTTGATCCTGATGGTAGTGGCCGACCAGCTACC
TGGGATAATTTTGGCATCTGGGATAACCGCCTGGAGGAGCCAATTCTGCTGCCGCCCAGC
ATTAAGTATGGCAAGCCAATTCCCAAAGTCAGCTTGCAGAATGTGGGCAGCGCATCACAG
ATTGGCAAACGGAAAGAGAATGAAGACCGGTTTGGCTTTGCTCAGCTGACCAATGAGGTC
CTGTACTTTGCGGTGTATGATGGCCACGGTGGACCTGCAGCGGCCGATTTCTGTCATACC
CACATGGAGAAATGCATCCTGGATTTGCTTCCTAAGGAGGAGAACTTGGAAACTGTGTTG
ACCTTGGCTTTTCTTGAAATAGATAAAACCTTTGCAAGGCACGCCCACCTATCTGCTGAT
GCAACGCTTCTGACCTCTGGGACTACTGCAACAGTAGCCCTATTGAGAGATGGTATTGAA
CTGGTTATAGCTAGTGTTGGGGACAGCCGAGCTATTTTGTGCAGAAAAGGAAAACCCATG
AAGCTGACCATCGACCACACTCCAGAAAGAAAAGACGAGAAAGAAAGGATTAAGAAATGT
GGGGGGTTTGTAGCTTGGAATAGTTTGGGACAGCCTCACGTGAACGGAAGACTTGCAATG
ACAAGGAGTCTCGGAGATTTGGATCTTAAAACCAGTGGTGTGATAGCAGAACCTGAAACA
AAGAGGATTAAGCTACATCATGCTGATGACAGCTTCCTGGTCCTCACTACAGATGGAATT
AACTTCATGGTGAACAGTCAAGAGATTTGTGACTTTGTCAATCAGTGCCACGATCCCAAT
GAAGCAGCCCATGCAGTGACTGAACAGGCAATACAATATGGTACTGAAGATAACACGACT
GCAGTAGTAGTGCCTTTTGGTGCCTGGGGAAAATACAAGAACTCTGAAATCACCTTCTCA
TTCAGCAGAAGCTTCGCCTCTAGTGGACGATGGGCCTGA
Enzyme 24 GenBank Gene ID AJ871967 Link Image
Enzyme 24 GeneCard ID PPM1K Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Chromosome:4
Enzyme 24 Locus 4q22.1
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 499
Enzyme 25 Name Cytosol aminopeptidase
Enzyme 25 Synonyms
  1. Leucine aminopeptidase
  2. Leucyl aminopeptidase
  3. Leucine aminopeptidase 3
  4. LAP
  5. Proline aminopeptidase
  6. Prolyl aminopeptidase
  7. Peptidase S
Enzyme 25 Gene Name LAP3
Enzyme 25 Protein Sequence >Cytosol aminopeptidase
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
Enzyme 25 Number of Residues 519
Enzyme 25 Molecular Weight 56288.9
Enzyme 25 Theoretical pI 6.44
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Amino acid transport and metabolism
Enzyme 25 Specific Function Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 410689 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID P00727 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name AMPL_BOVIN Link Image
Enzyme 25 PDB ID 1LAP Link Image
Enzyme 25 PDB File Show
Enzyme 25 3D Structure
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence >1542 bp
ATGCCACCACCTGGATCCCCTTGGCCTTCAGAGCGTCAGCCTGCTCCACGAACCCTGGCA
GGTGGGTGCTCAGACATGACGAAGGGCCTTGTTTTAGGAATCTATAGCAAAGAAAAAGAA
GAAGATGAGCCTCAGTTTACAAGTGCAGGAGAGAATTTTAATAAATTGGTGTCTGGAAAG
CTGAGAGAAATTTTGAACATATCTGGACCATCCCTGAAGGCAGGCAAAACCCGAACCTTT
TATGGTCTACATGAGGACTTCCCTAGCGTGGTGGTGGTTGGCCTTGGCAAAAAGACGGCT
GGAATTGATGAACAGGAGAACTGGCATGAAGGCAAAGAAAACATCAGAGCTGCTGTTGCA
GCGGGGTGCAGACAGATTCAGGACCTGGAGATCCCGTCGGTGGAGGTGGACCCCTGCGGA
GATGCCCAGGCGGCTGCGGAAGGAGCGGTGCTCGGGCTCTATGAATATGATGACCTGAAG
CAGAAAAGGAAGGTGGTGGTGTCGGCCAAACTCCATGGAAGTGAGGACCAGGAGGCCTGG
CAGAGAGGCGTCCTCTTTGCTTCTGGGCAGAACCTGGCACGCCGCTTGATGGAGACGCCT
GCCAACGAGATGACGCCAACCAAATTTGCCGAAATTGTTGAGGAGAATCTCAAAAGTGCT
AGTATTAAAACAGACGTCTTCATCAGACCCAAGTCTTGGATTGAGGAACAGGAAATGGGA
TCATTTCTAAGTGTGGCCAAAGGGTCCGAAGAGCCTCCAGTCTTCCTGGAAATTCACTAC
AAAGGCAGTCCCAATGCAAGTGAACCTCCCTTGGTGTTTGTTGGGAAGGGGATTACCTTT
GACAGTGGTGGCATCTCCATCAAGGCTGCTGCAAACATGGACCTCATGAGGGCCGACATG
GGAGGAGCTGCCACTATCTGTTCAGCCATCGTGTCTGCTGCCAAGCTCGACCTGCCCATC
AACATCGTAGGTTTGGCTCCTCTTTGTGAAAATATGCCCAGTGGGAAGGCCAACAAGCCT
GGGGATGTTGTTAGAGCCAGGAACGGGAAGACCATACAGGTGGATAACACCGATGCTGAG
GGGAGACTTATCCTGGCCGATGCGCTCTGCTACGCTCACACTTTTAACCCAAAGGTCATC
ATTAATGCCGCCACCCTGACAGGTGCCATGGACATAGCTTTGGGATCTGGTGCCACTGGG
GTCTTTACCAACTCTTCTTGGCTGTGGAACAAACTATTTGAGGCCAGCATTGAAACAGGA
GACCGTGTCTGGAGGATGCCTCTCTTTGAACATTACACAAGACAGGTTATAGATTGCCAA
CTTGCTGATGTTAATAACATTGGAAAATATAGATCTGCAGGAGCGTGTACAGCTGCAGCA
TTCCTGAAAGAATTTGTGACTCATCCTAAGTGGGCACATTTAGACATAGCAGGTGTGATG
ACCAACAAAGATGAGGTTCCTTATCTTCGCAAAGGCATGGCTGGGAGGCCCACGAGGACC
CTGATTGAATTCCTGTTTCGGTTCAGTCAAGACAGTGCTTAG
Enzyme 25 GenBank Gene ID S65367 Link Image
Enzyme 25 GeneCard ID LAP3 Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:4
Enzyme 25 Locus 4p15.32
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References
  1. [PubMed Link Image]
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 502
Enzyme 26 Name TGF-beta receptor type-1
Enzyme 26 Synonyms
  1. Transforming growth factor-beta receptor type I
  2. TGF-beta receptor type I
  3. TGF-beta type I receptor
  4. TbetaR-I
  5. TGFR-1
Enzyme 26 Gene Name TGFBR1
Enzyme 26 Protein Sequence >TGF-beta receptor type-1
MEAAAATPRPRLFLLMLAAAATLVPEATPLQCFCHLCTKDNFTCVTDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGSITTTYCCNQDHCNKIELPTVGKPSSGLGPV
ELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDM
TTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFR
EAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIK
LALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEVARRCSIGGIHEDY
QLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLT
ALRIKKTLSQLSQQEGIKM
Enzyme 26 Number of Residues 499
Enzyme 26 Molecular Weight 55813.0
Enzyme 26 Theoretical pI 7.45
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Involved in ATP binding
Enzyme 26 Specific Function On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for TGF-beta
Enzyme 26 Pathways Not Available
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • 1-29
Enzyme 26 Transmembrane Regions
  • 123-143
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 2873365 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID O46680 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name TGFR1_BOVIN Link Image
Enzyme 26 PDB ID 1IAS Link Image
Enzyme 26 PDB File Show
Enzyme 26 3D Structure
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence >1500 bp
ATGGAGGCAGCGGCCGCTACTCCGCGTCCCCGGCTGTTCCTCCTCATGCTGGCGGCGGCG
GCCACGCTGGTCCCGGAGGCAACGCCATTACAGTGTTTTTGCCACCTTTGTACAAAAGAC
AATTTTACTTGTGTCACAGATGGGCTTTGCTTTGTTTCTGTCACAGAGACCACAGACAAA
GTTATACATAATAGCATGTGTATAGCTGAAATTGACCTAATTCCACGAGACAGGCCATTT
GTATGTGCACCATCTTCAAAAACTGGGTCTATAACTACAACATATTGCTGCAACCAGGAC
CACTGCAATAAAATAGAACTTCCAACTGTTGGAAAGCCATCATCTGGCCTTGGTCCTGTT
GAACTGGCAGCTGTCATTGCTGGACCAGTCTGCTTTGTCTGTATCTCACTCATGTTGATG
GTCTATATTTGCCATAACCGCACTGTCATTCACCATCGAGTGCCAAATGAAGAGGATCCC
TCGTTAGATCGCCCTTTTATTTCAGAGGGTACAACGTTAAAAGATTTAATTTACGACATG
ACAACATCAGGTTCTGGATCAGGTTTACCATTGCTTGTTCAGAGAACAATTGCGAGAACT
ATTGTGTTACAAGAAAGTATTGGCAAAGGTCGTTTTGGAGAAGTTTGGCGAGGAAAATGG
AGAGGAGAAGAAGTTGCTGTTAAAATATTCTCCTCTAGAGAAGAACGTTCATGGTTCCGT
GAAGCAGAGATTTATCAGACTGTCATGTTACGTCACGAAAACATCTTGGGATTTATAGCA
GCAGACAATAAAGACAATGGCACATGGACTCAGCTCTGGTTGGTGTCAGATTATCATGAG
CACGGATCCCTTTTTGATTATTTGAACAGATACACAGTTACTGTGGAAGGAATGATAAAA
CTTGCTCTGTCCACAGCAAGTGGACTTGCCCATCTTCACATGGAGATAGTTGGTACCCAA
GGAAAACCAGCCATAGCTCATAGGGATTTGAAATCAAAGAATATCTTGGTAAAGAAGAAT
GGAACTTGCTGTATTGCAGACTTAGGATTGGCAGTAAGGCATGATTCGGCCACGGATACA
ATTGACATTGCTCCAAACCACAGAGTGGGAACAAAAAGGTACATGGCCCCTGAAGTTCTA
GATGATTCCATAAATATGAAACACTTTGAATCCTTCAAACGTGCTGACATCTATGCAATG
GGACTAGTATTCTGGGAAGTAGCTCGACGATGTTCCATTGGTGGAATACATGAAGATTAC
CAGCTGCCTTATTATGATCTTGTACCTTCCGATCCATCAGTTGAAGAAATGAGAAAAGTT
GTTTGTGAACAGAAGTTAAGGCCAAATATTCCAAACAGATGGCAGAGCTGTGAAGCCTTG
AGAGTAATGGCTAAAATTATGAGAGAATGTTGGTATGCCAATGGAGCAGCTAGGCTTACA
GCTTTGCGGATTAAGAAAACATTGTCACAACTCAGTCAGCAGGAAGGCATCAAAATGTAA
Enzyme 26 GenBank Gene ID U97485 Link Image
Enzyme 26 GeneCard ID TGFBR1 Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Chromosome:9
Enzyme 26 Locus 9q22
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References
  1. [PubMed Link Image]
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 504
Enzyme 27 Name Protein phosphatase 1G
Enzyme 27 Synonyms
  1. Protein phosphatase 2C isoform gamma
  2. PP2C-gamma
  3. Protein phosphatase magnesium-dependent 1 gamma
  4. Protein phosphatase 1B
  5. Magnesium-dependent calcium inhibitable phosphatase
  6. MCPP
Enzyme 27 Gene Name PPM1G
Enzyme 27 Protein Sequence >Protein phosphatase 1G
MGAYLSQPNTVKCSGDGVGASRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYD
GHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGR
PTEDEDEKEKVADEDDVDNEEAALLHEEATMTIEELLTRYGQNCHKGAPHSKSGAGTGEE
PGSQGLNGEAGPEDPSRETSAEENGPTAKAHTGLSSNSECGTEAGQGGEPGTPTGEAGPS
CSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEEEDGYSSEEAENEEDEDDTEE
AEEDDEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDM
SYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALP
DIKVLTLTDDHEFMVIACDGIWNVMSSQEVIDFIQSKISQRDENGELRLLSSIVEELLDQ
CLAPDTSGDGTGCDNMTCIIICFKPRNTAAPQPESGKRKLEEVLSTEGAEENGNSDKKKA
KRD
Enzyme 27 Number of Residues 543
Enzyme 27 Molecular Weight 58606.3
Enzyme 27 Theoretical pI 3.99
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Signal transduction mechanisms
Enzyme 27 Specific Function A phosphoprotein + H(2)O = a protein + phosphate
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 1754694 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID P79126 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name PPM1G_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence >1632 bp
ATGGGTGCCTACCTCTCTCAGCCCAACACGGTGAAGTGCTCTGGAGACGGGGTCGGCGCT
TCGCGCCTGCCGCTGCCCTACGGCTTCTCCGCCATGCAAGGCTGGCGCGTCTCCATGGAG
GATGCTCACAACTGTATTCAAGAGCTGGACAGTGAGACAGCCATGTTTTCTGTCTATGAT
GGACATGGAGGGGAGGAAGTTGCCTTGTACTGTGCCAAATATCTTCCAGATATCATCAAA
GATCAGAAGGCCTACAAAGAAGGCAAGCTACAGAAGGCTTTGGAAGATGCCTTTTTGGCT
ATTGATGCCAAGCTAACCACTGAGGAAGTCATTAAGGAGCTGGCACAGATTGCAGGGCGA
CCCACTGAAGACGAGGATGAAAAAGAAAAAGTTGCTGATGAAGATGATGTGGACAATGAG
GAGGCTGCACTGCTGCATGAAGAGGCTACCATGACTATTGAAGAGCTGCTGACACGCTAC
GGGCAGAACTGTCACAAGGGTGCTCCCCACAGCAAATCTGGAGCTGGGACAGGCGAGGAA
CCAGGGTCCCAGGGCCTCAATGGGGAGGCGGGACCTGAGGACCCATCTAGGGAAACTTCT
GCAGAGGTAAATGGCCCCACAGCCAAGGCTCACACAGGCCTTTCCTCCAACTCGGAATGT
GGGACTGAGGCAGGCCAAGGTGGGGAGCCTGGCACTCCCACTGGTGAGGCTGGGCCTTCC
TGCTCTTCAGCCTCCGACAAGCTGCCTCGAGTTGATAAGTCCAAGTTCTTTGAGGACAGT
GAGGATGAGTCAGATGAGGCGGAGGAGGAAGAGGAAGACAGCGAGGAATGCAGTGAGGAA
GAAGATGGCTACAGCAGTGAAGAGGCAGAGAATGAGGAAGACGAGGATGACACTGAGGAG
GCTGAAGAGGATGATGAAGAAGAAGAGATGATGGTGCCTGGGATGGAAGGCAAAGAGGAG
CCTGGCTCTGACAGTGGTACAACAGCAGTGGTGGCTCTGATACGAGGGAAGCAGTTGATT
GTAGCCAATGCAGGAGACTCCCGCTGTGTGGTGTCTGAGGCCGGCAAAGCTTTAGACATG
TCCTATGACCACAAACCGGAGGATGAAGTGGAGCTAGCACGCATCAAGAATGCTGGGGGC
AAGGTTACCATGGATGGGCGAGTCAACGGTGGCCTCAACCTCTCCAGAGCCATTGGAGAC
CACTTTTACAAGAGAAACAAGAACTTGCCACCAGAGGAACAGATGATTTCGGCCCTTCCT
GACATCAAGGTGCTGACTCTCACAGATGATCATGAGTTTATGGTCATTGCCTGTGATGGC
ATATGGAATGTGATGAGCAGCCAGGAAGTTATAGACTTTATTCAATCGAAGATCAGCCAG
CGCGATGAAAATGGGGAGCTTCGGTTACTGTCATCCATTGTGGAATATCTGCTGGATCAA
TGCCTGGCACCAGACACTTCTGGGGACGGTACAGGGTGTGACAACATGACCTGCATCATC
ATTTGCTTCAAGCCCCGAAATACAGCAGCGCCTCAGCCAGAGAGTGGCAAGCGGAAACTG
GAGGAGGTGCTGTCTACCGAGGGGGCTGAACAAAATGGCCACAGTGACAAGAAGAAGGCC
AAGCGGGACTAG
Enzyme 27 GenBank Gene ID U81159 Link Image
Enzyme 27 GeneCard ID PPM1G Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:2
Enzyme 27 Locus 2p23.3
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References Not Available
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 511
Enzyme 28 Name Protein phosphatase 1L
Enzyme 28 Synonyms
  1. Protein phosphatase 1-like
  2. Protein phosphatase 2C isoform epsilon
  3. PP2C-epsilon
Enzyme 28 Gene Name PPM1L
Enzyme 28 Protein Sequence >Protein phosphatase 1L
MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVK
GKVAEIMQNDRLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLMDLANKTH
PSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREM
LEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERK
RIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILA
SDGLWDAFSNEEAVRFIKDRLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ
Enzyme 28 Number of Residues 360
Enzyme 28 Molecular Weight 41041.6
Enzyme 28 Theoretical pI 5.67
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Signal transduction mechanisms
Enzyme 28 Specific Function Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • 26-42
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 148744034 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID A5PJZ2 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name PPM1L_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >1083 bp
ATGATAGAGGATACAATGACTTTGCTATCTCTCCTGGGTCGCATCATGCGCTACTTCTTG
CTGAGACCCGAGACGCTGTTCCTGCTGTGCATCAGCCTGGCGCTGTGGAGTTACTTCTTC
CACACGGACGAGGTGAAGACTATCGTCAAATCCAGCCGGGACGCCGTGAAGATGGTGAAG
GGCAAAGTGGCCGAGATCATGCAGAACGATCGACTAGGGGGGCTCGACGTGCTGGAGGCT
GAGTTCTCCAAGACCTGGGAGTTCAAGAGCCACAATGTGGCGGTGTATTCCATCCAGGGT
CGGAGAGACCACATGGAGGACCGTTTCGAAGTTCTTATGGACCTAGCCAACAAGACGCAC
CCCTCTATCTTCGGGATCTTCGACGGGCACGGGGGCGAGACAGCAGCTGAATATGTAAAA
TCTCGACTCCCAGAGGCCCTTAAGCAGCATCTTCAAGACTACGAGAAAGACAAAGAAAAT
AGTGTATTGTCTTACCAGACCATCCTTGAACAGCAGATTCTATCAATTGACCGAGAAATG
CTAGAAAAATTGACTGTATCCTATGATGAAGCAGGTACAACGTGTTTGATTGCTCTGCTA
TCAGATAAAGACCTCACTGTGGCCAACGTGGGTGACTCGCGTGGGGTCCTATGTGACAAG
GATGGGAACGCCATTCCTTTGTCTCATGATCACAAACCCTACCAGCTGAAGGAGAGGAAG
AGGATAAAGAGAGCCGGTGGTTTTATCAGTTTCAATGGCTCCTGGAGGGTCCAGGGGATC
CTGGCCATGTCTCGATCGCTGGGGGATTATCCACTGAAAAACCTCAATGTGGTCATCCCA
GACCCAGATATCCTGACCTTTGACCTGGACAAGCTCCAGCCCGAGTTCATGATCTTGGCA
TCAGATGGCCTCTGGGATGCTTTCAGCAATGAGGAAGCTGTTCGATTCATCAAGGACCGC
TTGGATGAACCTCACTTTGGGGCCAAGAGCATCGTTTTACAGTCCTTTTACAGAGGCTGC
CCTGACAATATAACAGTCATGGTGGTGAAGTTCAGGAATAGCAGCAAAACAGAAGAGCAG
TGA
Enzyme 28 GenBank Gene ID BC142293 Link Image
Enzyme 28 GeneCard ID PPM1L Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:3
Enzyme 28 Locus 3q26.1
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References Not Available
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 512
Enzyme 29 Name Peroxisomal NADH pyrophosphatase NUDT12
Enzyme 29 Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 12
  2. Nudix motif 12
Enzyme 29 Gene Name NUDT12
Enzyme 29 Protein Sequence >Peroxisomal NADH pyrophosphatase NUDT12
MSSVKRSLNQEIISQFHYSAAEGDIAKLTAILSHSPSLLNETSENGWSALICDRSIVNKS
RQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEMKKEFFNYAGEISKEEEDGLVAWFALGIDTVAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRVCLKEDCPSLHGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQA
FFVPPSRAIAHQLIKHWIGMNPNL
Enzyme 29 Number of Residues 444
Enzyme 29 Molecular Weight 50119.1
Enzyme 29 Theoretical pI 6.69
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Replication, recombination and repair
Enzyme 29 Specific Function Hydrolyzes NAD(P)H to NMNH and AMP (2',5'-ADP), and diadenosine diphosphate to AMP. Has also activity towards NAD(P)(+), ADP-ribose and diadenosine triphosphate. May act to regulate the concentration of peroxisomal nicotinamide nucleotide cofactors required for oxidative metabolism in this organelle
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • None
Enzyme 29 Transmembrane Regions
  • None
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 88954139 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q29RH3 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name NUD12_BOVIN Link Image
Enzyme 29 PDB ID Not Available
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >1335 bp
ATGTCTTCTGTAAAAAGAAGTCTGAATCAAGAAATAATATCCCAGTTTCACTATTCAGCT
GCAGAAGGAGATATTGCCAAGTTAACAGCAATACTCAGTCATTCTCCATCTCTTCTCAAT
GAAACTTCTGAAAATGGCTGGAGTGCTTTAATATGCGACAGATCCATTGTCAACAAATCA
AGGCAGACTGCACTGGATATAGCTAAATTTTGGGGTTATAAGCATATAGCTAACTTATTA
GCTAATGCTAAAGGTGGGAAGAAGCCTTGGTTCCTAACCAATGAAGTGGAAGAATGTGAA
AATTATTTTAGCAAGACACTACTGGACCGGAAAAGTGAAAAAAGAAATAATTCTGACTGG
CTGTTAGCAAAAGAAAGCCATCCAGCCACAGTTTATATCCTTTTCTCAGATTTAAATCCC
TTGGTTACTCTAGGAGGCAATAAAGAAAGTTTTCAACAGCCAGAAGTCAGGCTTTGTCAG
CTGAACTACACAGATATAAAGGATTATTTGGCTCAGCCTGAAAAGATCACCTTGATTTTC
CTTGGAGTAGAACTTGAAATGAAAAAAGAGTTTTTTAATTATGCTGGGGAAATCTCAAAA
GAAGAAGAAGATGGGTTGGTTGCCTGGTTTGCTTTAGGTATAGATACTGTTGCTGCTGAA
GAATTTAAGCAAAGGCATGAAAATTGTTATTTTCTTCATCCACCAATGCCAGCTCTTCTG
CAATTGAAAGAAAAAGAAGCTGGGGTTGTAGCTCAAGCAAGATCTGTTCTCGCTTGGCAC
AGTCGGTATAAGTTCTGCCCAACCTGTGGAAATGCAACTAAAATTGAAGAAGGTGGCTAT
AAAAGAGTATGCTTAAAAGAAGACTGTCCTAGTCTCCATGGTGTTCACAATACATCATAC
CCAAGAGTTGATCCAGTGGTAATCATGCAAGTTATTCATCCCGATGGGACCAAATGTCTT
TTAGGCAGGCAGAAGAGATTTCCTCCGGGCATGTTTACTTGCCTCGCTGGATTTATTGAA
CCTGGGGAGACAATAGAAGACGCTGTTCGGAGAGAAGTAGAAGAGGAAAGTGGAGTCAAA
GTTGGCCATGTTCAGTATGTCTCTTGTCAACCGTGGCCAATGCCCTCTTCCTTAATGATT
GGTTGCTTAGCTGTGGCAGTGTCTACAGAAATTAAAGTTGACAAGAATGAAATAGAGGAT
GCCCGCTGGTTCACTAGAGAACAGGTTGTGGATGTTCTGACCAAAGGCAAGCAGCAGGCA
TTCTTTGTTCCACCGAGCCGAGCTATTGCACATCAGTTAATCAAACACTGGATTGGAATG
AACCCCAATCTCTAA
Enzyme 29 GenBank Gene ID BC114173 Link Image
Enzyme 29 GeneCard ID NUDT12 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Chromosome:5
Enzyme 29 Locus 5q21.2
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References Not Available
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 516
Enzyme 30 Name Isocitrate dehydrogenase [NADP] cytoplasmic
Enzyme 30 Synonyms
  1. IDH
  2. Cytosolic NADP-isocitrate dehydrogenase
  3. Oxalosuccinate decarboxylase
  4. NADP(+)-specific ICDH
  5. IDP
Enzyme 30 Gene Name IDH1
Enzyme 30 Protein Sequence >Isocitrate dehydrogenase [NADP] cytoplasmic
MSQKIQGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEISYTPSDGSPKTVYLVHNFTESGGVAM
GMYNQDKSIEDFAHSSFQMALSKNWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSEFE
AQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETLTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLQLKLAQAKL
Enzyme 30 Number of Residues 414
Enzyme 30 Molecular Weight 46785.1
Enzyme 30 Theoretical pI 6.52
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Energy production and conversion
Enzyme 30 Specific Function May act as a corneal epithelial crystallin and may be involved in maintaining corneal epithelial transparency
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • None
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 4959708 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID Q9XSG3 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name IDHC_BOVIN Link Image
Enzyme 30 PDB ID 1T0L Link Image
Enzyme 30 PDB File Show
Enzyme 30 3D Structure
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >1245 bp
ATGTCTCAAAAAATCCAAGGCGGGTCTGTGGTAGAGATGCAAGGAGATGAAATGACACGG
ATCATTTGGGAGTTGATTAAAGAGAAACTCATTTTTCCCTACGTGGAACTGGACCTGCAC
AGCTACGATTTAGGCATAGAGAATCGCGATGCCACCAACGACCAGGTCACCAAGGACGCT
GCAGAAGCTATAAAGAAGTACAACGTTGGTGTCAAGTGTGCCACCATCACCCCCGATGAG
AAGAGAGTGGAGGAATTCAAGTTGAAACAAATGTGGAAGTCTCCAAATGGCACCATCCGA
AATATCCTGGGTGGCACTGTCTTCAGGGAAGCTATTATCTGCAAAAATATACCCCGGCTT
GTGAGCGGATGGGTAAAACCCATTATCATAGGTCGTCATGCTTATGGGGATCAATATAGA
GCAACCGATTTTGTTGTGCCAGGGCCTGGAAAAGTAGAGATATCCTACACACCAAGCGAT
GGATCCCCCAAAACGGTATACCTAGTACATAACTTCACAGAGAGTGGTGGTGTTGCCATG
GGGATGTACAATCAAGATAAGTCAATCGAAGATTTTGCGCACAGTTCTTTCCAGATGGCT
TTGTCTAAGAACTGGCCTTTGTATCTGAGCACCAAAAACACTATTCTGAAGAAATACGAT
GGACGTTTTAAAGACATCTTTCAGGAGATATATGACAAGCAGTACAAATCTGAGTTTGAA
GCTCAGAATATCTGGTATGAGCACAGGCTCATTGATGACATGGTGGCCCAAGCTATGAAA
TCGGAGGGGGGCTTCATTTGGGCCTGTAAGAACTATGATGGGGACGTGCAGTCGGACTCC
GTGGCCCAAGGTTATGGCTCTCTCGGCATGATGACCAGTGTGCTGGTTTGTCCAGATGGC
AAGACAGTAGAAGCAGAGGCTGCCCACGGGACTGTAACCCGTCACTACCGAATGTACCAG
AAAGGACAGGAGACATTGACCAATCCCATTGCTTCCATTTTTGCCTGGACCAGAGGCTTA
GCCCACAGAGCTAAGCTTGATAACAATAAAGAGCTCAGCTTTTTTGCAAAGGCTTTGGAA
GAAGTCTGTATTGAGACCATTGAGGCTGGCTTCATGACCAAGGACTTAGCTGCATGTATT
AAAGGTTTACCCAACGTGCAACGTTCTGACTACTTGAATACATTTGAGTTCATGGATAAA
CTCGGAGAGAACCTGCAGTTAAAACTAGCCCAGGCCAAACTTTAA
Enzyme 30 GenBank Gene ID AF136009 Link Image
Enzyme 30 GeneCard ID IDH1 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:2
Enzyme 30 Locus 2q33.3
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References
  1. [PubMed Link Image]
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 521
Enzyme 31 Name Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
Enzyme 31 Synonyms
  1. Isocitric dehydrogenase
  2. NAD(+)-specific ICDH
  3. Isocitrate dehydrogenase subunits 3/4
Enzyme 31 Gene Name IDH3A
Enzyme 31 Protein Sequence >Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
MAGPAWISKVSRLLGAFHNQKQVTRGFAGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAP
IQWEERNVAAIQGPGGKWMIPPEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYHDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEAASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAENCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAAKIETACFATIKDGKSLTKDLGGNSKCSDFTEEICR
RVKDLD
Enzyme 31 Number of Residues 366
Enzyme 31 Molecular Weight 39667.5
Enzyme 31 Theoretical pI 7.22
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Energy production and conversion
Enzyme 31 Specific Function Isocitrate + NAD(+) = 2-oxoglutarate + CO(2) + NADH
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function
Enzyme 31 Signals
  • None
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 902743 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID P41563 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name IDH3A_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence >1101 bp
ATGGCAGGGCCCGCGTGGATCTCCAAGGTCTCTCGGCTGCTGGGGGCATTCCACAACCAA
AAACAGGTGACCAGAGGTTTTGCTGGTGGTGTTAAGACAGTAACTTTAATTCCAGGAGAT
GGAATTGGCCCAGAAATTTCTGCTGCAGTTATGAAGATTTTTGATGCTGCCAAAGCACCT
ATTCAGTGGGAGGAGCGAAACGTCGCCGCCATTCAAGGTCCGGGAGGCAAGTGGATGATC
CCTCCAGAAGCCAAAGAGTCCATGGATAAGAACAAGATGGGCTTGAAAGGCCCTTTAAAA
ACACCAATAGCTGCTGGTCACCCATCTATGAATTTATTGCTGCGTAAAACATTTGACCTT
TATGCAAATGTCCGACCATGTGTCTCAATCGAAGGCTATAAAACCCCTTACCATGATGTA
AATATTGTCACCATTCGAGAGAACACGGAAGGAGAATACAGTGGAATCGAGCATGTGATC
GTGGATGGAGTTGTGCAGAGTATCAAGCTCATCACCGAGGCAGCGAGCAAGCGCATCGCG
GAGTTTGCATTTGAATACGCACGGAACAACCACCGGAGCAACGTCACAGCCGTGCACAAA
GCCAACATCATGCGAATGTCAGATGGGCTTTTTCTGCAAAAATGCAGGGAAGTTGCAGAA
AACTGTAAAGATATTAAATTTAATGAGATGTACCTTGATACAGTATGTTTGAATATGGTC
CAAGACCCGTCCCAGTTTGATGTTCTTGTTATGCCAAATTTGTATGGAGACATCCTTAGT
GACCTGTGTGCGGGATTGATTGGAGGTCTTGGTGTGACACCAAGCGGCAACATTGGAGCC
AACGGAGTTGCAATCTTCGAGTCGGTTCACGGGACCGCCCCGGACATTGCGGGCAAGGAC
ATGGCCAATCCCACAGCCCTCCTGCTCAGCGCCGTGATGATGCTGCGCCACATGGGGCTT
TTTGACCACGCTGCGAAGATTGAGACGGCGTGTTTTGCTACAATTAAGGATGGAAAGAGC
TTAACCAAAGATTTGGGAGGCAATTCAAAGTGCTCGGACTTCACAGAAGAAATCTGTCGC
CGAGTAAAAGATTTAGATTAA
Enzyme 31 GenBank Gene ID U07980 Link Image
Enzyme 31 GeneCard ID IDH3A Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:1
Enzyme 31 Locus 15q25.1-q25.2
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References
  1. [PubMed Link Image]
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 524
Enzyme 32 Name Protein phosphatase 1A
Enzyme 32 Synonyms
  1. Protein phosphatase 2C isoform alpha
  2. PP2C-alpha
Enzyme 32 Gene Name PPM1A
Enzyme 32 Protein Sequence >Protein phosphatase 1A
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVYFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPE
AVKKEEELDKYLESRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSTSTDDMW
Enzyme 32 Number of Residues 382
Enzyme 32 Molecular Weight 42529.5
Enzyme 32 Theoretical pI 4.89
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Signal transduction mechanisms
Enzyme 32 Specific Function Enzyme with a broad specificity
Enzyme 32 Pathways Not Available
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • None
Enzyme 32 Transmembrane Regions
  • None
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 3063743 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID O62829 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name PPM1A_BOVIN Link Image
Enzyme 32 PDB ID 1A6Q Link Image
Enzyme 32 PDB File Show
Enzyme 32 3D Structure
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >1149 bp
ATGGGAGCATTTTTAGACAAACCAAAGATGGAAAAACATAATGCCCAGGGGCAGGGTAAT
GGGTTGCGATATGGGCTAAGCAGCATGCAAGGCTGGCGAGTTGAAATGGAGGATGCACAT
ACTGCTGTGATCGGTCTGCCAAGTGGACTTGAAACATGGTCATTCTTTGCTGTGTATGAT
GGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGCATTTGTTAGATCACATCACC
AATAACCAGGATTTTAAAGGGTCTGCAGGAGCACCTTCTGTGGAAAATGTAAAGAATGGA
ATCAGAACAGGCTTCCTGGAGATTGATGAACATATGAGAGTTATGTCAGAGAAGAAACAT
GGTGCTGATAGGAGTGGGTCAACAGCTGTGGGTGTCTTAATTTCTCCTCAACACACGTAT
TTCATTAACTGTGGAGACTCAAGAGGTTTACTTTGTAGGAACAGGAAAGTTTACTTCTTC
ACACAAGATCACAAACCAAGTAATCCGCTGGAAAAAGAACGAATTCAGAATGCAGGTGGT
TCTGTAATGATTCAGCGTGTGAATGGCTCTCTGGCTGTGTCGAGGGCCCTTGGGGACTTT
GATTACAAATGTGTCCATGGAAAAGGTCCTACAGAGCAGCTTGTTTCACCAGAGCCTGAA
GTCCATGATATTGAAAGATCTGAAGAAGATGATCAATTCATTATTCTTGCATGTGATGGT
ATTTGGGATGTCATGGGAAATGAAGAGCTCTGTGATTTTGTAAGATCCAGACTTGAAGTC
ACTGATGACCTTGAGAAAGTTTGCAATGAAGTAGTCGACACCTGTTTGTATAAGGGAAGT
CGAGACAACATGAGTGTGATATTGATCTGTTTTCCAAATGCACCCAAAGTATCGCCAGAA
GCAGTGAAGAAGGAGGAAGAGTTGGACAAATACCTGGAAAGCAGAGTAGAAGAAATCATA
AAGAAGCAGGGGGAAGGCGTCCCTGACTTAGTCCATGTGATGCGCACATTAGCGAGTGAG
AACATACCCAGCCTCCCACCAGGGGGTGAACTGGCAAGCAAGCGGAATGTAATTGAAGCC
GTTTACAATAGACTGAATCCATACAAAAATGATGACACCGACTCTACATCAACTGATGAT
ATGTGGTAA
Enzyme 32 GenBank Gene ID AJ005457 Link Image
Enzyme 32 GeneCard ID PPM1A Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:1
Enzyme 32 Locus 14q23.1
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References
  1. [PubMed Link Image]
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 553
Enzyme 33 Name Arginase-1
Enzyme 33 Synonyms
  1. Type I arginase
  2. Liver-type arginase
Enzyme 33 Gene Name ARG1
Enzyme 33 Protein Sequence >Arginase-1
MSSKPQSIGVIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKELECDVKDYGDLSFADNLD
DSPFQIVKNPRCVGKASEKLADVVAEVKKTGRISLVLGGDHSLAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTKTGNLHGQPVSFLLKELKEKMPEVPGFYWVAPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVQGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTTVAIT
MACFGVAREGNHKPIDYLSPPK
Enzyme 33 Number of Residues 322
Enzyme 33 Molecular Weight 35009.0
Enzyme 33 Theoretical pI 6.51
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Amino acid transport and metabolism
Enzyme 33 Specific Function L-arginine + H(2)O = L-ornithine + urea
Enzyme 33 Pathways
  • Nitrogen metabolism
  • urea cycle
  • L-ornithine and urea from L-arginine:step 1/1
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • None
Enzyme 33 Transmembrane Regions
  • None
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 86824019 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID Q2KJ64 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name ARGI1_BOVIN Link Image
Enzyme 33 PDB ID Not Available
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence >969 bp
ATGAGTTCCAAGCCACAGTCCATCGGGGTCATTGGAGCTCCCTTCTCAAAGGGCCAGCCA
CGAGGAGGGGTGGAAGAAGGCCCTACAGTACTTAGAAAGGCTGGTCTGCTTGAGAAACTT
AAAGAACTAGAGTGTGATGTGAAAGATTATGGGGACCTGTCCTTTGCTGATAATCTTGAT
GACAGTCCCTTTCAAATTGTGAAGAATCCAAGGTGTGTGGGAAAAGCAAGTGAAAAGCTG
GCTGATGTGGTGGCAGAAGTCAAGAAGACTGGAAGGATCAGCCTTGTCCTGGGCGGAGAC
CACAGTTTGGCGATCGGCAGCATCTCTGGCCATGCCAGGGTCCACCCAGACCTCTGTGTC
ATTTGGGTGGATGCTCACACGGACATCAACACTCCACTGACAACCAAAACCGGGAACTTG
CATGGACAACCTGTGTCTTTCCTTCTGAAGGAACTAAAGGAAAAGATGCCTGAGGTCCCA
GGATTCTACTGGGTGGCTCCCTGCATATCTGCCAAAGACATTGTGTATATTGGTCTGAGA
GATGTGGACCCTGGGGAACACTATATTTTGAAAACTCTGGGAATTAAATACTTTTCAATG
ACTGAAGTGGATAAACTGGGAATTGGCAAGGTGATGGAAGAAACATTCAGCTATCTACTA
GGAAGAAAGAAAAGGCCAATTCATTTGAGCTTTGATGTTGATGGACTGGACCCATCTTTC
ACGCCAGCTACTGGCACACCAGTCCAGGGAGGTCTGACTTACAGAGAAGGTCTCTACATC
ACAGAAGAAATTTACAAAACAGGTTTACTCTCAGGATTAGATATAATGGAAGTGAATCCG
TCTCTGGGGAAGACACCAGAAGAAGTGACTCGAACAGTGAACACAACAGTAGCAATAACC
ATGGCTTGCTTTGGGGTTGCTCGAGAGGGTAACCATAAACCTATTGATTACCTTAGCCCA
CCAAAGTAA
Enzyme 33 GenBank Gene ID BC105497 Link Image
Enzyme 33 GeneCard ID ARG1 Link Image
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Chromosome:6
Enzyme 33 Locus 6q23
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References Not Available
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 558
Enzyme 34 Name Arginase-2, mitochondrial
Enzyme 34 Synonyms
  1. Arginase II
Enzyme 34 Gene Name ARG2
Enzyme 34 Protein Sequence >Arginase-2, mitochondrial
MSLRSHLSRLLRTQVHSVRKKSVHSVAVIGAPFSQGQKRKGVEYGPAAVRXAGLMKRLSD
LGCHLKDFGDLNFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLGVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGIYITEEIHSTGLLSALDLVEVNPR
LAVSEEEAKATASLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESESEERVRI
Enzyme 34 Number of Residues 354
Enzyme 34 Molecular Weight 38561.5
Enzyme 34 Theoretical pI 6.45
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Amino acid transport and metabolism
Enzyme 34 Specific Function May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis
Enzyme 34 Pathways
  • Nitrogen metabolism
  • urea cycle
  • L-ornithine and urea from L-arginine:step 1/1
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • None
Enzyme 34 Transmembrane Regions
  • None
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 61553631 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID Q58DL1 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name ARGI2_BOVIN Link Image
Enzyme 34 PDB ID 1PQ3 Link Image
Enzyme 34 PDB File Show
Enzyme 34 3D Structure
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >1065 bp
ATGTCCCTGAGGAGCCACCTCTCGCGTCTCCTCCGGACGCAAGTGCACTCCGTCCGGAAG
AAGTCTGTCCACTCCGTGGCTGTCATTGGAGCCCCATTCTCCCAGGGACAGAAAAGAAAA
GGAGTGGAATATGGTCCTGCTGCTGTAAGANAAGCTGGCTTGATGAAAAGGCTCTCGGAT
CTGGGCTGCCACCTTAAAGACTTCGGAGATTTGAATTTTACTCCAGTTCCCAAAGATGAT
CTCTATAACAACTTGATAGTGAATCCTCGCTCAGTGGGCCTGGCCAACCAGGAACTAGCG
GAGGTGGTTAGCCGAGCTGTGTCAGGTGGCTACAGCTGTGTCACGGTGGGAGGAGACCAC
AGCCTGGCAATCGGTACCATCAGTGGCCACGCCCGACACTGCCCAGACCTTGGTGTGATC
TGGGTTGATGCCCATGCTGACATCAATACACCCCTCACCACTTCATCTGGAAATCTACAT
GGACAGCCAGTTTCGTTTCTCCTCAGAGAACTACAGGACAAGGTACCACAGCTCCCAGGA
TTTTCCTGGATCAAACCTTGTATCTCTTCTCCAAGTATTGTATATATTGGACTAAGAGAC
GTGGACCCTCCTGAACATTTTATTTTAAAGAATTATGATATCCAGTATTTTTCCATGAGA
GACATAGATCGACTTGGTATCCAGAAGGTCATGGAACAGACATTCGATCTGCTGATTGGC
AAAAGACAAAGGCCAATCCATCTGAGTTTCGATATTGATGCATTTGACCCTACACTGGCT
CCAGCCACAGGAACCCCTGTTGTAGGGGGACTGACCTATCGAGAAGGCATATATATTACT
GAGGAAATACACAGTACAGGGTTGCTCTCGGCCCTGGACCTCGTTGAAGTCAATCCTCGG
TTGGCCGTGTCAGAGGAGGAGGCCAAGGCTACAGCCAGCCTGGCAGTGGACGTCATTGCT
TCGAGTTTCGGGCAGACGAGGGAGGGAGGGCATATTGTCTACGACCAACTTCCAACTCCC
AGCTCACCAGATGAATCAGAGAGTGAAGAACGTGTAAGAATTTAG
Enzyme 34 GenBank Gene ID BT021586 Link Image
Enzyme 34 GeneCard ID ARG2 Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Chromosome:1
Enzyme 34 Locus 14q24.1-q24.3
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References
  1. [PubMed Link Image]
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 586
Enzyme 35 Name Superoxide dismutase [Mn], mitochondrial
Enzyme 35 Synonyms Not Available
Enzyme 35 Gene Name SOD2
Enzyme 35 Protein Sequence >Superoxide dismutase [Mn], mitochondrial
MLSRAACSTSRRLVPALSVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVAEEKYREALEKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPQGELLEA
IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK
Enzyme 35 Number of Residues 222
Enzyme 35 Molecular Weight 24637.8
Enzyme 35 Theoretical pI 8.76
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Inorganic ion transport and metabolism
Enzyme 35 Specific Function Destroys radicals which are normally produced within the cells and which are toxic to biological systems
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • None
Enzyme 35 Transmembrane Regions
  • None
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 498260 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID P41976 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name SODM_BOVIN Link Image
Enzyme 35 PDB ID 1LUV Link Image
Enzyme 35 PDB File Show
Enzyme 35 3D Structure
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence Not Available
Enzyme 35 GenBank Gene ID L22092 Link Image
Enzyme 35 GeneCard ID SOD2 Link Image
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Chromosome:6
Enzyme 35 Locus 6q25.3
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References
  1. [PubMed Link Image]
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 600
Enzyme 36 Name Trifunctional purine biosynthetic protein adenosine-3
Enzyme 36 Synonyms
  1. Phosphoribosylamine--glycine ligase
  2. Glycinamide ribonucleotide synthetase
  3. GARS
  4. Phosphoribosylglycinamide synthetase
  5. Phosphoribosylformylglycinamidine cyclo-ligase
  6. Phosphoribosyl-aminoimidazole synthetase
  7. AIR synthase
  8. AIRS
  9. Phosphoribosylglycinamide formyltransferase
  10. 5'-phosphoribosylglycinamide transformylase
  11. GAR transformylase
  12. GART
Enzyme 36 Gene Name GART
Enzyme 36 Protein Sequence >Trifunctional purine biosynthetic protein adenosine-3
MAARVLVIGNGGREHTLAWKLAQSTHVKQVLVTPGNAGTACSEKISNTDISISDHTALAQ
FCKDEKIEFVVVGPEAPLAAGIVGNLNSVGVRCFGPTAQAAQLESSKRFAKEFMDRHGIS
TARWRAFTKPKEACDFIMSADFPALVVKASGLAAGKGVIVAKSKEEACEAVREIMQGKAF
GEAGETVVIEELLEGEEVSCLCFTDGRTVAPMPPAQDHKRLLEGDEGPNTGGMGAYCPAP
QVSKDLLLKIKNNILQRTVDGMQEEGMPYTGVLYAGIMLTKNGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSILDGLLCTSLPVWLDNCAAVTVVMASKGYPGDYTKGVEITGFPEA
QALGLEVFQAGTALKDGKVVTNGGRVLTVTAIRENLISALEEARKGLAAIKFEGAVYRKD
IGFRAIAFLQQPRGLTYKESGVDIAAGNMLVQKIKPLAKATSRPGCDVDLGGFAGLFDLK
AAGFTDPLLACGTDGVGTKLKIAQQCSKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLRTTEAVITGIAKACKKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
QLERITEGDAVIGIASSGLHSNGFSLVRKIVAKSSLEYSSPAPGGCGDQTLGDLLLTPTK
IYSRSLLPVLRSGRVKAVAHITGGGLLENIPRVLPQKLGVNLDAQTWRVPRIFSWLQQEG
HLSEEEMARTFNCGIGAALVVSEDLVKQTLQDIEQHQEEACVIGRVVACPKGSPRVKVEH
LIETMQINGSVLENGTLRNHFSVQPKKARVAVLISGTGSNLQALIDSTREPSSLAHIVIV
ISNKAAVAGLDKAEKAGIPTRVINHKLYKNRAAFDTAIDEVLEEFSTDIVCLAGFMRILS
GPFVRKWNGKMLNIHPSLLPSFKGSNAHEQVLDAGVTVTGCTVHFVAEDVDAGQIILQEA
VPVKRGDTVETLSERVKLAEHKIFPSALQLVASGAVRLGENGRICWVTED
Enzyme 36 Number of Residues 1010
Enzyme 36 Molecular Weight 107906.5
Enzyme 36 Theoretical pI 6.34
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Nucleotide transport and metabolism
Enzyme 36 Specific Function ATP + 5-phospho-D-ribosylamine + glycine = ADP + phosphate + N(1)-(5-phospho-D-ribosyl)glycinamide
Enzyme 36 Pathways
  • Purine metabolism
  • IMP biosynthesis via de novo pathway
  • N(2)-formyl-N(1)-(5-phospho-D-ribosyl)glycinamide from N(1)-(5- phospho-D-ribosyl)glycinamide (10-formyl THF route):step 1/1
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein 113912153 Link Image
Enzyme 36 UniProtKB/Swiss-Prot ID Q59A32 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name PUR2_BOVIN Link Image
Enzyme 36 PDB ID Not Available
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence >3033 bp
ATGGCAGCCCGAGTACTTGTCATTGGCAATGGAGGACGAGAACACACGCTGGCCTGGAAA
CTTGCACAGTCTACTCATGTCAAACAAGTGTTGGTTACCCCAGGAAATGCAGGCACTGCC
TGCTCTGAGAAGATTTCAAATACTGACATCTCAATCAGTGATCATACTGCCCTTGCGCAG
TTCTGCAAAGATGAGAAAATTGAATTCGTAGTTGTTGGACCAGAGGCACCTCTAGCTGCT
GGAATTGTTGGGAACCTGAACTCTGTGGGAGTTCGGTGCTTTGGCCCCACAGCACAAGCA
GCTCAGTTAGAGTCCAGCAAGAGATTTGCCAAAGAGTTTATGGACCGACATGGAATCTCA
ACTGCAAGATGGAGAGCTTTCACTAAACCTAAAGAAGCCTGTGACTTCATTATGAGTGCA
GACTTCCCTGCTTTGGTTGTGAAGGCCAGTGGTCTTGCAGCTGGGAAAGGGGTAATTGTT
GCCAAGAGCAAAGAGGAGGCCTGTGAAGCTGTCAGAGAGATTATGCAGGGTAAAGCTTTC
GGAGAAGCAGGAGAAACAGTTGTCATTGAAGAACTTCTTGAAGGAGAAGAGGTGTCTTGT
CTGTGCTTCACTGATGGACGGACTGTGGCCCCCATGCCCCCAGCACAGGACCATAAGCGA
TTGCTGGAGGGCGATGAGGGCCCCAACACGGGAGGAATGGGAGCCTATTGTCCAGCCCCT
CAGGTTTCTAAGGATTTGTTGCTAAAAATTAAAAATAATATTCTTCAGAGGACAGTGGAT
GGCATGCAGGAGGAGGGTATGCCATACACAGGTGTCCTCTATGCTGGTATAATGCTGACC
AAGAACGGCCCCAAAGTTCTGGAATTTAATTGCCGTTTCGGTGATCCAGAGTGCCAAGTG
ATCCTCCCACTTCTTAAAAGTGATCTTTATGAAGTGATTCAGTCTATCTTAGATGGCTTG
CTCTGCACTTCTCTGCCTGTTTGGCTGGACAACTGTGCTGCCGTAACTGTGGTCATGGCA
AGTAAAGGTTATCCAGGAGACTACACCAAGGGTGTAGAGATAACAGGGTTTCCTGAGGCT
CAGGCTTTAGGACTGGAGGTGTTCCAAGCAGGCACTGCCCTAAAAGATGGCAAGGTGGTG
ACTAACGGGGGTAGGGTCCTTACTGTCACGGCCATCAGGGAAAATCTCATCTCAGCTCTT
GAAGAAGCCAGGAAAGGACTTGCCGCCATAAAGTTTGAGGGAGCTGTTTATAGGAAAGAC
ATCGGCTTTCGAGCCATAGCTTTCCTCCAGCAGCCCAGGGGCCTGACTTACAAGGAATCT
GGGGTAGACATTGCAGCTGGTAATATGCTGGTCCAGAAAATTAAACCTTTAGCGAAGGCC
ACCTCCAGACCAGGCTGTGATGTTGATCTTGGAGGTTTTGCTGGTCTTTTTGATTTGAAA
GCAGCTGGTTTCACTGATCCTCTTCTGGCTTGTGGAACAGATGGTGTTGGGACGAAACTG
AAGATTGCCCAGCAGTGCAGTAAACATGACACCATTGGTCAGGATTTGGTTGCGATGTGT
GTAAATGACATTCTGGCACAAGGAGCAGAGCCCCTCTTTTTCCTCGATTACTTTTCCTGT
GGAAAACTTGACCTCCGTACTACTGAAGCTGTTATCACTGGGATCGCCAAAGCTTGTAAA
AAGGCTGGATGTGCTCTCCTCGGAGGTGAAACGGCAGAGATGCCTGACATGTACCCTCCT
GGAGAGTATGATCTAGCTGGTTTTGCCGTTGGCGCCATGGAGCGGGATCAGAAACTTCCT
CAACTGGAAAGAATCACGGAAGGAGACGCTGTTATTGGAATCGCTTCATCTGGTCTTCAC
AGCAACGGATTCAGCCTTGTGAGGAAAATTGTAGCAAAATCTTCTCTCGAGTACTCTTCT
CCAGCACCTGGTGGCTGTGGTGACCAGACCTTAGGTGACTTACTTCTAACCCCAACCAAA
ATCTACAGCCGCTCACTGTTACCTGTCCTGCGTTCAGGACGTGTTAAGGCCGTTGCACAT
ATTACTGGTGGAGGATTACTGGAAAACATCCCCAGAGTCCTCCCTCAGAAATTGGGGGTG
AATTTAGATGCCCAGACCTGGAGGGTCCCCAGGATCTTCTCATGGTTACAGCAGGAAGGC
CACCTCTCTGAAGAGGAGATGGCCAGAACATTTAACTGTGGGATTGGGGCTGCCCTCGTG
GTATCAGAGGACCTGGTGAAGCAGACTCTGCAGGATATTGAGCAGCACCAGGAAGAAGCC
TGCGTGATCGGCAGAGTGGTTGCATGTCCCAAGGGTTCTCCTCGTGTGAAAGTCGAGCAT
CTGATTGAAACCATGCAAATAAATGGATCAGTATTGGAGAATGGAACCCTGAGAAATCAT
TTCTCTGTTCAACCAAAAAAGGCAAGAGTAGCTGTCTTAATTTCTGGGACAGGATCAAAC
CTCCAAGCTCTCATAGACAGCACTAGGGAGCCAAGTAGCTTGGCACACATTGTCATTGTG
ATCTCCAACAAAGCTGCAGTGGCTGGGTTAGATAAAGCAGAAAAAGCCGGGATTCCCACG
AGAGTAATTAATCATAAATTATATAAAAATCGTGCAGCATTTGACACTGCAATTGACGAA
GTCCTTGAAGAGTTCTCCACAGACATAGTCTGTCTTGCAGGATTCATGAGAATTTTGTCT
GGCCCCTTCGTCAGAAAATGGAATGGGAAAATGCTCAATATCCACCCATCCTTGCTCCCT
TCGTTTAAGGGTTCAAATGCCCATGAACAAGTCCTGGATGCTGGGGTCACAGTCACCGGG
TGCACCGTGCACTTTGTAGCTGAAGATGTAGATGCCGGTCAAATTATCTTACAGGAAGCC
GTTCCAGTGAAGAGGGGTGACACTGTTGAAACTCTATCTGAGAGAGTAAAATTAGCAGAA
CATAAAATATTTCCCTCAGCCCTCCAGCTGGTGGCCAGTGGAGCTGTACGGCTTGGAGAA
AATGGCAGAATCTGTTGGGTCACAGAGGACTGA
Enzyme 36 GenBank Gene ID BC122573 Link Image
Enzyme 36 GeneCard ID GART Link Image
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Chromosome:2
Enzyme 36 Locus 21q22.1|21q22.11
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References
  1. [PubMed Link Image]
Enzyme 36 Metabolite References Not Available
Enzyme 37 [top]
Enzyme 37 ID 604
Enzyme 37 Name Beta-1,4-galactosyltransferase 1
Enzyme 37 Synonyms
  1. Beta-1,4-GalTase 1
  2. Beta4Gal-T1
  3. b4Gal-T1
  4. UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
  5. UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
  6. Lactose synthase A protein
  7. N-acetyllactosamine synthase
  8. Nal synthetase
  9. Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
  10. Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
  11. Processed beta-1,4-galactosyltransferase 1
Enzyme 37 Gene Name B4GALT1
Enzyme 37 Protein Sequence >Beta-1,4-galactosyltransferase 1
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL
QGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTS
APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH
KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL
KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ
FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF
DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Enzyme 37 Number of Residues 402
Enzyme 37 Molecular Weight 44842.2
Enzyme 37 Theoretical pI 9.60
Enzyme 37 GO Classification
Function
Process
Component
Enzyme 37 General Function Involved in alpha-tubulin binding
Enzyme 37 Specific Function The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix
Enzyme 37 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 37 Reactions Not Available
Enzyme 37 Pfam Domain Function
Enzyme 37 Signals
  • None
Enzyme 37 Transmembrane Regions
  • 25-44
Enzyme 37 Essentiality Not Available
Enzyme 37 GenBank ID Protein 382 Link Image
Enzyme 37 UniProtKB/Swiss-Prot ID P08037 Link Image
Enzyme 37 UniProtKB/Swiss-Prot Entry Name B4GT1_BOVIN Link Image
Enzyme 37 PDB ID 1FR8 Link Image
Enzyme 37 PDB File Show
Enzyme 37 3D Structure
Enzyme 37 Cellular Location Not Available
Enzyme 37 Gene Sequence >1209 bp
ATGAAGTTTCGGGAGCCGCTCCTGGGCGGCAGTGCCGCGATGCCGGGCGCGTCCCTGCAG
CGGGCCTGCCGCCTCCTCGTGGCTGTCTGCGCCCTGCATCTTGGCGTCACCCTCGTCTAT
TACCTGGCCGGCCGAGACCTAAGACGCCTGCCTCAGCTGGTCGGAGTCCACCCACCGCTT
CAGGGAAGCTCTCACGGCGCCGCCGCTATCGGGCAGCCCTCCGGGGAGCTCCGGCTGCGA
GGGGTCGCACCGCCGCCGCCTTTGCAGAACTCTTCCAAGCCGCGCTCGCGGGCCCCCTCC
AACCTAGACGCGTACTCTCACCCCGGCCCTGGCCCGGGCCCGGGGAGCAACTTGACTTCG
GCCCCAGTGCCCTCCACCACAACACGCTCGCTGACCGCATGCCCTGAGGAGTCCCCGCTG
CTCGTCGGCCCCATGCTGATTGAGTTTAACATACCTGTGGACCTGAAGCTTATCGAGCAG
CAGAACCCGAAGGTGAAGTTGGGTGGTCGCTACACCCCCATGGACTGCATCTCTCCTCAC
AAGGTGGCCATCATCATTCTATTCCGCAACCGGCAGGAACACCTCAAGTACTGGCTGTAT
TACTTGCACCCAATGGTACAGCGTCAGCAGTTAGACTATGGCATCTATGTTATCAACCAG
GCTGGAGAGTCCATGTTCAACCGCGCAAAGCTCCTCAATGTTGGCTTTAAAGAGGCCTTG
AAGGACTATGACTACAACTGCTTTGTGTTTAGCGATGTGGACCTCATCCCAATGAACGAC
CATAACACCTACAGGTGCTTTTCACAGCCACGGCACATTTCTGTAGCAATGGATAAGTTT
GGATTTAGCCTACCTTACGTGCAGTATTTTGGAGGTGTCTCTGCTCTAAGTAAACAACAG
TTTCTCAGCATCAATGGATTTCCTAATAACTACTGGGGCTGGGGAGGTGAAGATGATGAC
ATTTATAACAGATTAGCTTTTAGAGGCATGTCTGTGTCTCGCCCAAATGCTGTGATCGGG
AAGTGTCGGATGATCCGCCACTCGAGAGACAAGAAAAATGAACCTAATCCTCAGAGGTTT
GACCGAATTGCACATACAAAGGAGACAATGCTCTCTGATGGTTTGAACTCACTCACCTAC
ATGGTGTTAGAGGTCCAGAGGTACCCGTTGTATACCAAAATCACAGTGGACATCGGGACG
CCGAGCTAG
Enzyme 37 GenBank Gene ID X14558 Link Image
Enzyme 37 GeneCard ID B4GALT1 Link Image
Enzyme 37 GenAtlas ID Not Available
Enzyme 37 HGNC ID Not Available
Enzyme 37 Chromosome Location Chromosome:9
Enzyme 37 Locus 9p13
Enzyme 37 SNPs SNPJam Report Link Image
Enzyme 37 General References
  1. [PubMed Link Image]
Enzyme 37 Metabolite References Not Available
Enzyme 38 [top]
Enzyme 38 ID 615
Enzyme 38 Name Pyruvate carboxylase, mitochondrial
Enzyme 38 Synonyms
  1. Pyruvic carboxylase
  2. PCB
Enzyme 38 Gene Name PC
Enzyme 38 Protein Sequence >Pyruvate carboxylase, mitochondrial
MLKFQTVRGSLRLLAIRRTSTATAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELG
IRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIPDIIKVAKENNVDAVHPGYGF
LSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIE
KPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPAAHLDPQLRTRLTSDSVKLAK
QVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISP
HYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQF
IDENPELFQLRPAQNRAQKLLHYLGHVMVNGPTTPIPVKASPSPTDPIVPVVPIGPPPTG
FRDILLREGPEGFARAVRNHEGLLLMDTTFRDAHQSLLATRVRTHDLKKISPYVAHSFNK
LFSIENWGGATFDVAMRFLYECPWRRLQELRELVPNIPFQMLLRGANAVGYTNYPDNVVF
KFCEVAKENGMDIFRVFDSLNYLPNLLLGMEAAGSAGGVVEAAISYTGDVSDPSRTKYSL
QYYMGLAEELVRAGTHILCIKDMAGLLKPTACTMLVSSLRDRFPDLPLHIHTHDTSGAGV
AAMLACAHAGADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTGVPLERVFDYSEYWEG
ARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQAHSMGLGSKFKEVKKAYVEANQM
LGDLIKVTPSSKIVGDLAQFMVQNGLTRAEAEAQAEELSFPRSVVEFLQGYIGIPHGGFP
EPLRSKVLKDLPRVEGRPGASLPPLDLQALEKELTERHGEEVTPEDVLSAAMYPDVFAHF
KDFTATFGPLDSLNTRLFLQGPKIAEEFEVELERGKTLHIKALAISDLNRAGQRQVFFEL
NGQLRSILVKDTQAMKEMHFHPKALKDVKGQIGAPMPGKVIDIKVAAGAKVTKGQPLCVL
SAMKMETVVTSPVEGTVRKVHVTKDMTLEGDDLILEIE
Enzyme 38 Number of Residues 1178
Enzyme 38 Molecular Weight 129696.5
Enzyme 38 Theoretical pI 6.83
Enzyme 38 GO Classification
Function
Process
Component
Enzyme 38 General Function Involved in ATP binding
Enzyme 38 Specific Function Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate
Enzyme 38 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 38 Reactions Not Available
Enzyme 38 Pfam Domain Function
Enzyme 38 Signals
  • None
Enzyme 38 Transmembrane Regions
  • None
Enzyme 38 Essentiality Not Available
Enzyme 38 GenBank ID Protein 28200301 Link Image
Enzyme 38 UniProtKB/Swiss-Prot ID Q29RK2 Link Image
Enzyme 38 UniProtKB/Swiss-Prot Entry Name PYC_BOVIN Link Image
Enzyme 38 PDB ID Not Available
Enzyme 38 Cellular Location Not Available
Enzyme 38 Gene Sequence >3537 bp
ATGCTGAAGTTTCAGACTGTCCGGGGGAGCCTGAGGCTCCTGGCTATCCGCCGGACCTCC
ACCGCAACCGCTGCCTCTCCCAATGTCCGGCGCCTGGAGTACAAGCCCATCAAGAAGGTC
ATGGTGGCCAACAGAGGCGAGATCGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGC
ATCCGCACGGTGGCTGTCTACTCGGAGCAGGACACGGGCCAAATGCACCGACAGAAAGCT
GACGAAGCCTACCTCATCGGCCGGGGTCTTGCCCCGGTGCAGGCCTATCTGCACATTCCA
GACATCATTAAGGTCGCCAAGGAGAACAACGTGGACGCTGTGCACCCGGGCTACGGGTTC
CTGTCGGAGCGGGCCGACTTTGCCCAGGCCTGCCAGGATGCTGGGGTCCGGTTCATTGGG
CCAAGCCCCGAGGTGGTCCGCAAGATAGGTGACAAGGTGGAGGCCCGGACCATCGCCATC
GCCGCAGATGTGCCCGTGGTGCCCGGCACGAATGCCCCCATCACTTCCCTGCACGAGGCC
CACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCCGCCTACGGGGGCGGG
GGCCGCGGCATGAGGGTCGTGCACAGCTACGAGGAGCTGGAGGAGAACTACACCCGGGCC
TACTCGGAGGCTCTGGCCGCCTTCGGGAACGGGGCGCTGTTCGTGGAGAAGTTCATCGAG
AAGCCACGCCACATCGAGGTGCAGATCCTGGGGGACCAGTACGGGAACATCCTTCACCTC
TACGAGCGGGACTGCTCCATCCAGCGGCGGCACCAGAAAGTGGTGGAGATCGCCCCGGCT
GCCCACTTGGACCCCCAGCTGCGCACCCGGCTCACTAGCGACTCCGTCAAGCTTGCAAAG
CAGGTGGGCTACGAGAACGCGGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCAC
TACTTCATCGAGGTCAACTCGCGCCTGCAGGTGGAGCACACGGTGACCGAGGAGATCACA
GATGTGGACCTGGTCCACGCCCAGATCCACGTGGCCGAGGGCCGGAGCCTGCCTGACCTG
GGCCTCCGGCAGGAGAACATCCGCATCAACGGCTGTGCCATCCAGTGCCGGGTTACCACC
GAGGACCCTGCGCGCAGCTTCCAGCCCGACACCGGCCGCATCGAGGTGTTCCGGAGCGGG
GAGGGCATGGGCATCCGCCTGGACAACGCCTCTGCCTTCCAAGGCGCCGTCATCTCCCCC
CACTACGACTCCCTGCTGGTCAAGGTCATCGCTCACGGCAAGGACCACCCCACGGACGCC
ACCAAGATGAGCAGAGCCCTGGCCGAGTTCCGAGTCCGAGGCGTGAAGACCAACATCCCC
TTCCTGCAGAACGTGCTCAACAACCAGCAGTTCCTGGCAGGCACCGTGGACACGCAGTTC
ATCGACGAGAACCCAGAGCTGTTCCAGCTGCGGCCCGCACAGAACCGGGCCCAGAAGCTG
CTGCACTACCTCGGACACGTCATGGTGAATGGCCCAACTACTCCGATCCCCGTCAAGGCC
AGCCCCAGCCCCACGGACCCCATCGTCCCTGTGGTGCCCATAGGCCCACCCCCAACGGGT
TTCAGAGACATCCTGCTACGGGAGGGGCCCGAGGGCTTTGCTCGAGCGGTGCGGAACCAT
GAGGGGCTGCTGCTGATGGACACGACCTTCAGGGACGCCCACCAGTCACTGCTGGCCACT
CGAGTGCGCACCCACGATCTCAAAAAGATCTCCCCCTATGTTGCCCACAGCTTCAACAAA
CTCTTCAGCATAGAGAACTGGGGAGGAGCCACCTTTGACGTCGCCATGCGCTTCCTGTAC
GAGTGCCCCTGGCGACGGCTGCAGGAGCTCCGGGAGCTCGTCCCCAACATCCCATTCCAG
ATGCTGCTGCGGGGGGCCAACGCCGTGGGCTACACCAACTACCCCGACAATGTGGTCTTC
AAGTTCTGCGAGGTGGCCAAGGAGAATGGCATGGACATCTTCCGGGTCTTTGACTCCCTC
AACTACCTGCCCAACCTGCTGCTGGGCATGGAGGCGGCGGGCAGTGCTGGTGGCGTGGTG
GAGGCCGCCATCTCCTACACGGGTGACGTGTCCGACCCCAGCCGCACCAAGTACTCGCTG
CAGTACTACATGGGCTTGGCCGAGGAGCTGGTGCGAGCCGGCACCCACATCCTGTGCATC
AAGGACATGGCTGGGCTGCTGAAGCCTACGGCCTGCACCATGCTGGTCAGCTCCCTCCGG
GACCGCTTCCCTGACCTCCCGCTGCACATCCACACCCACGACACGTCAGGGGCGGGCGTG
GCAGCCATGCTGGCCTGTGCTCACGCAGGGGCTGACGTGGTGGATGTGGCGGCTGACTCC
ATGTCTGGAATGACATCACAGCCCAGCATGGGGGCCCTGGTGGCCTGTACCCGAGGGACG
CCCCTGGACACAGGCGTGCCCCTGGAGCGTGTGTTCGACTACAGCGAGTACTGGGAGGGG
GCCCGGGGGCTGTACGCGGCCTTTGACTGCACGGCCACCATGAAGTCTGGCAACTCGGAC
GTGTATGAGAACGAGATCCCAGGGGGCCAGTACACCAACCTGCACTTCCAGGCGCACAGC
ATGGGGCTCGGCTCCAAGTTCAAGGAGGTCAAGAAGGCCTACGTGGAGGCCAACCAGATG
CTGGGCGACCTCATCAAGGTGACGCCCTCCTCCAAGATCGTGGGGGACCTGGCCCAGTTC
ATGGTGCAGAACGGGCTGACCCGAGCTGAGGCCGAAGCGCAGGCAGAGGAGCTGTCCTTC
CCCCGCTCGGTGGTGGAGTTCCTGCAGGGCTACATCGGCATCCCCCACGGGGGCTTCCCA
GAGCCCCTTCGCTCCAAGGTGCTGAAAGACCTGCCGAGGGTGGAGGGCCGGCCAGGAGCC
TCCCTCCCACCCCTGGACCTGCAGGCGCTGGAGAAGGAGCTGACGGAACGGCACGGGGAG
GAGGTGACCCCGGAGGACGTGCTCTCAGCCGCCATGTACCCCGACGTCTTTGCCCACTTC
AAGGACTTCACTGCCACCTTCGGCCCCCTGGACAGCCTCAATACGCGCCTCTTCCTGCAG
GGACCCAAGATTGCAGAGGAGTTTGAGGTGGAGCTGGAGCGAGGCAAGACGCTGCACATC
AAAGCCTTGGCCATAAGTGACCTCAACCGGGCGGGCCAGAGGCAGGTCTTCTTCGAGCTC
AACGGACAGCTGCGGTCCATCCTGGTCAAGGACACCCAGGCCATGAAGGAGATGCACTTC
CACCCCAAGGCCCTGAAGGACGTCAAGGGCCAGATTGGGGCACCCATGCCCGGGAAGGTG
ATAGACATCAAGGTGGCAGCAGGGGCCAAGGTGACCAAGGGCCAACCCCTGTGTGTGCTC
AGCGCCATGAAGATGGAGACTGTAGTGACCTCGCCCGTGGAGGGCACTGTCCGCAAGGTC
CACGTGACTAAGGACATGACGCTGGAGGGTGACGACCTCATCCTGGAGATCGAGTGA
Enzyme 38 GenBank Gene ID AY185595 Link Image
Enzyme 38 GeneCard ID PC Link Image
Enzyme 38 GenAtlas ID Not Available
Enzyme 38 HGNC ID Not Available
Enzyme 38 Chromosome Location Chromosome:1
Enzyme 38 Locus 11q13.4-q13.5
Enzyme 38 SNPs SNPJam Report Link Image
Enzyme 38 General References
  1. [PubMed Link Image]
Enzyme 38 Metabolite References Not Available
Enzyme 39 [top]
Enzyme 39 ID 617
Enzyme 39 Name Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
Enzyme 39 Synonyms
  1. PEPCK-C
  2. Phosphoenolpyruvate carboxylase
Enzyme 39 Gene Name PPCK1
Enzyme 39 Protein Sequence >Phosphoenolpyruvate carboxykinase, cytosolic [GTP]
MPPQLSDGLNYSAKIVRGSLDSLPQAVRSFVESSAKLCRPDQVHICDGSEEENRQLLSHM
EEEGVIKRLKKYDNCWLALTDPRDVARIESKTVIITREQRDTVPIPKNGLSQLGRWMSEE
DFEKAFNIRFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVTSMRIMTRMGTSV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPKGQKKYFAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKFDQQGNLRAINPENGFFGVAPGTSVRTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDQPLAARVKLISWKGKEWDPKDGEPCAHPNSRFCTPASQCPIIDPDW
ESPEGVPIEGIIFGGRRPVGVPLVYEALSWQHGVFVGAAMRSEATAAAEYKGKVIMHDPF
AMGPFFGYNFGQYLAHWLSMAQRPAAKLPKIFHVNWFRKDKAGRFLWPGFGENSRVLEWM
FNRVVGEGGASVTPIGYIPDEDALDLRGLGDVDVKELFHISKEFWEEEVEEIQKYLEEQV
NVDLPPEIKNQVLALKQRISQM
Enzyme 39 Number of Residues 622
Enzyme 39 Molecular Weight 69352.2
Enzyme 39 Theoretical pI 6.73
Enzyme 39 GO Classification
Function
Process
Component
Enzyme 39 General Function Energy production and conversion
Enzyme 39 Specific Function Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle
Enzyme 39 Pathways
  • Carbohydrate biosynthesis
  • gluconeogenesis
Enzyme 39 Reactions Not Available
Enzyme 39 Pfam Domain Function
Enzyme 39 Signals
  • None
Enzyme 39 Transmembrane Regions
  • None
Enzyme 39 Essentiality Not Available
Enzyme 39 GenBank ID Protein 24559772 Link Image
Enzyme 39 UniProtKB/Swiss-Prot ID Q8HYZ4 Link Image
Enzyme 39 UniProtKB/Swiss-Prot Entry Name PCKGC_BOVIN Link Image
Enzyme 39 PDB ID Not Available
Enzyme 39 Cellular Location Not Available
Enzyme 39 Gene Sequence >1869 bp
ATGCCTCCTCAGCTCTCAGACGGCCTCAACTACTCAGCCAAAATCGTCCGGGGCTCCCTG
GACAGCCTGCCCCAGGCCGTGAGGAGTTTCGTGGAGAGCAGCGCCAAGCTGTGCCGGCCT
GACCAAGTCCACATCTGCGATGGCTCCGAGGAGGAGAACCGGCAGCTGCTGAGCCACATG
GAGGAGGAGGGTGTGATCAAGAGGCTGAAGAAGTATGACAACTGCTGGTTGGCTCTCACT
GACCCCAGGGATGTGGCCAGAATTGAAAGCAAGACGGTCATCATCACTCGAGAGCAAAGA
GATACGGTGCCCATCCCCAAAAACGGCCTCAGTCAGCTGGGCCGCTGGATGTCCGAGGAG
GATTTTGAAAAAGCATTCAACATCCGATTTCCGGGGTGCATGAAGGGTCGCACCATGTAT
GTCATCCCGTTCAGCATGGGGCCCCTGGGCTCTCCTCTGTCCAAGATTGGCATCGAGCTG
ACAGACTCGCCCTACGTGGTGACCAGCATGCGCATCATGACGAGGATGGGCACCAGCGTC
CTGGAAGCGCTGGGGGACGGCGAGTTCGTCAAGTGCCTCCACTCCGTGGGGTGCCCTTTG
CCTTTAAAAAAGCCTTTGGTTAACAACTGGGCCTGTAACCCCGAGCTCACACTCATCGCC
CACCTGCCCGACCGCCGAGAAATCATCTCCTTTGGGAGTGGGTACGGCGGGAACTCGCTC
CTTGGGAAGAAGTGCTTTGCCCTCAGGATGGCCAGCCGGCTGGCCAAGGAGGAGGGGTGG
CTGGCAGAGCACATGCTGATTCTGGGCATCACCAACCCCAAGGGCCAGAAGAAGTACTTC
GCGGCTGCGTTTCCCAGCGCCTGTGGGAAGACCAACCTGGCCATGATGAACCCTACTCTC
CCGGGATGGAAAGTAGAGTGTGTGGGTGATGATATCGCCTGGATGAAATTTGACCAACAA
GGTAACTTGCGGGCCATCAATCCAGAGAATGGGTTTTTTGGCGTCGCTCCGGGAACCTCT
GTGAGGACAAATCCCAACGCCATCAAGACCATCCAGAAGAATACCATCTTCACCAACGTG
GCCGAGACCAGTGACGGGGGCGTTTACTGGGAAGGCATTGATCAGCCGCTGGCCGCACGA
GTCAAGCTCATTTCCTGGAAGGGCAAGGAGTGGGACCCCAAGGATGGGGAGCCTTGTGCC
CACCCCAACTCACGGTTCTGCACTCCAGCCAGCCAGTGCCCCATCATTGACCCTGACTGG
GAGTCTCCAGAGGGCGTGCCCATTGAGGGCATCATCTTCGGAGGGCGCCGGCCTGTTGGT
GTCCCTCTGGTCTACGAGGCTCTCAGCTGGCAGCACGGTGTGTTTGTGGGGGCGGCCATG
AGATCTGAGGCCACGGCAGCGGCGGAGTACAAGGGCAAAGTCATCATGCACGACCCCTTC
GCCATGGGCCCCTTCTTCGGCTACAACTTCGGCCAGTACCTGGCACACTGGCTCAGCATG
GCCCAGCGCCCCGCAGCCAAGCTGCCCAAGATCTTCCATGTCAACTGGTTCCGAAAGGAC
AAGGCCGGCAGGTTCCTCTGGCCCGGCTTCGGCGAGAACTCCCGGGTGCTGGAGTGGATG
TTCAACCGCGTGGTCGGGGAAGGCGGCGCAAGCGTCACGCCCATCGGCTACATCCCCGAT
GAGGATGCCCTGGACCTCCGGGGCCTGGGGGATGTCGACGTGAAGGAGCTCTTCCACATC
TCCAAGGAGTTCTGGGAGGAGGAGGTGGAGGAAATACAGAAGTACCTTGAGGAGCAAGTG
AACGTCGATCTACCCCCAGAGATCAAGAATCAGGTCCTGGCCCTGAAGCAGAGAATCAGC
CAGATGTAA
Enzyme 39 GenBank Gene ID AY145503 Link Image
Enzyme 39 GeneCard ID PPCK1 Link Image
Enzyme 39 GenAtlas ID Not Available
Enzyme 39 HGNC ID Not Available
Enzyme 39 Chromosome Location Not Available
Enzyme 39 Locus Not Available
Enzyme 39 SNPs SNPJam Report Link Image
Enzyme 39 General References
  1. [PubMed Link Image]
Enzyme 39 Metabolite References Not Available
Enzyme 40 [top]
Enzyme 40 ID 640
Enzyme 40 Name Beta-1,4-galactosyltransferase 3
Enzyme 40 Synonyms
  1. Beta-1,4-GalTase 3
  2. Beta4Gal-T3
  3. b4Gal-T3
  4. UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 3
  5. UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 3
  6. N-acetyllactosamine synthase
  7. Nal synthetase
  8. Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
  9. Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
Enzyme 40 Gene Name B4GALT3
Enzyme 40 Protein Sequence >Beta-1,4-galactosyltransferase 3
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGREQEPAFDYSHPHDVYSNLSH
MPGAPVAPGGLPAPQGLPYCPKRSPLLVGPISVSFSPVPSLAEIVERNPRVEPGGRYRPA
RCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNV
GVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGV
SALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGN
EENPHRFDLLVRTQNSWTQDGMNSLTYQLLSRELGPLYTNITADIGTDPRGPRTSSGPHY
PPGSSQAFRQEMLQRRPPARPGPLPTANHTAPHGSH
Enzyme 40 Number of Residues 396
Enzyme 40 Molecular Weight 44370.2
Enzyme 40 Theoretical pI 9.32
Enzyme 40 GO Classification
Function
Process
Component
Enzyme 40 General Function Involved in beta-N-acetylglucosaminylglycopeptide beta-
Enzyme 40 Specific Function Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids
Enzyme 40 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 40 Reactions Not Available
Enzyme 40 Pfam Domain Function
Enzyme 40 Signals
  • None
Enzyme 40 Transmembrane Regions
  • 11-31
Enzyme 40 Essentiality Not Available
Enzyme 40 GenBank ID Protein 59857729 Link Image
Enzyme 40 UniProtKB/Swiss-Prot ID Q5EA87 Link Image
Enzyme 40 UniProtKB/Swiss-Prot Entry Name B4GT3_BOVIN Link Image
Enzyme 40 PDB ID Not Available
Enzyme 40 Cellular Location Not Available
Enzyme 40 Gene Sequence >1191 bp
ATGTTGCGGAGGTTGCTGGAGCGGCCCTGCACCCTGGCCCTACTTGTGGGCTCCCAGCTG
GCAGTCATGATGTACCTGTCATTGGGGGGCTTTCGAAGCCTCAGTGCCCTCTTTGGCCGA
GAGCAGGAGCCGGCATTTGACTATTCTCATCCCCATGATGTCTACAGTAACCTCAGTCAC
ATGCCTGGGGCCCCTGTTGCCCCAGGGGGCCTCCCAGCTCCTCAAGGCCTGCCATACTGT
CCCGAACGATCTCCTCTCTTAGTGGGTCCCATATCCGTGTCCTTTAGCCCAGTGCCATCG
CTGGCAGAGATTGTGGAGAGGAATCCCCGGGTAGAACCGGGGGGCCGATACCGCCCTGCA
AGGTGTGAGCCCCGGTCCCGGACAGCCATCATTGTGCCCCACCGTGCCCGGGAGCACCAC
CTGCGCCTGCTGCTCTACCACCTGCACCCGTTCCTGCAGCGCCAGCAGCTTGCTTACGGC
ATTTATGTCATCCACCAGGCTGGAAATGGAACATTTAACAGGGCAAAGCTGCTGAATGTC
GGGGTGCGGGAGGCCCTGCGAGATGAAGAATGGGACTGCTTGTTTCTGCATGATGTGGAT
CTCCTGCCAGAGAACGACCACAACCTGTATGTGTGCGATCCCCGAGGACCTCGGCACGTT
GCTGTTGCCATGAACAAATTTGGATACAGCCTCCCGTATCCCCAGTACTTTGGCGGGGTC
TCAGCGCTCACTCCTGACCAGTACCTGAAGATGAATGGCTTCCCCAATGAATACTGGGGC
TGGGGTGGTGAGGATGACGACATTGCTACCAGGGTTCGCTTGGCTGGGATGAAGATATCT
CGTCCCCCCACATCCGTGGGACACTATAAGATGGTGAAGCACCGAGGAGATAAGGGCAAC
GAGGAAAATCCCCACAGGTTTGACCTCCTGGTCCGTACCCAGAATTCCTGGACTCAAGAT
GGAATGAACTCACTGACATACCAGTTGCTGTCTCGAGAGCTGGGCCCTCTCTATACGAAC
ATCACAGCAGACATTGGAACTGACCCTCGGGGTCCCCGGACTTCCTCTGGTCCCCATTAC
CCGCCTGGTTCCTCCCAAGCCTTCCGTCAGGAGATGCTGCAGCGCCGGCCCCCAGCCAGG
CCTGGCCCTCTGCCTACTGCCAACCACACAGCTCCTCATGGTTCACACTGA
Enzyme 40 GenBank Gene ID BT020682 Link Image
Enzyme 40 GeneCard ID B4GALT3 Link Image
Enzyme 40 GenAtlas ID Not Available
Enzyme 40 HGNC ID Not Available
Enzyme 40 Chromosome Location Chromosome:1
Enzyme 40 Locus 1q21-q23
Enzyme 40 SNPs SNPJam Report Link Image
Enzyme 40 General References
  1. [PubMed Link Image]
Enzyme 40 Metabolite References Not Available
Enzyme 41 [top]
Enzyme 41 ID 641
Enzyme 41 Name Xaa-Pro aminopeptidase 1
Enzyme 41 Synonyms
  1. X-Pro aminopeptidase 1
  2. X-prolyl aminopeptidase 1, soluble
  3. Cytosolic aminopeptidase P
  4. Soluble aminopeptidase P
  5. sAmp
  6. Aminoacylproline aminopeptidase
Enzyme 41 Gene Name XPNPEP1
Enzyme 41 Protein Sequence >Xaa-Pro aminopeptidase 1
MAPKITSELLRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSA
GTAIVTEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVD
PLIIPTDYWKKMAKVLRSAGHHLIPVKDNLVDKIWTDRPERPCKPLITLGLDYTGISWKD
KVADLRLKMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAILGLETIMLFIDGD
RIDAPIVKEHLLLDLGLEAEYRIQVLPYKSILSELKILCASLSPREKVWVSDKASYAVSE
AIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEI
SAANKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSG
LDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVV
LVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNSYHLTCRDVIGKEL
QKQGRQEALEWLIRETQPISKQP
Enzyme 41 Number of Residues 623
Enzyme 41 Molecular Weight 69789.2
Enzyme 41 Theoretical pI 5.41
Enzyme 41 GO Classification
Function
Process
Component
Enzyme 41 General Function Amino acid transport and metabolism
Enzyme 41 Specific Function Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide
Enzyme 41 Pathways Not Available
Enzyme 41 Reactions Not Available
Enzyme 41 Pfam Domain Function
Enzyme 41 Signals
  • None
Enzyme 41 Transmembrane Regions
  • None
Enzyme 41 Essentiality Not Available
Enzyme 41 GenBank ID Protein 95767577 Link Image
Enzyme 41 UniProtKB/Swiss-Prot ID Q1JPJ2 Link Image
Enzyme 41 UniProtKB/Swiss-Prot Entry Name XPP1_BOVIN Link Image
Enzyme 41 PDB ID Not Available
Enzyme 41 Cellular Location Not Available
Enzyme 41 Gene Sequence >1872 bp
ATGGCTCCAAAGATAACTTCAGAGCTGCTTCGGCAGCTGAGACAAGCCATGAGGAACTTG
GAGTATGTGACGGAACCAATCCAGGCCTACATCATCCCGTCGGGAGACGCCCATCAGAGT
GAGTACATTGCTCCGTGTGATTGTCGGCGCGCCTTTGTCTCTGGATTTGATGGCTCTGCA
GGCACAGCCATCGTCACAGAAGAACATGCGGCCATGTGGACTGACGGGCGCTACTTTCTC
CAGGCTGCCAAGCAGATGGACAGCAACTGGACACTCATGAAGATGGGTCTGAAGGACACA
CCAACTCAGGAAGACTGGCTGGTGAGTGTACTTCCTGAAGGATCCAGGGTTGGTGTAGAC
CCACTGATCATTCCTACAGATTACTGGAAGAAGATGGCCAAGGTTCTGAGAAGTGCTGGC
CACCACCTCATTCCTGTCAAGGACAACCTAGTGGACAAGATCTGGACAGACCGCCCCGAG
CGTCCCTGCAAACCGCTCATCACACTGGGCCTGGATTACACAGGCATCTCCTGGAAGGAC
AAGGTTGCAGACCTTCGGTTGAAAATGGCTGAGAGGAACGTCGTGTGGTTTGTGGTCACT
GCCCTGGATGAGATTGCGTGGCTATTCAATCTCCGAGGATCAGACGTAGAGCACAATCCT
GTATTTTTCTCCTATGCAATCTTAGGACTAGAGACGATCATGCTCTTCATTGATGGTGAC
CGCATAGACGCCCCCATTGTGAAGGAACACCTACTGCTTGACTTGGGCCTGGAAGCCGAG
TACAGAATCCAGGTGCTTCCGTACAAGTCCATCCTGAGCGAGCTCAAGATCCTGTGTGCC
AGCCTTTCCCCAAGGGAGAAGGTGTGGGTCAGTGACAAGGCCAGCTATGCTGTGAGCGAG
GCCATCCCCAAGGATCATCGCTGCTGTATGCCTTACACCCCCATCTGCATCGCCAAAGCT
GTGAAGAATTCTGCTGAATCAGAAGGCATGAGGCGAGCTCACATTAAAGATGCTGTTGCC
TTGTGTGAACTCTTTAACTGGCTGGAAAAAGAGGTGCCCAAAGGTGGTGTGACAGAGATC
TCAGCTGCCAACAAAGCTGAGGAATTCCGCAGGCAGCAGGCCGACTTTGTGGACCTGAGC
TTCCCAACCATTTCCAGTACGGGACCCAATGGCGCCATCATTCACTACGCGCCGGTCCCT
GAGACGAATAGGACCTTGTCTCTGGATGAGGTGTACCTCATTGACTCGGGTGCTCAATAC
AAGGACGGAACCACAGACGTCACCCGCACCATGCATTTTGGAACTCCTACAGCTTACGAG
AAGGAATGCTTCACATACGTCCTCAAGGGCCACATAGCTGTGAGCGCAGCGGTTTTCCCG
ACTGGAACCAAAGGCCACCTCCTTGACTCCTTTGCCCGCTCAGCGTTATGGGATTCTGGC
CTGGATTACCTGCATGGAACGGGGCATGGTGTTGGGTCTTTTCTGAATGTTCATGAGGGT
CCATGTGGCATCAGTTATAAAACATTCTCTGATGAGCCCTTGGAGGCCGGCATGATCGTC
ACTGATGAGCCAGGGTATTATGAAGATGGGGCTTTTGGAATTCGCATTGAGAATGTTGTC
CTGGTGGTGCCTGTTAAGACCAAGTATAACTTCAACAACCGGGGAAGCCTGACCTTTGAA
CCTCTGACTTTGGTTCCAATACAGACCAAAATGATAGATGTGGATTCTCTAACAGACAAA
GAGTGTGACTGGCTCAACAGCTACCACCTGACCTGCAGGGACGTGATCGGGAAGGAGCTG
CAAAAGCAGGGCCGCCAGGAAGCCCTCGAGTGGCTCATCAGAGAGACGCAGCCCATCTCC
AAACAGCCTTAA
Enzyme 41 GenBank Gene ID BT025361 Link Image
Enzyme 41 GeneCard ID XPNPEP1 Link Image
Enzyme 41 GenAtlas ID Not Available
Enzyme 41 HGNC ID Not Available
Enzyme 41 Chromosome Location Chromosome:1
Enzyme 41 Locus 10q25.3
Enzyme 41 SNPs SNPJam Report Link Image
Enzyme 41 General References
  1. [PubMed Link Image]
Enzyme 41 Metabolite References Not Available
Enzyme 42 [top]
Enzyme 42 ID 642
Enzyme 42 Name Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Enzyme 42 Synonyms
  1. PP2A-alpha
Enzyme 42 Gene Name PPP2CA
Enzyme 42 Protein Sequence >Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
Enzyme 42 Number of Residues 309
Enzyme 42 Molecular Weight 35593.9
Enzyme 42 Theoretical pI 5.22
Enzyme 42 GO Classification
Function
Process
Component
Enzyme 42 General Function Signal transduction mechanisms
Enzyme 42 Specific Function PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase
Enzyme 42 Pathways Not Available
Enzyme 42 Reactions Not Available
Enzyme 42 Pfam Domain Function
Enzyme 42 Signals
  • None
Enzyme 42 Transmembrane Regions
  • None
Enzyme 42 Essentiality Not Available
Enzyme 42 GenBank ID Protein 629 Link Image
Enzyme 42 UniProtKB/Swiss-Prot ID P67774 Link Image
Enzyme 42 UniProtKB/Swiss-Prot Entry Name PP2AA_BOVIN Link Image
Enzyme 42 PDB ID Not Available
Enzyme 42 Cellular Location Not Available
Enzyme 42 Gene Sequence >930 bp
ATGGACGAGAAGGTGTTCACCAAGGAGCTGGACCAGTGGATCGAGCAGCTGAACGAGTGC
AAGCAGCTGTCTGAGTCCCAGGTTAAGAGCCTCTGCGAGAAGGCTAAAGAAATCCTGACA
AAAGAATCCAATGTGCAAGAAGTTCGATGTCCAGTCACTGTCTGTGGAGATGTGCATGGG
CAATTTCATGATCTCATGGAACTGTTTAGAATTGGTGGCAAATCACCAGATACAAATTAC
TTGTTTATGGGCGATTATGTTGACAGAGGATATTATTCAGTGGAAACAGTTACTCTGCTT
GTAGCTCTTAAGGTTCGTTACCGTGAACGTATCACCATTCTTCGAGGAAATCATGAGAGC
AGACAGATCACACAAGTATATGGTTTCTACGATGAGTGTTTAAGGAAATACGGAAATGCA
AATGTTTGGAAGTATTTTACAGACCTTTTTGACTATCTTCCTCTCACTGCCTTGGTGGAT
GGGCAGATCTTCTGTCTACATGGTGGCCTCTCACCATCCATAGATACACTGGATCACATC
AGAGCACTTGATCGCCTACAAGAAGTTCCTCATGAGGGTCCAATGTGTGACTTGCTGTGG
TCAGATCCAGATGACCGTGGAGGTTGGGGTATATCTCCTCGAGGAGCTGGTTACACCTTT
GGGCAGGATATTTCTGAGACATTTAATCATGCCAATGGCCTCACGTTGGTGTCTAGAGCT
CATCAGCTGGTGATGGAGGGATATAACTGGTGCCATGACCGAAATGTAGTAACGATTTTC
AGTGCTCCAAACTATTGTTATCGTTGTGGTAACCAAGCTGCAATCATGGAACTTGATGAT
ACTCTAAAATACTCTTTCTTGCAGTTTGACCCAGCACCTCGCAGAGGCGAGCCACATGTT
ACTCGTCGTACCCCAGACTACTTCCTGTAA
Enzyme 42 GenBank Gene ID X52554 Link Image
Enzyme 42 GeneCard ID PPP2CA Link Image
Enzyme 42 GenAtlas ID Not Available
Enzyme 42 HGNC ID Not Available
Enzyme 42 Chromosome Location Chromosome:5
Enzyme 42 Locus 5q31.1
Enzyme 42 SNPs SNPJam Report Link Image
Enzyme 42 General References
  1. [PubMed Link Image]
Enzyme 42 Metabolite References Not Available
Enzyme 43 [top]
Enzyme 43 ID 643
Enzyme 43 Name Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
Enzyme 43 Synonyms
  1. PP-1A
Enzyme 43 Gene Name PPP1CA
Enzyme 43 Protein Sequence >Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Enzyme 43 Number of Residues 330
Enzyme 43 Molecular Weight 37511.7
Enzyme 43 Theoretical pI 6.25
Enzyme 43 GO Classification
Function
Process
Component
Enzyme 43 General Function Signal transduction mechanisms
Enzyme 43 Specific Function Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II
Enzyme 43 Pathways Not Available
Enzyme 43 Reactions Not Available
Enzyme 43 Pfam Domain Function
Enzyme 43 Signals
  • None
Enzyme 43 Transmembrane Regions
  • None
Enzyme 43 Essentiality Not Available
Enzyme 43 GenBank ID Protein 74267665 Link Image
Enzyme 43 UniProtKB/Swiss-Prot ID Q3T0E7 Link Image
Enzyme 43 UniProtKB/Swiss-Prot Entry Name PP1A_BOVIN Link Image
Enzyme 43 PDB ID 1FJM Link Image
Enzyme 43 PDB File Show
Enzyme 43 3D Structure
Enzyme 43 Cellular Location Not Available
Enzyme 43 Gene Sequence >993 bp
ATGTCCGACAGCGAGAAGCTCAACCTGGACTCTATAATCGGACGCCTGCTGGAAGTGCAG
GGCTCCAGGCCTGGAAAGAATGTACAGCTGACGGAGAACGAGATCCGTGGTCTGTGCCTC
AAATCCCGGGAGATTTTCCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAG
ATCTGCGGTGACATTCATGGCCAGTACTATGATCTTCTGCGGCTGTTCGAGTACGGTGGC
TTCCCTCCAGAGAGTAACTACTTGTTCCTGGGGGACTACGTGGACAGGGGCAAGCAGTCT
TTGGAGACCATCTGCCTGCTGCTGGCCTATAAGATCAAGTACCCAGAGAACTTCTTCCTG
CTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTACGGCTTCTATGATGAGTGC
AAGAGACGCTACAACATCAAACTGTGGAAGACCTTCACTGATTGCTTCAACTGCCTGCCC
ATCGCTGCCATCGTGGACGAGAAGATCTTCTGTTGCCATGGAGGGCTGTCCCCAGACCTA
CAGTCCATGGAGCAGATCCGGCGTATCATGCGGCCCACAGATGTGCCTGACCAGGGCCTG
CTCTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGTGAGAATGAC
CGCGGCGTCTCCTTTACATTTGGAGCTGAGGTGGTGGCCAAGTTCCTGCACAAGCATGAC
CTGGACCTCATCTGCCGGGCACACCAGGTAGTAGAAGACGGCTATGAGTTCTTTGCCAAG
CGGCAGCTGGTGACACTCTTTTCAGCCCCCAACTACTGCGGCGAGTTTGACAATGCAGGT
GCCATGATGAGTGTGGACGAGACGCTCATGTGCTCCTTCCAGATCCTCAAGCCCGCTGAC
AAGAACAAGGGGAAATACGGGCAGTTCAGTGGCCTGAACCCTGGAGGCCGGCCCATCACC
CCACCCCGCAACTCCGCCAAAGCCAAGAAATAG
Enzyme 43 GenBank Gene ID BC102424 Link Image
Enzyme 43 GeneCard ID PPP1CA Link Image
Enzyme 43 GenAtlas ID Not Available
Enzyme 43 HGNC ID Not Available
Enzyme 43 Chromosome Location Chromosome:1
Enzyme 43 Locus 11q13
Enzyme 43 SNPs SNPJam Report Link Image
Enzyme 43 General References Not Available
Enzyme 43 Metabolite References Not Available
Enzyme 44 [top]
Enzyme 44 ID 644
Enzyme 44 Name UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Enzyme 44 Synonyms Not Available
Enzyme 44 Gene Name GALNT6
Enzyme 44 Protein Sequence >UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
MRLLRRRHMAVRLVMVGSAFVLFLFILQRDVSGREQATEKPWLRSLVSQKDHVLDLMLGA
VHNLRDSMPKFQIRAPEPQQTLASTNQSCLPGFYTPAELKPFWERPPQDPNGPGADGKAF
QKKEWTPQETQEKEEGYKKHCFNAFASDRISLQRALGPDTRPPECVDQKFRRCPPLPATS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTDEYLKEPLERYVKQLQVVQV
VRQQERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDETVVVSPNIVT
IDLNTFEFSKPVQRGRIQSRGNFDWSLTFGWEVLPAREKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
INVIARNQVRLAEVWMDGYKEIFYRRNLQAAQMAREKSFGDISERLQLRERLNCHNFSWF
LDNVYPEMFVPDLKPTFFGALKNLGVDHCLDVGENNNGGKPLILYTCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHASAGTLGLRSCHFTGKNSQVPKDEEWEFTQDQLIRNSGSGTCLTS
KDKKPVMATCNPSDPHQHWLFI
Enzyme 44 Number of Residues 622
Enzyme 44 Molecular Weight 71151.9
Enzyme 44 Theoretical pI 8.07
Enzyme 44 GO Classification
Function
Process
Component
Enzyme 44 General Function Cell wall/membrane/envelope biogenesis
Enzyme 44 Specific Function Not Available
Enzyme 44 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 44 Reactions Not Available
Enzyme 44 Pfam Domain Function
Enzyme 44 Signals
  • None
Enzyme 44 Transmembrane Regions
  • None
Enzyme 44 Essentiality Not Available
Enzyme 44 GenBank ID Protein 148878418 Link Image
Enzyme 44 UniProtKB/Swiss-Prot ID A6H6Z5 Link Image
Enzyme 44 UniProtKB/Swiss-Prot Entry Name A6H6Z5_BOVIN Link Image
Enzyme 44 PDB ID Not Available
Enzyme 44 Cellular Location Not Available
Enzyme 44 Gene Sequence >1869 bp
ATGAGGCTGCTCCGCAGACGCCACATGGCCGTGCGCCTGGTCATGGTGGGCAGCGCCTTC
GTGCTCTTTCTCTTCATCCTGCAGAGGGACGTAAGTGGCAGGGAGCAGGCCACAGAGAAG
CCATGGCTGAGGTCCTTGGTGAGCCAGAAGGACCACGTCTTGGACCTCATGCTGGGGGCC
GTGCACAACCTCAGGGACTCGATGCCCAAGTTCCAGATCAGGGCTCCAGAGCCCCAGCAG
ACACTGGCCTCCACCAACCAGTCCTGCCTCCCAGGTTTCTACACCCCAGCTGAGCTGAAG
CCATTCTGGGAACGGCCGCCACAGGACCCCAATGGCCCTGGGGCGGATGGGAAGGCGTTT
CAGAAGAAAGAGTGGACGCCCCAGGAGACCCAGGAAAAGGAAGAGGGCTATAAGAAGCAC
TGCTTCAATGCCTTTGCCAGTGACCGCATCTCCCTGCAGAGGGCCCTGGGGCCGGACACC
CGACCCCCTGAGTGTGTCGACCAGAAGTTCCGGCGCTGCCCCCCGCTGCCTGCCACCAGC
GTCATCATTGTGTTCCACAATGAGGCCTGGTCCACTCTGCTGCGGACGGTGTACAGCGTC
CTGCACACCACCCCTGCCATCCTGCTGAAGGAGATCATTCTGGTAGATGATGCCAGCACG
GACGAGTACTTGAAGGAGCCCCTGGAGCGGTACGTGAAGCAGCTGCAGGTGGTGCAGGTG
GTGCGGCAGCAGGAGAGGAAGGGGCTGATCACCGCCCGGCTGCTGGGGGCCAGCGTGGCC
CAGGCGGAGGTGCTCACCTTCCTGGATGCCCACTGTGAGTGCTTCCACGGCTGGCTAGAG
CCACTCCTGGCTCGCATCGCCGAGGACGAGACGGTGGTGGTGAGCCCAAACATCGTCACC
ATTGACCTGAACACTTTTGAGTTCTCCAAGCCTGTCCAGAGGGGCCGAATCCAGAGTCGG
GGCAACTTTGACTGGAGCCTGACCTTCGGCTGGGAGGTTTTACCGGCACGAGAGAAGCAG
AGGCGCAAGGATGAGACCTACCCCATCAAATCCCCGACGTTTGCTGGTGGCCTCTTCTCC
ATCTCCAAGTCCTACTTTGAGCACATCGGTACCTATGATAACCAGATGGAGATCTGGGGA
GGGGAGAACGTGGAAATGTCCTTCCGGGTGTGGCAGTGCGGCGGCCAGCTAGAGATTATC
CCCTGCTCTGTGGTCGGACACGTGTTCCGTACCAAGAGCCCCCACACCTTCCCCAAGGGC
ATCAATGTCATTGCTCGCAACCAAGTGCGCCTGGCTGAGGTCTGGATGGATGGCTACAAG
GAGATTTTCTACAGGAGAAATCTGCAGGCAGCACAGATGGCCCGAGAGAAATCCTTTGGC
GACATTTCGGAACGACTGCAGCTGAGGGAGCGACTAAACTGTCACAACTTTTCCTGGTTC
CTGGACAACGTTTACCCGGAGATGTTTGTCCCTGACCTGAAGCCCACCTTCTTTGGAGCT
CTCAAGAACCTCGGCGTGGATCACTGTCTGGATGTGGGAGAGAACAACAACGGGGGAAAG
CCCCTCATCCTGTACACCTGCCATGGCCTCGGTGGCAACCAGTACTTTGAGTACACAACC
CAGAGAGACCTTCGCCACAACATCGCAAAGCAGCTGTGTCTACATGCCAGTGCTGGCACT
CTGGGCCTTAGGAGCTGTCACTTCACCGGCAAGAATAGCCAAGTGCCCAAGGATGAGGAA
TGGGAATTCACCCAGGATCAACTCATCAGGAACTCAGGATCTGGTACCTGCCTGACATCC
AAAGACAAAAAGCCGGTCATGGCCACCTGCAACCCCAGTGATCCCCACCAGCACTGGCTC
TTCATTTAG
Enzyme 44 GenBank Gene ID BC146055 Link Image
Enzyme 44 GeneCard ID GALNT6 Link Image
Enzyme 44 GenAtlas ID Not Available
Enzyme 44 HGNC ID Not Available
Enzyme 44 Chromosome Location Chromosome:1
Enzyme 44 Locus 12q13
Enzyme 44 SNPs SNPJam Report Link Image
Enzyme 44 General References Not Available
Enzyme 44 Metabolite References Not Available
Enzyme 45 [top]
Enzyme 45 ID 645
Enzyme 45 Name UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)
Enzyme 45 Synonyms Not Available
Enzyme 45 Gene Name GALNT13
Enzyme 45 Protein Sequence >UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)
MRRFVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEM
GKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTRVYPDELPNTSVV
IVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKII
RMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVI
SDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRN
YFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHV
INKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPD
SQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDL
CLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCS
GTRSQQWLLRNMTLGA
Enzyme 45 Number of Residues 556
Enzyme 45 Molecular Weight 64062.1
Enzyme 45 Theoretical pI 6.82
Enzyme 45 GO Classification
Function
Process
Component
Enzyme 45 General Function Involved in calcium ion binding
Enzyme 45 Specific Function Not Available
Enzyme 45 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 45 Reactions Not Available
Enzyme 45 Pfam Domain Function
Enzyme 45 Signals
  • None
Enzyme 45 Transmembrane Regions
  • None
Enzyme 45 Essentiality Not Available
Enzyme 45 GenBank ID Protein 115304963 Link Image
Enzyme 45 UniProtKB/Swiss-Prot ID Q08DM9 Link Image
Enzyme 45 UniProtKB/Swiss-Prot Entry Name Q08DM9_BOVIN Link Image
Enzyme 45 PDB ID Not Available
Enzyme 45 Cellular Location Not Available
Enzyme 45 Gene Sequence >1671 bp
ATGAGGAGGTTTGTTTACTGCAAGGTGGTTCTAGCCACTTCACTGATGTGGGTTCTCGTT
GATGTCTTCTTACTCCTGTACTTCAGTGAATGTAACAAATGTGATGACAAGAAGGAGAGG
TCCCTGCTACCTGCACTCAGGGCTGTTATTTCAAGAAACCAAGAAGGGCCAGGAGAAATG
GGAAAGGCTGTGCTGATTCCTAAAGATGACCAGGAGAAAATGAAAGAATTGTTTAAAATC
AATCAGTTTAACCTTATGGCCAGTGATTTGATTGCCCTTAACAGAAGTCTGCCGGATGTA
AGATTAGAAGGATGCAAGACAAGGGTCTACCCTGATGAACTCCCAAACACAAGTGTAGTC
ATTGTATTTCATAACGAAGCTTGGAGCACTCTCCTCAGAACTGTTTACAGTGTTATAAAT
CGGTCCCCACACTATCTACTCTCTGAGGTCATCTTGGTAGATGATGCCAGTGAAAGAGAT
TTTCTCAAGTTAACATTAGAGAATTATGTGAAAAATTTAGAAGTGCCAGTAAAAATTATT
AGAATGGAAGAGCGCTCTGGGTTAATACGAGCCCGCCTTCGAGGAGCAGCTGCTTCAAAA
GGACAAGTCATAACTTTCCTGGATGCACACTGCGAATGCACATTAGGATGGCTGGAGCCC
TTGCTGGCAAGAATAAAGGAGGACAGGAAGACAGTTGTATGCCCCATCATTGATGTGATT
AGTGATGACACCTTTGAATACATGGCTGGGTCAGACATGACTTATGGGGGTTTTAACTGG
AAACTGAATTTCCGTTGGTATCCTGTTCCCCAGAGAGAAATGGATAGAAGGAAAGGAGAC
AGAACTTTACCTGTCAGGACCCCAACTATGGCTGGTGGCCTATTTTCTATTGACAGAAAC
TACTTTGAAGAGATAGGAACTTACGATGCAGGAATGGATATCTGGGGTGGAGAGAATCTT
GAAATGTCTTTTAGGATTTGGCAGTGTGGAGGCTCATTGGAGATTGTGACTTGTTCCCAC
GTTGGTCACGTTTTTCGGAAGGCAACTCCCTACACATTCCCTGGTGGCACTGGTCATGTC
ATCAACAAGAACAACAGGAGACTGGCAGAAGTTTGGATGGATGAATTTAAAGATTTCTTC
TATATCATATCCCCAGGTGTTGTCAAAGTGGATTACGGAGATGTGTCAGTCAGAAAAACA
CTAAGAGAAAATCTGAAGTGTAAGCCCTTTTCTTGGTACCTTGAAAACATCTATCCGGAC
TCCCAGATCCCAAGACGTTATTACTCACTTGGAGAGATAAGAAATGTTGAAACAAATCAA
TGTTTAGACAACATGGGCCGCAAGGAAAATGAAAAAGTGGGTATATTCAACTGTCATGGT
ATGGGAGGAAATCAGGTATTTTCTTATACTGCTGACAAAGAAATCCGAACCGATGACTTG
TGCTTAGATGTTTCTAGACTCAATGGACCTGTAATCATGTTAAAATGCCACCATATGAGA
GGAAATCAGTTATGGGAGTATGATGCTGAGAGACTCACCTTGAGACATGTTAACAGTAAT
CAATGTCTAGATGAACCTTCTGAAGAAGACAAAATGGTGCCTACCATGCAGGACTGTAGT
GGAACCAGATCTCAACAATGGCTGCTAAGGAACATGACTCTGGGGGCCTGA
Enzyme 45 GenBank Gene ID BC123662 Link Image
Enzyme 45 GeneCard ID GALNT13 Link Image
Enzyme 45 GenAtlas ID Not Available
Enzyme 45 HGNC ID Not Available
Enzyme 45 Chromosome Location Chromosome:2
Enzyme 45 Locus 2q23.3-q24.1
Enzyme 45 SNPs SNPJam Report Link Image
Enzyme 45 General References Not Available
Enzyme 45 Metabolite References Not Available
Enzyme 46 [top]
Enzyme 46 ID 646
Enzyme 46 Name Serine/threonine-protein phosphatase PP1-beta catalytic subunit
Enzyme 46 Synonyms
  1. PP-1B
Enzyme 46 Gene Name PPP1CB
Enzyme 46 Protein Sequence >Serine/threonine-protein phosphatase PP1-beta catalytic subunit
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
Enzyme 46 Number of Residues 327
Enzyme 46 Molecular Weight 37186.5
Enzyme 46 Theoretical pI 6.06
Enzyme 46 GO Classification
Function
Process
Component
Enzyme 46 General Function Signal transduction mechanisms
Enzyme 46 Specific Function Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity
Enzyme 46 Pathways Not Available
Enzyme 46 Reactions Not Available
Enzyme 46 Pfam Domain Function
Enzyme 46 Signals
  • None
Enzyme 46 Transmembrane Regions
  • None
Enzyme 46 Essentiality Not Available
Enzyme 46 GenBank ID Protein 74356397 Link Image
Enzyme 46 UniProtKB/Swiss-Prot ID Q3SWW9 Link Image
Enzyme 46 UniProtKB/Swiss-Prot Entry Name PP1B_BOVIN Link Image
Enzyme 46 PDB ID 1S70 Link Image
Enzyme 46 PDB File Show
Enzyme 46 3D Structure
Enzyme 46 Cellular Location Not Available
Enzyme 46 Gene Sequence >984 bp
ATGGCGGACGGAGAGCTGAACGTGGACAGTCTTATTACCCGACTGCTGGAGGTACGAGGA
TGTCGTCCAGGAAAGATTGTACAGATGACTGAAGCAGAAGTTCGGGGCTTATGTATCAAG
TCTCGGGAGATCTTTCTCAGCCAGCCTATTCTTTTGGAATTGGAAGCACCACTGAAAATC
TGTGGAGATATTCATGGACAGTATACAGATTTACTGCGATTATTTGAATATGGGGGTTTC
CCCCCAGAAGCCAACTATCTTTTCTTAGGAGATTATGTGGACAGAGGAAAGCAGTCTTTG
GAAACAATCTGCTTGCTATTGGCTTATAAAATCAAATACCCAGAAAACTTCTTTCTCTTA
AGAGGAAACCATGAGTGTGCTAGCATCAATCGCATTTATGGATTCTATGATGAATGCAAA
CGAAGATTTAATATTAAGTTGTGGAAGACCTTCACTGATTGTTTCAACTGTCTGCCTATA
GCTGCCATTGTGGATGAGAAGATCTTCTGTTGTCATGGAGGACTGTCACCAGACCTGCAA
TCTATGGAGCAGATACGGAGAATTATGAGACCCACTGATGTCCCTGATACAGGTTTGCTC
TGTGATTTGCTGTGGTCTGACCCAGATAAGGATGTGCAAGGGTGGGGAGAAAATGATCGT
GGTGTTTCCTTCACTTTTGGAGCTGATGTAGTCAGTAAATTTCTGAATCGTCATGATTTA
GACTTGATTTGTCGAGCTCATCAGGTTGTGGAAGATGGATATGAATTCTTTGCTAAGCGA
CAACTGGTAACCCTGTTTTCAGCCCCAAATTACTGTGGCGAGTTTGATAATGCTGGTGGA
ATGATGAGTGTGGATGAAACTTTGATGTGTTCATTTCAGATTTTGAAACCATCTGAAAAG
AAAGCTAAGTACCAATATGGTGGACTGAATTCAGGACGTCCTGTCACTCCACCTCGAACA
GCTAATCCACCGAAGAAAAGGTGA
Enzyme 46 GenBank Gene ID BC104628 Link Image
Enzyme 46 GeneCard ID PPP1CB Link Image
Enzyme 46 GenAtlas ID Not Available
Enzyme 46 HGNC ID Not Available
Enzyme 46 Chromosome Location Chromosome:2
Enzyme 46 Locus 2p23
Enzyme 46 SNPs SNPJam Report Link Image
Enzyme 46 General References Not Available
Enzyme 46 Metabolite References Not Available
Enzyme 47 [top]
Enzyme 47 ID 647
Enzyme 47 Name Serine/threonine-protein phosphatase 4 catalytic subunit
Enzyme 47 Synonyms
  1. PP4C
  2. Pp4
Enzyme 47 Gene Name PPP4C
Enzyme 47 Protein Sequence >Serine/threonine-protein phosphatase 4 catalytic subunit
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
Enzyme 47 Number of Residues 307
Enzyme 47 Molecular Weight 35079.6
Enzyme 47 Theoretical pI 4.68
Enzyme 47 GO Classification
Function
Process
Component
Enzyme 47 General Function Signal transduction mechanisms
Enzyme 47 Specific Function Protein phosphatase that regulates many processes such as microtubule organization or maturation of spliceosomal snRNPs
Enzyme 47 Pathways Not Available
Enzyme 47 Reactions Not Available
Enzyme 47 Pfam Domain Function
Enzyme 47 Signals
  • None
Enzyme 47 Transmembrane Regions
  • None
Enzyme 47 Essentiality Not Available
Enzyme 47 GenBank ID Protein 148877418 Link Image
Enzyme 47 UniProtKB/Swiss-Prot ID A6H772 Link Image
Enzyme 47 UniProtKB/Swiss-Prot Entry Name PP4C_BOVIN Link Image
Enzyme 47 PDB ID Not Available
Enzyme 47 Cellular Location Not Available
Enzyme 47 Gene Sequence >924 bp
ATGGCGGAGATCAGCGACCTGGACCGGCAGATCGAGCAGCTACGGCGCTGCGAGCTCATC
AAGGAGAGTGAAGTCAAAGCCCTGTGCGCTAAAGCCAGAGAGATCTTGGTGGAGGAAAGC
AACGTGCAGAGGGTGGACTCCCCAGTCACAGTGTGTGGTGACATCCATGGACAATTCTAT
GACCTCAAGGAGCTGTTCAGAGTGGGTGGCGATGTCCCTGAGACTAACTACCTCTTCATG
GGGGACTTTGTGGATCGTGGTTTCTACAGCGTCGAAACGTTTCTCCTGCTGCTGGCACTT
AAGGTTCGCTATCCTGACCGCATCACCCTGATCCGGGGCAACCATGAGAGCCGTCAGATC
ACCCAGGTCTACGGCTTCTATGACGAGTGTCTGCGCAAGTACGGCTCGGTGACCGTGTGG
CGCTACTGCACTGAGATCTTTGACTACCTCAGCCTGTCGGCCATCATCGATGGCAAGATC
TTCTGTGTGCATGGGGGGCTCTCCCCCTCCATCCAGACGCTGGACCAGATCCGGACAATT
GACCGAAAGCAAGAGGTGCCCCACGACGGGCCCATGTGTGACCTGCTCTGGTCCGACCCT
GAAGACACAACAGGCTGGGGCGTGAGCCCCCGTGGGGCCGGCTACCTGTTTGGCAGTGAC
GTGGTGGCCCAGTTCAACGCAGCCAACGACATTGACATGATCTGCCGTGCCCACCAACTG
GTGATGGAAGGTTACAAGTGGCACTTCAACGAGACTGTACTCACTGTGTGGTCGGCACCC
AACTACTGCTACCGCTGTGGGAATGTGGCAGCCATCTTGGAGCTGGATGAGCATCTCCAG
AAAGACTTCATCATCTTCGAGGCCGCTCCCCAAGAGACACGGGGCATCCCCTCCAAAAAG
CCCGTGGCCGACTACTTCCTGTGA
Enzyme 47 GenBank Gene ID BC146137 Link Image
Enzyme 47 GeneCard ID PPP4C Link Image
Enzyme 47 GenAtlas ID Not Available
Enzyme 47 HGNC ID Not Available
Enzyme 47 Chromosome Location Chromosome:1
Enzyme 47 Locus 16p12-p11
Enzyme 47 SNPs SNPJam Report Link Image
Enzyme 47 General References Not Available
Enzyme 47 Metabolite References Not Available
Enzyme 48 [top]
Enzyme 48 ID 648
Enzyme 48 Name Oligoribonuclease, mitochondrial
Enzyme 48 Synonyms
  1. Small fragment nuclease
  2. RNA exonuclease 2 homolog
Enzyme 48 Gene Name REXO2
Enzyme 48 Protein Sequence >Oligoribonuclease, mitochondrial
MLGGSLGSRLLRGVGGTRGQFRARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTMTLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY
PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGENEKTVS
Enzyme 48 Number of Residues 237
Enzyme 48 Molecular Weight 26884.6
Enzyme 48 Theoretical pI 7.55
Enzyme 48 GO Classification
Function
Process
Component
Enzyme 48 General Function RNA processing and modification
Enzyme 48 Specific Function 3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily
Enzyme 48 Pathways Not Available
Enzyme 48 Reactions Not Available
Enzyme 48 Pfam Domain Function
Enzyme 48 Signals
  • None
Enzyme 48 Transmembrane Regions
  • None
Enzyme 48 Essentiality Not Available
Enzyme 48 GenBank ID Protein 126010762 Link Image
Enzyme 48 UniProtKB/Swiss-Prot ID A2VE52 Link Image
Enzyme 48 UniProtKB/Swiss-Prot Entry Name ORN_BOVIN Link Image
Enzyme 48 PDB ID Not Available
Enzyme 48 Cellular Location Not Available
Enzyme 48 Gene Sequence >714 bp
ATGCTAGGCGGCTCCCTGGGCTCCAGGCTGTTGCGAGGTGTGGGTGGGACTCGCGGGCAG
TTCAGGGCTCGGGGTGTCCGCGAAGGTGGCGCAGCCATGGCGGCGGGGGAGAGCATGGCT
CAGCGGATGGTCTGGGTGGACCTGGAGATGACAGGATTGGACATTGAGAAGGACCAGATT
ATTGAGATGGCCTGTCTGATAACTGACTCTGATCTCAACATTTTGGCTGAAGGTCCTAAC
CTGATTATAAAACAGCCAGATGAGTTACTGGACAGCATGTCAGACTGGTGCAAGGAGCAT
CATGGGAAGTCTGGTCTAACCAAAGCAGTGAAGGAGAGTACGATGACACTGCAGCAGGCA
GAGTATGAATTTCTCTCCTTTGTACGACAGCAGACTCCTCCAGGGCTCTGTCCACTTGCA
GGAAATTCAGTTCACGCAGATAAGAAGTTTCTTGACAAATACATGCCCCAGTTCATGAAA
CATCTTCATTATAGAATAATTGATGTGAGCACTGTTAAAGAGCTGTGCAGACGCTGGTAT
CCCGAAGAATACGAATTTGCACCAAAGAAGGCTGCTTCTCACAGGGCACTTGATGACATT
AGCGAAAGCATCAAAGAACTTCAGTTTTACCGAAATAACATCTTCAAGAAAAAAACAGAT
GAGAAGAAGAGGAAAATTATAGAAAATGGGGAAAATGAGAAGACTGTGAGTTGA
Enzyme 48 GenBank Gene ID BC133575 Link Image
Enzyme 48 GeneCard ID REXO2 Link Image
Enzyme 48 GenAtlas ID Not Available
Enzyme 48 HGNC ID Not Available
Enzyme 48 Chromosome Location Chromosome:1
Enzyme 48 Locus 11q23.1-q23.2
Enzyme 48 SNPs SNPJam Report Link Image
Enzyme 48 General References Not Available
Enzyme 48 Metabolite References Not Available
Enzyme 49 [top]
Enzyme 49 ID 649
Enzyme 49 Name Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
Enzyme 49 Synonyms
  1. PP-1G
  2. Protein phosphatase 1C catalytic subunit
Enzyme 49 Gene Name PPP1CC
Enzyme 49 Protein Sequence >Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
Enzyme 49 Number of Residues 323
Enzyme 49 Molecular Weight 36983.4
Enzyme 49 Theoretical pI 6.50
Enzyme 49 GO Classification
Function
Process
Component
Enzyme 49 General Function Signal transduction mechanisms
Enzyme 49 Specific Function Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II
Enzyme 49 Pathways Not Available
Enzyme 49 Reactions Not Available
Enzyme 49 Pfam Domain Function
Enzyme 49 Signals
  • None
Enzyme 49 Transmembrane Regions
  • None
Enzyme 49 Essentiality Not Available
Enzyme 49 GenBank ID Protein 18477497 Link Image
Enzyme 49 UniProtKB/Swiss-Prot ID P61287 Link Image
Enzyme 49 UniProtKB/Swiss-Prot Entry Name PP1G_BOVIN Link Image
Enzyme 49 PDB ID 1IT6 Link Image
Enzyme 49 PDB File Show
Enzyme 49 3D Structure
Enzyme 49 Cellular Location Not Available
Enzyme 49 Gene Sequence Not Available
Enzyme 49 GenBank Gene ID AJ429235 Link Image
Enzyme 49 GeneCard ID PPP1CC Link Image
Enzyme 49 GenAtlas ID Not Available
Enzyme 49 HGNC ID Not Available
Enzyme 49 Chromosome Location Chromosome:1
Enzyme 49 Locus 12q24.1-q24.2
Enzyme 49 SNPs SNPJam Report Link Image
Enzyme 49 General References
  1. [PubMed Link Image]
Enzyme 49 Metabolite References Not Available
Enzyme 50 [top]
Enzyme 50 ID 650
Enzyme 50 Name Cytosolic non-specific dipeptidase
Enzyme 50 Synonyms
  1. CNDP dipeptidase 2
Enzyme 50 Gene Name CNDP2
Enzyme 50 Protein Sequence >Cytosolic non-specific dipeptidase
MSALTTLFKYVDENQDRYVKKLAEWVAIQSVSAWPEKRGEIRRMMEVAAADIKQLGGSVQ
LVDIGTQKLPDGSEIPLPPILLGKLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVE
RDGKLFGRGATDDKGPVAGWINALEAFQKTKQEVPVNVRFCLEGMEESGSEGLDALIFAQ
KDAFFKDVDYVCISDNYWLGKNKPCITYGLRGICYFFIEVECSDKDLHSGVYGGSVHEAM
TDLIMLMGCLMDKKGKILIPGISEAVAPVTEEELELYDKIDFDLEEYARDVGAGTLLHGC
KKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTPEVVSEQVTSY
LTKKFAELHSPNKFKVYMGHGGKPWVSDFNHPHYLAGRRALKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRRNYIEGTKMLAAYLYEVSQLKD
Enzyme 50 Number of Residues 475
Enzyme 50 Molecular Weight 52655.0
Enzyme 50 Theoretical pI 5.67
Enzyme 50 GO Classification
Function
Process
Component
Enzyme 50 General Function Amino acid transport and metabolism
Enzyme 50 Specific Function Not Available
Enzyme 50 Pathways Not Available
Enzyme 50 Reactions Not Available
Enzyme 50 Pfam Domain Function
Enzyme 50 Signals
  • None
Enzyme 50 Transmembrane Regions
  • None
Enzyme 50 Essentiality Not Available
Enzyme 50 GenBank ID Protein 73586898 Link Image
Enzyme 50 UniProtKB/Swiss-Prot ID Q3ZC84 Link Image
Enzyme 50 UniProtKB/Swiss-Prot Entry Name CNDP2_BOVIN Link Image
Enzyme 50 PDB ID Not Available
Enzyme 50 Cellular Location Not Available
Enzyme 50 Gene Sequence >1428 bp
ATGTCGGCCCTCACCACCCTGTTTAAGTACGTGGACGAAAATCAGGATCGATATGTTAAG
AAGCTTGCGGAATGGGTGGCCATCCAGAGCGTGTCAGCGTGGCCAGAGAAGAGAGGCGAG
ATCCGCAGGATGATGGAGGTGGCGGCCGCCGACATCAAGCAGCTGGGCGGCTCTGTGCAG
CTGGTGGACATCGGGACCCAGAAGCTCCCTGATGGCTCCGAGATCCCACTTCCGCCCATT
TTACTCGGCAAGCTGGGCTCTGACCCACAGAAGAAGACGGTGTGCATCTACGGCCACCTG
GACGTGCAGCCGGCGGCCCTGGAGGACGGCTGGGACAGCGAGCCCTTCACCCTGGTGGAG
CGAGACGGCAAACTGTTTGGGAGAGGAGCCACCGACGACAAGGGGCCGGTGGCCGGCTGG
ATCAATGCCCTGGAAGCCTTCCAGAAAACCAAGCAGGAAGTCCCGGTCAACGTCCGCTTC
TGCCTGGAGGGCATGGAGGAGTCGGGCTCCGAGGGCCTGGACGCGCTGATCTTCGCGCAG
AAAGACGCATTCTTCAAGGATGTGGACTACGTGTGCATCTCCGACAACTACTGGCTGGGC
AAGAACAAGCCCTGCATCACCTACGGGCTGCGGGGCATCTGCTACTTCTTCATCGAGGTG
GAATGCAGCGACAAGGACCTGCACTCGGGCGTGTACGGCGGCTCGGTGCACGAGGCCATG
ACCGACCTCATCATGCTGATGGGCTGCCTGATGGACAAGAAGGGGAAGATCCTCATCCCG
GGCATCAGTGAGGCCGTGGCCCCCGTGACCGAGGAGGAGCTGGAGCTCTACGACAAGATC
GATTTTGACCTGGAGGAGTACGCCCGGGACGTGGGCGCTGGGACCCTCCTGCATGGCTGC
AAGAAGGACATCCTGATGCACAGATGGCGTTACCCATCCCTGTCTCTTCATGGCATCGAA
GGTGCCTTCTCCGGGTCAGGGGCCAAGACCGTGATTCCACGAAAGGTGGTCGGCAAGTTC
TCCATCCGACTCGTCCCGAACATGACTCCGGAAGTGGTCAGCGAGCAGGTTACAAGCTAC
TTGACCAAGAAGTTTGCTGAGCTTCACAGTCCCAACAAGTTCAAGGTGTACATGGGCCAC
GGCGGGAAGCCCTGGGTGTCCGACTTCAACCACCCTCACTACCTGGCTGGGAGGAGGGCC
CTGAAGACAGTGTTTGGTGTCGAGCCGGACTTGACCAGGGAAGGCGGCAGCATCCCAGTG
ACACTGACGTTCCAGGAGGCCACAGGCAAGAACGTCATGCTGCTGCCCGTGGGCTCGGCG
GACGACGGAGCGCACTCCCAGAACGAGAAGCTCAACCGGCGCAACTACATTGAGGGGACC
AAGATGCTGGCCGCGTACCTGTACGAAGTCTCCCAGCTGAAGGACTGA
Enzyme 50 GenBank Gene ID BC102835 Link Image
Enzyme 50 GeneCard ID CNDP2 Link Image
Enzyme 50 GenAtlas ID Not Available
Enzyme 50 HGNC ID Not Available
Enzyme 50 Chromosome Location Chromosome:1
Enzyme 50 Locus 18q22.3
Enzyme 50 SNPs SNPJam Report Link Image
Enzyme 50 General References Not Available
Enzyme 50 Metabolite References Not Available
Enzyme 51 [top]
Enzyme 51 ID 651
Enzyme 51 Name Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
Enzyme 51 Synonyms
  1. POMGnT1
Enzyme 51 Gene Name POMGNT1
Enzyme 51 Protein Sequence >Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
MDDWKPSPLIKPFGARKKRSWYLTWKYKLTNQRALRRFCQTGAVLFLLVTVIVNIKLILD
TRRAISEASEDLEPEQDYDEALGRLEPPRRIGSGPRRVLDVEVYSSRSKVYVAVDGTTVL
EDEAQEQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDE
GSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLL
KTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVL
NVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTP
ISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLY
CISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMR
MPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRNVDSLKKDA
YEVEVHRLLSEAEVLDHSKNPCEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLRIW
DLDVRGNHRGLWRLFRKKNHFLVVGVPASPYSMKKPPSITPIFLESPPKEEGGPGAAEQT
Enzyme 51 Number of Residues 660
Enzyme 51 Molecular Weight 75076.1
Enzyme 51 Theoretical pI 6.70
Enzyme 51 GO Classification
Function
Process
Component
Enzyme 51 General Function Involved in alpha-1,3-mannosylglycoprotein 2-beta-N-ace
Enzyme 51 Specific Function Participates in O-mannosyl glycosylation. May be responsible for the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O- Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins. Is specific for alpha linked terminal mannose
Enzyme 51 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 51 Reactions Not Available
Enzyme 51 Pfam Domain Function
Enzyme 51 Signals
  • None
Enzyme 51 Transmembrane Regions
  • 38-58
Enzyme 51 Essentiality Not Available
Enzyme 51 GenBank ID Protein 59857671 Link Image
Enzyme 51 UniProtKB/Swiss-Prot ID Q5EAB6 Link Image
Enzyme 51 UniProtKB/Swiss-Prot Entry Name PMGT1_BOVIN Link Image
Enzyme 51 PDB ID Not Available
Enzyme 51 Cellular Location Not Available
Enzyme 51 Gene Sequence >1983 bp
ATGGACGACTGGAAGCCCAGCCCCCTCATCAAGCCCTTTGGGGCGCGAAAAAAGCGGAGC
TGGTATCTTACCTGGAAGTATAAACTGACCAACCAGCGGGCCCTGCGGAGGTTCTGTCAG
ACAGGAGCCGTGCTTTTCCTACTGGTGACCGTCATTGTCAACATCAAGTTGATCCTGGAC
ACACGACGAGCTATCAGCGAGGCCAGTGAAGACCTGGAGCCAGAACAAGACTATGATGAG
GCCCTGGGCCGATTGGAGCCTCCACGGCGCATAGGCAGTGGTCCCCGACGTGTCCTGGAT
GTGGAGGTATACTCAAGCCGCAGCAAAGTGTATGTGGCAGTGGACGGCACCACGGTGCTG
GAGGATGAGGCCCAGGAGCAGGGCCGGGGCATCCACGTCATCGTCCTCAACCAGGCCACG
GGCCATGTGATGGCAAAGCGAGTGTTTGACACCTATTCACCTCATGAGGATGAGGCCATG
GTGCTGTTCCTCAACATGGTGGCACCTGGCCGAGTGCTCATCTGCACCGTCAAGGACGAG
GGCTCCTTCCACCTCAAGGACACCGCCAAGGCTCTGCTGAGGAGCCTAGGCAGCCAGGCT
GGCCCTGCCCTGGGCTGGAGAGACACCTGGGCCTTCGTGGGACGAAAAGGAGGTCCTGTG
CTCGGGGAGAAACATTCTAAGTCACCTGCCCTCTCCTCCTGGGGGGATCCAGTTCTGCTG
AAGACAGATGTGCCGCTGAGCTCAGCTGAAGAGGCAGAGTGCCACTGGGCAGACACAGAG
CTGAACCGTCGCCGCCGCCGCTTCTGCAGCAAAGTTGAGGGCTATGGGAGCGTGTGCAGC
TGCAAGGACCCCACACCCATCGAGTTCAGCCCTGACCCACTCCCAGACAACAAGGTCCTC
AATGTGCCTGTGGCTGTCATTGCAGGGAACCGGCCCAATTACCTGTACAGGATGCTGCGC
TCTCTACTCTCAGCCCAGGGGGTGTCTCCCCAGATGATAACAGTTTTCATCGATGGCTAC
TATGAGGAGCCGATGGATGTGGTGGCGCTGTTTGGTCTGAGGGGCATCCAGCACACTCCC
ATCAGCATCAAGAACGCCCGTGTGTCTCAGCACTACAAGGCCAGCCTCACTGCCACTTTC
AACCTGTTTCCGGAAGCCAAGTTTGCTGTGGTTCTGGAAGAGGACCTGGACATTGCTGTG
GATTTTTTCAGTTTCCTGAGCCAATCCATCCACCTGCTGGAGGAGGACGACAGCTTGTAC
TGTATCTCTGCCTGGAATGACCAGGGCTATGAGCACACGGCAGAGGACCCAGCACTGCTA
TACCGTGTGGAGACCATGCCTGGGCTGGGCTGGGTGCTCAGGAAGTCCTTGTACAAGGAG
GAGCTTGAACCCAAGTGGCCCACACCAGAAAAGCTCTGGGACTGGGACATGTGGATGCGG
ATGCCGGAACAACGCCGAGGCCGAGAATGCATTATCCCTGACGTGTCCCGATCCTACCAC
TTCGGCATCGTTGGCCTCAACATGAATGGCTACTTCCATGAGGCCTACTTCAAGAAGCAC
AAGTTCAACACGGTTCCAGGTGTCCAGCTCAGGAACGTGGACAGTCTGAAGAAGGATGCT
TATGAAGTGGAAGTTCACAGGCTGCTCAGCGAAGCAGAGGTTCTGGACCACAGCAAGAAC
CCTTGTGAAGACTCTTTCCTGCCAGACACAGAGGGCCACACCTACGTGGCCTTTATCCGG
ATGGAGAAGGACGATGACTTCACCACCTGGACTCAGCTTGCCAAGTGCCTCCGAATCTGG
GACCTGGATGTGCGTGGCAACCACCGGGGCCTGTGGAGACTGTTTCGGAAGAAGAACCAC
TTCCTGGTGGTGGGGGTCCCAGCCTCCCCGTACTCGATGAAGAAGCCACCATCAATCACC
CCAATTTTCTTGGAGTCACCCCCAAAGGAGGAGGGAGGCCCAGGAGCTGCAGAACAGACA
TGA
Enzyme 51 GenBank Gene ID BT020653 Link Image
Enzyme 51 GeneCard ID POMGNT1 Link Image
Enzyme 51 GenAtlas ID Not Available
Enzyme 51 HGNC ID Not Available
Enzyme 51 Chromosome Location Chromosome:1
Enzyme 51 Locus 1p34.1
Enzyme 51 SNPs SNPJam Report Link Image
Enzyme 51 General References
  1. [PubMed Link Image]
Enzyme 51 Metabolite References Not Available
Enzyme 52 [top]
Enzyme 52 ID 652
Enzyme 52 Name Protein prune homolog
Enzyme 52 Synonyms Not Available
Enzyme 52 Gene Name PRUNE
Enzyme 52 Protein Sequence >Protein prune homolog
MENYLQGCRAALQESRPIHVVLGNEACDLDSMVSALALAFYLAKTTEAEEVFVPVLNIKR
SELPLRGDNVFFLQKIHIPESVLIFRDEIDLHALHQAGQLTLILVDHHVLPKSDAALEEA
VAEVLDHRPIDQRHCPPCHVSVELVGSCATLVAERILQGAPEILDRQTAALLHGTILLDC
VNMDLKIGKATLKDSHYVEKLEALFPDLPSRNDIFDSLQKAKFDVSGLTTEQMLRKDQKT
ISRQGTKVAISAIYMDMEAFLQRSGLLADLRAFCQAHSYDALVAMTIFFNTYNEPVRQLA
VFCPHAALRMTICGILEHSHSPPLKLTPVPSSHPDLQAYLQGNTQISRKKVLPLLQEALS
AYFDSTNIPLGQPETEGVSREQVDKELDRAGNSLLSGLSQDEEEPPLPPTPMNSLVDECP
LDQGLPKFSAEVIFEKCSQISLSEPTTASLSKK
Enzyme 52 Number of Residues 453
Enzyme 52 Molecular Weight 50079.9
Enzyme 52 Theoretical pI 5.02
Enzyme 52 GO Classification
Function
Process
Component
Enzyme 52 General Function Energy production and conversion
Enzyme 52 Specific Function Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1
Enzyme 52 Pathways Not Available
Enzyme 52 Reactions Not Available
Enzyme 52 Pfam Domain Function
Enzyme 52 Signals
  • None
Enzyme 52 Transmembrane Regions
  • None
Enzyme 52 Essentiality Not Available
Enzyme 52 GenBank ID Protein 59857931 Link Image
Enzyme 52 UniProtKB/Swiss-Prot ID Q5E9Y6 Link Image
Enzyme 52 UniProtKB/Swiss-Prot Entry Name PRUNE_BOVIN Link Image
Enzyme 52 PDB ID Not Available
Enzyme 52 Cellular Location Not Available
Enzyme 52 Gene Sequence >1362 bp
ATGGAGAACTACCTGCAGGGTTGTCGAGCTGCTCTGCAGGAGTCCCGACCCATACATGTT
GTGCTGGGAAATGAAGCCTGTGACTTGGACTCCATGGTGTCAGCCCTTGCCCTGGCTTTT
TACCTGGCAAAGACAACTGAGGCGGAGGAAGTCTTTGTGCCAGTGTTAAATATAAAACGT
TCAGAGCTACCTCTACGAGGTGACAATGTCTTCTTCCTTCAGAAGATTCACATTCCAGAG
TCCGTCTTGATTTTCCGGGATGAGATTGACCTCCATGCACTGCACCAGGCTGGCCAGCTC
ACCCTCATCCTTGTTGACCATCATGTCTTACCCAAAAGTGACGCAGCCCTAGAGGAGGCA
GTGGCAGAGGTGCTAGACCATCGGCCCATCGATCAGAGACACTGCCCTCCCTGCCATGTT
TCAGTTGAACTGGTGGGGTCCTGCGCTACCCTGGTGGCCGAGAGAATCCTGCAGGGGGCA
CCAGAGATCTTGGACAGGCAAACTGCAGCCCTTCTTCATGGAACAATCCTCCTGGACTGT
GTGAACATGGACCTTAAGATTGGAAAGGCAACCCTCAAGGACAGCCACTATGTAGAGAAG
CTGGAGGCCCTCTTCCCAGATCTGCCCAGCAGAAATGACATCTTTGATTCTCTGCAAAAG
GCCAAGTTTGATGTATCAGGACTGACCACAGAGCAGATGCTGAGAAAGGACCAGAAGACC
ATCTCCAGACAAGGCACTAAGGTGGCCATTAGTGCAATATATATGGATATGGAGGCTTTT
CTGCAGAGGTCTGGCCTCCTTGCAGATCTCCGTGCCTTCTGCCAGGCTCATAGCTACGAT
GCCCTGGTTGCCATGACTATCTTTTTCAACACTTACAATGAGCCAGTGCGGCAGTTGGCT
GTTTTCTGTCCCCACGCAGCACTTCGAATGACGATCTGTGGAATCCTGGAACATTCCCAC
TCTCCACCCCTGAAGCTGACCCCTGTCCCAAGCAGCCACCCTGACCTCCAAGCCTATCTT
CAAGGCAACACCCAGATCTCTCGAAAGAAAGTTCTGCCTCTGCTCCAGGAAGCCCTGTCA
GCGTATTTTGACTCCACGAACATCCCTTTAGGACAGCCTGAGACAGAGGGTGTGTCAAGG
GAACAGGTGGACAAAGAATTGGACAGGGCAGGCAACTCCCTGCTTTCTGGACTGAGTCAG
GATGAGGAGGAGCCTCCACTGCCCCCCACGCCCATGAACAGCCTGGTGGACGAGTGCCCC
CTGGATCAGGGGCTGCCGAAGTTCTCAGCCGAAGTCATCTTCGAGAAATGTAGTCAGATC
TCGCTGTCAGAACCTACCACTGCCTCCCTGTCTAAGAAATGA
Enzyme 52 GenBank Gene ID BT020783 Link Image
Enzyme 52 GeneCard ID PRUNE Link Image
Enzyme 52 GenAtlas ID Not Available
Enzyme 52 HGNC ID Not Available
Enzyme 52 Chromosome Location Chromosome:1
Enzyme 52 Locus 1q21
Enzyme 52 SNPs SNPJam Report Link Image
Enzyme 52 General References
  1. [PubMed Link Image]
Enzyme 52 Metabolite References Not Available
Enzyme 53 [top]
Enzyme 53 ID 653
Enzyme 53 Name N-acetyllactosaminide alpha-1,3-galactosyltransferase
Enzyme 53 Synonyms
  1. UDP-galactose:beta-D-galactosyl-1,4-N-acetyl-D-glucosaminide alpha-1,3-galactosyltransferase
  2. Galactosyltransferase
Enzyme 53 Gene Name GGTA1
Enzyme 53 Protein Sequence >N-acetyllactosaminide alpha-1,3-galactosyltransferase
MNVKGKVILSMLVVSTVIVVFWEYIHSPEGSLFWINPSRNPEVGGSSIQKGWWLPRWFNN
GYHEEDGDINEEKEQRNEDESKLKLSDWFNPFKRPEVVTMTKWKAPVVWEGTYNRAVLDN
YYAKQKITVGLTVFAVGRYIEHYLEEFLTSANKHFMVGHPVIFYIMVDDVSRMPLIELGP
LRSFKVFKIKPEKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLG
ESVAQLQAWWYKADPNDFTYERRKESAAYIPFGEGDFYYHAAIFGGTPTQVLNITQECFK
GILKDKKNDIEAQWHDESHLNKYFLLNKPTKILSPEYCWDYHIGLPADIKLVKMSWQTKE
YNVVRNNV
Enzyme 53 Number of Residues 368
Enzyme 53 Molecular Weight 43246.3
Enzyme 53 Theoretical pI 6.52
Enzyme 53 GO Classification
Function
Process
Component
Enzyme 53 General Function Involved in manganese ion binding
Enzyme 53 Specific Function Transfer of galactose from UDP-galactose to an acceptor molecule (R)
Enzyme 53 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 53 Reactions Not Available
Enzyme 53 Pfam Domain Function
Enzyme 53 Signals
  • None
Enzyme 53 Transmembrane Regions
  • 7-22
Enzyme 53 Essentiality Not Available
Enzyme 53 GenBank ID Protein 163124 Link Image
Enzyme 53 UniProtKB/Swiss-Prot ID P14769 Link Image
Enzyme 53 UniProtKB/Swiss-Prot Entry Name GGTA1_BOVIN Link Image
Enzyme 53 PDB ID 1O7Q Link Image
Enzyme 53 PDB File Show
Enzyme 53 3D Structure
Enzyme 53 Cellular Location Not Available
Enzyme 53 Gene Sequence >1107 bp
GCAGACGATGAGGAGAAAATAATGAATGTCAAAGGAAAAGTGATTCTGTCAATGCTGGTT
GTCTCAACTGTCATTGTTGTGTTTTGGGAATATATCCACAGCCCAGAAGGCTCTTTGTTC
TGGATAAACCCATCAAGAAACCCAGAAGTTGGTGGCAGCAGCATTCAGAAGGGCTGGTGG
CTTCCGAGATGGTTTAACAATGGTTACCATGAAGAAGATGGAGACATAAACGAAGAAAAG
GAACAAAGAAACGAAGACGAAAGCAAGCTTAAGCTATCGGACTGGTTCAACCCATTTAAA
CGCCCCGAGGTTGTGACCATGACGAAGTGGAAGGCTCCAGTGGTGTGGGAAGGCACTTAC
AACAGAGCCGTCTTAGACAATTATTATGCCAAGCAGAAAATTACCGTCGGCCTGACGGTT
TTCGCCGTCGGAAGATACATTGAGCATTACTTGGAGGAGTTCTTAACGTCTGCTAATAAG
CACTTCATGGTGGGCCACCCAGTCATCTTTTATATCATGGTAGATGATGTCTCCAGGATG
CCTTTGATAGAGTTGGGTCCTCTGCGCTCCTTCAAAGTGTTTAAGATCAAGCCTGAGAAG
AGGTGGCAGGACATCAGCATGATGCGCATGAAGACTATCGGGGAGCACATTGTGGCCCAC
ATCCAGCATGAGGTTGACTTCCTTTTCTGCATGGATGTGGACCAGGTCTTCCAAGACAAG
TTTGGGGTGGAGACCCTGGGCGAGTCGGTGGCCCAGCTACAAGCCTGGTGGTACAAGGCA
GATCCCAATGACTTCACCTACGAGAGGCGGAAGGAGTCTGCAGCATACATTCCCTTCGGC
GAAGGGGATTTTTATTACCATGCAGCCATTTTTGGGGGAACACCCACTCAGGTCCTTAAC
ATCACCCAGGAATGCTTCAAAGGAATCCTCAAGGACAAGAAAAATGACATAGAAGCCCAA
TGGCATGATGAAAGCCATCTAAACAAGTATTTCCTTCTCAACAAACCTACTAAAATCTTA
TCCCCGGAATACTGCTGGGATTATCACATAGGCCTACCTGCGGATATTAAGCTTGTCAAG
ATGTCTTGGCAGACAAAAGAGTATAAT
Enzyme 53 GenBank Gene ID J04989 Link Image
Enzyme 53 GeneCard ID GGTA1 Link Image
Enzyme 53 GenAtlas ID Not Available
Enzyme 53 HGNC ID Not Available
Enzyme 53 Chromosome Location Chromosome:9
Enzyme 53 Locus 9q33.2-q34.11
Enzyme 53 SNPs SNPJam Report Link Image
Enzyme 53 General References
  1. [PubMed Link Image]
Enzyme 53 Metabolite References Not Available
Enzyme 54 [top]
Enzyme 54 ID 654
Enzyme 54 Name Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
Enzyme 54 Synonyms
  1. PP2A-beta
Enzyme 54 Gene Name PPP2CB
Enzyme 54 Protein Sequence >Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
MDDKAFTKDLDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
Enzyme 54 Number of Residues 309
Enzyme 54 Molecular Weight 35560.8
Enzyme 54 Theoretical pI 5.08
Enzyme 54 GO Classification
Function
Process
Component
Enzyme 54 General Function Signal transduction mechanisms
Enzyme 54 Specific Function PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase
Enzyme 54 Pathways Not Available
Enzyme 54 Reactions Not Available
Enzyme 54 Pfam Domain Function
Enzyme 54 Signals
  • None
Enzyme 54 Transmembrane Regions
  • None
Enzyme 54 Essentiality Not Available
Enzyme 54 GenBank ID Protein 112362154 Link Image
Enzyme 54 UniProtKB/Swiss-Prot ID Q0P594 Link Image
Enzyme 54 UniProtKB/Swiss-Prot Entry Name PP2AB_BOVIN Link Image
Enzyme 54 PDB ID Not Available
Enzyme 54 Cellular Location Not Available
Enzyme 54 Gene Sequence >930 bp
ATGGACGACAAGGCGTTCACTAAGGACCTGGACCAGTGGGTCGAACAGCTGAATGAGTGT
AAACAGCTCAACGAGAACCAAGTCCGGACGCTGTGTGAAAAGGCTAAGGAAATTTTAACA
AAAGAATCAAATGTACAAGAGGTCCGTTGTCCTGTCACCGTCTGTGGAGATGTGCATGGC
CAATTCCACGACCTTATGGAACTCTTCAGGATCGGTGGGAAGTCACCAGACACAAACTAT
CTGTTCATGGGCGACTATGTAGACAGAGGTTATTATTCTGTGGAAACGGTAACTCTTCTT
GTGGCATTAAAGGTGCGTTATCCAGAGCGCATTACAATACTGAGAGGAAACCACGAAAGC
CGACAAATTACCCAAGTTTATGGCTTTTATGACGAATGTCTGCGAAAGTATGGAAATGCC
AATGTTTGGAAATATTTTACAGATCTCTTTGATTATCTGCCACTTACAGCTTTAGTAGAT
GGACAGATATTCTGCCTCCATGGTGGCCTCTCTCCATCCATAGATACACTGGATCATATA
AGAGCCCTGGATCGTTTACAAGAAGTTCCACATGAGGGCCCGATGTGTGATCTCTTATGG
TCAGATCCAGATGATCGTGGTGGGTGGGGTATTTCACCACGTGGTGCTGGCTACACATTT
GGACAAGATATTTCTGAAACGTTTAACCATGCTAATGGTCTCACACTGGTTTCTCGTGCT
CACCAACTTGTAATGGAGGGATACAATTGGTGTCACGATCGGAACGTGGTTACCATTTTC
AGTGCACCCAATTACTGTTATCGTTGTGGGAACCAGGCTGCTATCATGGAATTAGATGAC
ACTTTGAAATATTCCTTCCTTCAGTTTGACCCAGCACCTCGTCGTGGAGAGCCTCATGTG
ACCCGGCGCACCCCAGACTACTTCCTGTAA
Enzyme 54 GenBank Gene ID BC120332 Link Image
Enzyme 54 GeneCard ID PPP2CB Link Image
Enzyme 54 GenAtlas ID Not Available
Enzyme 54 HGNC ID Not Available
Enzyme 54 Chromosome Location Chromosome:8
Enzyme 54 Locus 8p12
Enzyme 54 SNPs SNPJam Report Link Image
Enzyme 54 General References Not Available
Enzyme 54 Metabolite References Not Available