We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Rumen Metabolome Database



Showing metabocard for Putrescine (RMDB01414)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-08-27 15:15:57
Accession Number RMDB01414
Common Name Putrescine
Description Putrescine is a polyamine. Putrescine is related to cadaverine (another polyamine). Both are produced by the breakdown of amino acids in living and dead organisms and both are toxic in large doses. Putrescine and cadaverine are largely responsible for the foul odor of putrefying flesh, but also contribute to the odor of such processes as bad breath and bacterial vaginosis. Putrescine is also found in semen. Putrescine attacks s-adenosyl methionine and converts it to spermidine. Spermidine in turn attacks another s-adenosyl methionine and converts it to spermine. Putrescine is synthesized in small quantities by healthy living cells by the action of ornithine decarboxylase. The polyamines, of which putrescine is one of the simplest, appear to be growth factors necessary for cell division. Putrescine apparently has specific role in skin physiology and neuroprotection. (PMID: 15009201, 16364196). Pharmacological interventions have demonstrated convincingly that a steady supply of polyamines is a prerequisite for cell proliferation to occur. Genetic engineering of polyamine metabolism in transgenic rodents has shown that polyamines play a role in spermatogenesis, skin physiology, promotion of tumorigenesis and organ hypertrophy as well as neuronal protection. Transgenic activation of polyamine catabolism not only profoundly disturbs polyamine homeostasis in most tissues, but also creates a complex phenotype affecting skin, female fertility, fat depots, pancreatic integrity and regenerative growth. Transgenic expression of ornithine decarboxylase antizyme has suggested that this unique protein may act as a general tumor suppressor. Homozygous deficiency of the key biosynthetic enzymes of the polyamines, ornithine and S-adenosylmethionine decarboxylase is not compatible with murine embryogenesis.
Synonyms
  1. 1,4-Butanediamine
  2. 1,4-Butylenediamine
  3. 1,4-Diaminobutane
  4. 1,4-Tetramethylenediamine
  5. Butylenediamine
  6. Putrescin
  7. Tetramethyldiamine
  8. Tetramethylenediamine
Chemical IUPAC Name butane-1,4-diamine
Chemical Formula C4H12N2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amines
Class
  • Polyamines
Sub Class
  • Putrescines
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine)
Biofunction
  • RNA component; Component of Arginine and proline metabolism; Component of beta-Alanine metabolism; Component of Glycine, serine and threonine metabolism; Component of Histidine metabolism; Component of Methane metabolism; Component of Phenylalanine metabolism; Component of Tryptophan metabolism; Component of Tyrosine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 88.151
Monoisotopic Molecular Weight 88.100044
Isomeric SMILES NCCCCN
Canonical SMILES NCCCCN
KEGG Compound ID C00134 Link Image
BioCyc ID PUTRESCINE Link Image
BiGG ID 33980 Link Image
Wikipedia Link Putrescine Link Image
METLIN ID 3226 Link Image
PubChem Compound 1045 Link Image
PubChem Substance 17436307 Link Image
ChEBI ID 17148 Link Image
CAS Registry Number 110-60-1
InChI Identifier InChI=1/C4H12N2/c5-3-1-2-4-6/h1-6H2
Synthesis Reference Dudley, H. W.; Thorpe, W. V. Synthesis of N-methylputrescine and of putrescine. Biochemical Journal (1925), 19 845-9.
Melting Point (Experimental) 27.5 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1000 mg/mL at 25 oC [MEYLAN,WM et al. (1996)]; 235.99998 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 2
State Solid
Experimental LogP/Hydrophobicity -0.70 [SANGSTER (1994)] Source: PhysProp
Predicted LogP/Hydrophobicity -0.98 [Predicted by ALOGPS]; -0.6 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID 1A99 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • mitochondria
Biofluid Location
  • Rumen
Tissue Location
Concentrations (Normal)
Biofluid Rumen
Value 26.31 +/- 12.21 uM
Age 4-5 years old
Sex Female (lactating)
Condition Normal (0% barley grain in dry matter (DM) basis)
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 52 +/- 17 uM
Age 4-5 years old
Sex Female (lactating)
Condition 15% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 122 +/- 29 uM
Age 4-5 years old
Sex Female (lactating)
Condition 30% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 214 +/- 89 uM
Age 4-5 years old
Sex Female (lactating)
Condition 45% barley grain in dry matter (DM) basis
Breed Holstein-Friesian
Experimental Condition Rumen fluid for the analysis was collected 15-20 minutes before the morning feeding on days 12 and 21 of each experimental period. Cows were fed once daily at 0800.
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
  2. Ornithine decarboxylase
  3. Ornithine decarboxylase
Enzyme 1 [top]
Enzyme 1 ID 128
Enzyme 1 Name Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
Enzyme 1 Synonyms
  1. Polyamine oxidase
Enzyme 1 Gene Name PAOX
Enzyme 1 Protein Sequence >Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
MQSGGRQAEAPGRGPRVLVVGGGIAGLGAAQRLCRHPAFSHLRVLEATARAGGRIRSEHS
FGGVVEVGAHWIHGPSQGNPVFQLAAKYGLLGEKALSEENQLIETGGHVGLPSVSYASSG
VSVSLELVAEMASLFYSLIDQTREFLQAAETTPPSVGEYLKEKIRQHMAGWTEDEETKKL
KLAILKNLFNVECCVSGTHSMDLVALAPFGEYTVLPGLDCTFPEGYQGLTDCIMASLPKD
VMVFDKPVKTIHWNGSFREASAPGETFPVLVECEDGDCFPAHHVVVTVPLGFFKKHLDTF
FEPPLPTEKVEAIRKIGFGTNNKIFLEFEEPFWEPDCQHIQVVWEDMSPLEDTAPELQDA
WFKKLIGFWVLPPFQASHVLCGFIAGLESEFMETLSDEDVLRSLTQVLRRVTGNPQLPAP
RSMLRSCWHSAPYTRGSYSYVAVGSSGDDMDRLAQPLPSDGKGAQLQVLFAGEATHRTFY
STTHGALLSGWREADRLMTLWDPQAQWPEPRL
Enzyme 1 Number of Residues 512
Enzyme 1 Molecular Weight 56324.7
Enzyme 1 Theoretical pI 5.23
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in electron carrier activity
Enzyme 1 Specific Function Flavoenzyme which catalyzes the oxidation of N(1)- acetylspermine to spermidine and is thus involved in the polyamine back-conversion. Can also oxidize N(1)-acetylspermidine to putrescine. Substrate specificity:N(1)-acetylspermine = N(1)- acetylspermidine > N(1),N(12)-diacylspermine >> spermine. Does not oxidize spermidine. Plays an important role in the regulation of polyamine intracellular concentration
Enzyme 1 Pathways
  • Amine and polyamine metabolism
  • spermine metabolism
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 67944519 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q865R1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name PAOX_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1539 bp
ATGCAGTCGGGTGGTCGTCAGGCGGAAGCCCCGGGCCGCGGCCCGCGGGTGCTGGTCGTG
GGCGGCGGCATCGCGGGGCTGGGGGCGGCGCAGAGGCTCTGCCGCCACCCGGCCTTCTCA
CACCTTCGGGTTCTGGAGGCCACGGCCCGCGCCGGTGGCCGCATCCGCTCGGAGCACAGC
TTCGGTGGCGTGGTGGAGGTAGGTGCTCACTGGATCCATGGGCCCTCCCAGGGCAACCCC
GTCTTCCAGCTGGCTGCCAAATACGGGCTGCTTGGGGAGAAGGCCCTGTCCGAGGAGAAC
CAGCTGATCGAGACCGGAGGTCACGTGGGCCTGCCATCTGTGTCTTACGCCAGCTCTGGG
GTAAGTGTGAGCCTTGAGCTCGTGGCGGAGATGGCCAGTCTGTTCTACAGTCTCATAGAC
CAGACCAGGGAGTTCCTGCAGGCGGCTGAGACCACCCCACCCAGTGTCGGGGAGTACCTC
AAGGAGAAGATCCGTCAGCACATGGCTGGCTGGACAGAGGATGAGGAGACCAAGAAGCTC
AAACTGGCCATCCTGAAGAACTTGTTCAACGTGGAGTGCTGTGTGAGCGGTACCCACAGC
ATGGACCTGGTTGCCCTCGCGCCTTTCGGGGAGTACACTGTGCTGCCAGGGCTGGACTGC
ACCTTTCCTGAGGGCTACCAAGGACTCACAGACTGCATCATGGCCTCCTTGCCCAAGGAC
GTGATGGTTTTTGACAAACCCGTGAAGACCATTCACTGGAATGGGTCCTTCCGGGAAGCT
TCTGCTCCTGGGGAGACATTTCCCGTGCTGGTGGAATGTGAGGATGGAGACTGCTTCCCA
GCCCATCACGTGGTCGTCACCGTGCCCTTAGGTTTTTTTAAGAAGCATCTGGACACCTTC
TTTGAGCCACCACTGCCCACTGAAAAGGTGGAAGCGATCAGGAAAATAGGCTTTGGGACG
AACAATAAAATCTTCTTGGAGTTTGAGGAGCCCTTCTGGGAGCCAGACTGCCAGCACATC
CAGGTGGTGTGGGAGGACATGTCGCCCCTGGAGGATACCGCCCCCGAGCTGCAGGATGCC
TGGTTCAAGAAGCTGATTGGCTTCTGGGTCCTGCCTCCCTTCCAGGCCAGCCACGTGCTC
TGTGGCTTTATCGCGGGGCTCGAGTCCGAGTTCATGGAGACACTGTCGGACGAGGACGTG
CTCAGGTCTCTGACGCAGGTGCTCCGCAGGGTGACAGGGAACCCCCAGCTCCCCGCACCC
AGGAGTATGCTGAGGTCCTGCTGGCACAGCGCCCCGTACACCCGGGGCTCATACAGCTAC
GTGGCCGTGGGCAGCTCTGGGGACGACATGGACCGGCTGGCCCAGCCCCTCCCTTCAGAC
GGCAAGGGGGCACAGCTCCAGGTACTGTTCGCAGGGGAAGCCACACACCGGACGTTTTAT
TCCACCACACACGGGGCTCTGCTGTCTGGCTGGAGGGAGGCTGACCGGCTCATGACGCTG
TGGGACCCCCAGGCCCAGTGGCCCGAGCCCAGGCTCTGA
Enzyme 1 GenBank Gene ID DQ058607 Link Image
Enzyme 1 GeneCard ID PAOX Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 10q26.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 922
Enzyme 2 Name Ornithine decarboxylase
Enzyme 2 Synonyms
  1. ODC
Enzyme 2 Gene Name ODC1
Enzyme 2 Protein Sequence >Ornithine decarboxylase
MNSFSNEEFDCHFLDEGFTAKDILDQKINEVSYSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQ
TGSDDEEESTDRTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQLMQQI
RTQDFPPGVEEPDVGPLPVSCAWESGMKRHSAACASTRINV
Enzyme 2 Number of Residues 461
Enzyme 2 Molecular Weight 51345.1
Enzyme 2 Theoretical pI 5.12
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function L-ornithine = putrescine + CO(2)
Enzyme 2 Pathways
  • Amine and polyamine biosynthesis
  • putrescine biosynthesis via L-ornithine pathway
  • putrescine from L-ornithine:step 1/1
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 163449 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P27117 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DCOR_BOVIN Link Image
Enzyme 2 PDB ID 1D7K Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1386 bp
ATGAACAGCTTTAGCAATGAAGAGTTTGACTGCCATTTCTTGGATGAAGGCTTTACTGCC
AAGGATATTCTGGACCAAAAAATTAATGAAGTTTCTTATTCTGATGATAAGGATGCCTTC
TATGTTGCGGACCTGGGAGACATTCTGAAGAAACATCTGAGATGGTTGAAAGCTCTTCCT
CGGGTCACCCCCTTTTATGCCGTCAAATGCAATGATAGCAGAACCATAGTGAAGACACTC
GCTGCCATTGGGACAGGATTTGACTGTGCCAGCAAGACTGAAATACAATTGGTGCAGAGT
CTCGGGGTGCCCCCAGAGAGGATTATCTATGCAAATCCATGTAAACAAGTGTCTCAGATT
AAGTATGCTGCCAATAACGGAGTCCAGATGATGACTTTTGATAGTGAAGTTGAGCTGATG
AAAGTTGCCAGGGCACATCCAAAGGCCAAGTTGGTTTTACGGATCGCCACTGATGATTCC
AAAGCAGTCTGTCGCCTCAGTGTCAAATTTGGTGCCACACTCAAAACCAGCAGGCTTCTT
TTGGAACGGGCGAAAGAGCTAGATATTGATGTCATTGGTGTCAGCTTCCACGTGGGAAGT
GGCTGTACTGATCCTGAGACCTTTGTGCAGGCCATCTCTGATGCCCGCTGTGTCTTTGAC
ATGGGCGCTGAGGTTGGTTTCAACATGTATCTGCTTGATATTGGTGGTGGCTTTCCTGGA
TCAGAGGATGTAAAGCTTAAATTTGAAGAGATCACCAGTGTAATCAACCCAGCACTGGAC
AAGTATTTTCCATCAGACTCTGGAGTGAGAATCATAGCTGAGCCAGGCAGATACTATGTT
GCATCAGCTTTCACGCTCGCAGTTAATATTATTGCCAAAAAACTTGTATTAAAGGAACAG
ACAGGCTCTGATGATGAAGAGGAGTCAACTGATCGGACATTTATGTATTATGTGAACGAT
GGAGTATATGGGTCATTCAACTGCATCCTTTATGATCACGCACACGTGAAGCCTCTTCTG
CAGAAGAGACCCAAACCAGATGAGAAGTATTATTCATCCAGCATCTGGGGACCGACCTGT
GACGGCCTGGACCGCATTGTTGAGCGCTGTAACCTGCCTGAGATGCATGTGGGTGATTGG
ATGCTCTTTGAGAACATGGGTGCTTACACTGTTGCTGCTGCTTCTACCTTCAATGGATTC
CAGAGACCCACCATCTACTATGTGATGTCAGGGCCAACGTGGCAACTGATGCAGCAGATC
CGGACCCAGGACTTCCCGCCTGGAGTGGAGGAGCCGGACGTCGGTCCCCTGCCCGTGTCC
TGTGCCTGGGAGAGCGGCATGAAGCGGCACTCGGCAGCCTGCGCTTCCACGCGTATTAAC
GTGTAG
Enzyme 2 GenBank Gene ID M92441 Link Image
Enzyme 2 GeneCard ID ODC1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 2p25
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 923
Enzyme 3 Name Ornithine decarboxylase
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name ADC
Enzyme 3 Protein Sequence >Ornithine decarboxylase
MAGYLRETDFVMVEEGFSTRDLLEELTLGASQATTEEVAAFFVADLGAVVRKHFCFLKCL
PRVRSFYAVKCNSSPGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIIYANPCKQIAH
IKYAAKHGVRLLSFDNEMELAKVVKSHPSAKMVLCVATEDSHSLSRLSLKFGASLKSCRH
LLENAKRDHVEVVGVSFHIGSDCPDPQAYAQSIADARVVFEMGAELGHRMHILDLGGGFP
GVEDAKVRFEEIASVINSALDLYFPEGCGVDILAKLGRYYVTSAFTLAVSIIAKKEVLLD
QPGREEETSSSPKSVVYHLGEGVYGVFNSVLFDSACPAPILQKKPSTEQPLYSSSLWGPV
ASGCDCVAEGLWLPQLHVGDWLVFENMGAYTVGVGSLLRGAQTCRITYAMSRVAWEALQG
QLLPAEQDEDAEGMCKPLSCGWEITDTLCMGPVFTPASIMCIPETLASGTSQVEQTTPRT
SLPAPRSRVGSALVLGEVLAGI
Enzyme 3 Number of Residues 502
Enzyme 3 Molecular Weight 54146.8
Enzyme 3 Theoretical pI 5.46
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Amino acid transport and metabolism
Enzyme 3 Specific Function L-ornithine = putrescine + CO(2)
Enzyme 3 Pathways
  • Amine and polyamine biosynthesis
  • putrescine biosynthesis via L-ornithine pathway
  • putrescine from L-ornithine:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 83638748 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2TBX3 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name Q2TBX3_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1509 bp
ATGGCTGGCTACCTGAGAGAAACGGACTTTGTGATGGTGGAGGAGGGTTTCAGCACCCGA
GACCTGCTGGAGGAGCTCACTCTGGGGGCCTCACAGGCCACCACGGAAGAGGTTGCTGCC
TTCTTCGTGGCCGACCTGGGTGCCGTGGTGAGGAAGCACTTCTGCTTTCTGAAGTGCCTG
CCTCGAGTCCGATCCTTTTACGCTGTCAAGTGCAACAGCAGCCCGGGCGTGCTGAAGGTC
CTGGCCGAGCTGGGGCTGGGCTTCAGCTGTGCCAACAAGGCAGAGATGGAGTTGGTCCAG
CATATTGGTGTCCCTGCCAGTAAGATCATCTATGCCAATCCCTGTAAGCAAATTGCACAC
ATCAAGTATGCTGCCAAGCACGGGGTCCGGCTGCTGAGCTTTGACAACGAGATGGAGCTG
GCAAAGGTGGTGAAAAGCCACCCCAGTGCCAAGATGGTTCTGTGCGTTGCCACGGAGGAC
TCCCACTCTCTGAGCCGCCTGAGCCTCAAGTTCGGAGCCTCGCTGAAATCTTGCCGACAC
CTGCTTGAGAATGCCAAGAGGGACCATGTAGAGGTGGTAGGTGTGAGTTTTCACATTGGC
AGTGACTGTCCTGACCCTCAGGCCTACGCTCAGTCCATTGCGGACGCCCGGGTTGTGTTC
GAAATGGGTGCTGAGCTGGGCCACAGGATGCACATCCTGGACCTTGGTGGCGGCTTCCCC
GGAGTGGAGGACGCCAAAGTGAGATTCGAGGAGATTGCTTCTGTGATCAACTCAGCCTTG
GACCTATACTTCCCGGAGGGCTGCGGTGTGGACATCCTTGCCAAGCTGGGGCGCTACTAC
GTGACCTCGGCCTTCACCTTGGCAGTCAGCATCATTGCCAAGAAGGAGGTTCTTCTGGAT
CAGCCAGGCAGGGAGGAGGAAACCAGTTCCTCCCCCAAGAGCGTTGTGTACCACCTTGGC
GAGGGCGTGTATGGAGTCTTCAACTCAGTCCTGTTTGACAGCGCCTGCCCCGCCCCCATC
CTGCAGAAGAAACCATCCACGGAACAGCCCCTGTACAGCAGCAGCCTGTGGGGCCCGGTG
GCCAGTGGCTGTGACTGCGTAGCTGAGGGCTTGTGGCTGCCGCAACTACACGTAGGGGAC
TGGCTGGTCTTTGAGAACATGGGCGCCTACACCGTGGGCGTGGGTTCCCTCCTCAGGGGT
GCCCAGACCTGCCGCATCACCTATGCCATGTCCCGGGTGGCCTGGGAAGCCCTGCAAGGG
CAGCTGCTGCCTGCAGAACAGGACGAGGACGCCGAGGGCATGTGCAAGCCTCTGTCCTGT
GGCTGGGAGATCACGGACACCTTGTGCATGGGCCCCGTCTTCACCCCGGCGAGCATCATG
TGTATTCCAGAGACACTTGCTTCAGGGACTTCTCAGGTGGAGCAAACCACCCCGAGGACG
TCCCTCCCCGCTCCGAGGAGTCGCGTGGGAAGCGCGCTAGTCCTCGGAGAGGTTCTCGCT
GGAATATGA
Enzyme 3 GenBank Gene ID BC109524 Link Image
Enzyme 3 GeneCard ID ADC Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1p33-p34.3
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available